F469593

General Info

Members Datasets Scaffolds Average Seq Length
616 524 266 227

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2791355253|2793282592
Length 245
Sequence TPAPGTDPERLAPAGASQDAALPGDEDTVDYPADGKTGGNGRLCIVTRESQPVEALIRFVAGPDGQVVPDLKRQLPGRGCWVTARRSMVDQAVKRKLFARGLKAPVKAAEDLGEVVDRLLCADLAGMINLARKAGQFTTGSSKVDQAVRSLAALAVFHASDAAADGVRKISQARKASSFAAEDGSEIPAFRFFSAEEGDVLFGSNSFIHAAALAGQAGEGVVKRATMLDKYRDTVAMGASRQLTS

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
5 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
6 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
7 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
8 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
9 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
10 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
11 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
12 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
13 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
14 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
15 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
16 2516143018 Ensifer sp. BR816 Isolate Nodule
17 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
18 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
19 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
20 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
21 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
22 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
23 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
24 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
25 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
26 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
27 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
28 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
29 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
30 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
31 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
32 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
33 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
34 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
35 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
36 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
37 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
38 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
39 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
40 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
41 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
42 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
43 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
44 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
45 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
46 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
47 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
48 2643221557 Ensifer sp. Root558 Isolate Unclassified
49 2643221558 Rhizobium sp. Root149 Isolate Unclassified
50 2643221582 Rhizobium sp. Root651 Isolate Unclassified
51 2643221599 Rhizobium sp. Root708 Isolate Unclassified
52 2643221607 Rhizobium sp. Root73 Isolate Unclassified
53 2643221610 Ensifer sp. Root74 Isolate Unclassified
54 2643221618 Ensifer sp. Root231 Isolate Unclassified
55 2643221626 Ensifer sp. Root31 Isolate Unclassified
56 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
57 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
58 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
59 2643221655 Ensifer sp. Root1252 Isolate Unclassified
60 2643221659 Ensifer sp. Root127 Isolate Unclassified
61 2643221668 Ensifer sp. Root423 Isolate Unclassified
62 2643221675 Ensifer sp. Root1298 Isolate Unclassified
63 2643221680 Ensifer sp. Root1312 Isolate Unclassified
64 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
65 2643221688 Rhizobium sp. Root482 Isolate Unclassified
66 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
67 2643221693 Rhizobium sp. Root491 Isolate Unclassified
68 2643221698 Ensifer sp. Root142 Isolate Unclassified
69 2643221712 Ensifer sp. Root258 Isolate Unclassified
70 2643221718 Rhizobium sp. Root268 Isolate Unclassified
71 2643221719 Rhizobium sp. Root274 Isolate Unclassified
72 2643221723 Ensifer sp. Root278 Isolate Unclassified
73 2643221726 Ensifer sp. Root954 Isolate Unclassified
74 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
75 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
76 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
77 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
78 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
79 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
80 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
81 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
82 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
83 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
84 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
85 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
86 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
87 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
88 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
89 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
90 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
91 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
92 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
93 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
94 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
95 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
96 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
97 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
98 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
99 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
100 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
101 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
102 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
103 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
104 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
105 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
106 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
107 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
108 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
109 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
110 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
111 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
112 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
113 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
114 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
115 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
116 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
117 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
118 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
119 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
120 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
121 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
122 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
123 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
124 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
125 2844163670 Ensifer sp. 1H6 Isolate Unclassified
126 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
127 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
128 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
129 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
130 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
131 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
132 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
133 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
134 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
135 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
136 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
137 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
138 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
139 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
140 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
141 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
142 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
143 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
144 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
145 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
146 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
147 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
148 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
149 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
150 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
151 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
152 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
153 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
154 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
155 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
156 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
157 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
158 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
159 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
160 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
161 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
162 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
163 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
164 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
165 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
166 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
167 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
168 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
169 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
170 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
171 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
172 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
173 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
174 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
175 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
176 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
177 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
178 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
179 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
180 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
181 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
182 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
183 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
184 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
185 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
186 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
187 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
188 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
189 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
190 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
191 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
192 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
193 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
194 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
195 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
196 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
197 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
198 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
199 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
200 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
201 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
202 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
203 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
204 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
205 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
206 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
207 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
208 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
209 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
210 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
211 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
212 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
213 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
214 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
215 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
216 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
217 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
218 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
219 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
220 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
221 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
222 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
223 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
224 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
225 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
226 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
227 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
228 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
229 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
230 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
231 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
232 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
233 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
234 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
235 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
236 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
237 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
238 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
239 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
240 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
241 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
242 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
243 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
244 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
245 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
246 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
247 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
248 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
249 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
250 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
251 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
252 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
253 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
254 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
255 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
256 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
257 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
258 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
259 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
260 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
261 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
262 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
263 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
264 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
265 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
266 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
267 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
268 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
269 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
270 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
271 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
272 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
273 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
274 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
275 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
276 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
277 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
278 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
279 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
280 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
281 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
282 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
283 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
284 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
285 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
286 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
287 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
288 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
289 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
290 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
291 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
292 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
293 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
294 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
295 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
296 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
297 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
298 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
299 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
300 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
301 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
302 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
303 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
304 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
305 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
306 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
307 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
308 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
309 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
310 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
311 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
312 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
313 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
314 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
315 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
316 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
317 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
318 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
319 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
320 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
321 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
322 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
323 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
324 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
325 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
326 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
327 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
328 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
329 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
330 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
331 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
332 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
333 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
334 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
335 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
336 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
337 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
338 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
339 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
340 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
341 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
342 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
343 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
344 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
345 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
346 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
347 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
348 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
349 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
350 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
351 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
352 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
353 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
354 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
355 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
356 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
357 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
358 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
359 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
360 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
361 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
362 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
363 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
364 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
365 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
366 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
367 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
368 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
369 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
370 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
371 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
372 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
373 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
374 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
375 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
376 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
377 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
378 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
379 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
380 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
381 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
382 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
383 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
384 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
385 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
386 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
387 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
388 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
389 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
390 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
391 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
392 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
393 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
397 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
398 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
399 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
400 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
402 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
403 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
404 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
405 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
406 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
407 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
408 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
409 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
410 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
411 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
412 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
413 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
414 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
415 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
416 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
417 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
418 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
419 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
420 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
421 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
422 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
423 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
424 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
425 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
426 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
427 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
428 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
429 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
430 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
431 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
432 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
433 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
434 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
435 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
436 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
437 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
438 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
439 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
440 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
441 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
442 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
443 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
444 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
445 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
446 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
447 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
448 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
449 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
450 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
451 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
452 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
453 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
454 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
455 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
456 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
457 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
458 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
459 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
460 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
461 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
462 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
463 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
464 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
465 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
466 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
467 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
468 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
470 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
471 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
474 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
476 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
478 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
479 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
480 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
481 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
482 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
483 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
484 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
485 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
486 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
487 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
488 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
489 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
490 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
491 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
492 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
493 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
494 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
495 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
496 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
497 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
498 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
499 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
500 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
501 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
506 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
507 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
508 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
509 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
510 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
511 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
512 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
513 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
514 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
515 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
516 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
517 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
518 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
519 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
520 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
521 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
522 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
523 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
524 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 42.37
Metatranscriptomes 0.81
Isolates 56.82

Biome Distribution

Category Percentage (%)
Aerial Root 0.49
Bulb 0
Endosphere 15.1
Nodule 42.37
Rhizoplane 2.27
Rhizosphere 18.34
Stem 0
Stem Tuber 0
Unclassified 21.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000069 3300002704 Bacteria 64645
2 JGI25156J39149_1000095 3300002705 Bacteria 64645
3 JGI25154J39366_1000737 3300002738 Bacteria 14685
4 JGI25157J39369_1000216 3300002741 Bacteria 47231
5 JGI25159J45721_1000192 3300002987 Bacteria 28420
6 JGI25151J46595_10003061 3300003187 Bacteria 9452
7 JGI25151J46595_10025492 3300003187 Bacteria 2406
8 JGI25151J46595_10033052 3300003187 Bacteria 1998
9 rootH2_10015912 3300003320 Bacteria 2400
10 rootH2_10181262 3300003320 Bacteria 1136
11 rootH1_10037831 3300003323 Bacteria 1799
12 JGI25160J50197_1000003 3300003354 Bacteria 482719
13 JGI25160J50197_1000287 3300003354 Bacteria 36528
14 JGI25161J50226_1000176 3300003374 Bacteria 42677
15 JGI25161J50226_1000299 3300003374 Bacteria 27879
16 Ga0055526_1003881 3300003771 Bacteria 9270
17 Ga0055524_1008392 3300003775 Bacteria 4295
18 Ga0055536_1007369 3300003781 Bacteria 4939
19 Ga0055536_1009111 3300003781 Bacteria 4162
20 Ga0055530_10014888 3300003791 Bacteria 2567
21 Ga0055530_10030323 3300003791 Bacteria 1434
22 Ga0055540_1003768 3300003792 Bacteria 7149
23 Ga0055531_10004782 3300003794 Bacteria 8095
24 Ga0055543_1000114 3300004625 Bacteria 69144
25 Ga0055543_1001880 3300004625 Bacteria 7632
26 Ga0065165_1000047 3300005262 Bacteria 197811
27 Ga0065165_1000511 3300005262 Bacteria 59722
28 Ga0070665_100000937 3300005548 Bacteria 37328
29 Ga0075365_10004993 3300006038 Bacteria 7104
30 Ga0075365_10192580 3300006038 Bacteria 1427
31 Ga0075368_10000580 3300006042 Bacteria 10999
32 Ga0075363_100005802 3300006048 Bacteria 5545
33 Ga0075363_100149468 3300006048 Bacteria 1318
34 Ga0075364_10001311 3300006051 Bacteria 13387
35 Ga0075364_10022285 3300006051 Bacteria 3998
36 Ga0075364_10056667 3300006051 Bacteria 2566
37 Ga0075364_10326552 3300006051 Bacteria 1045
38 Ga0075362_10001149 3300006177 Bacteria 8271
39 Ga0075367_10022729 3300006178 Bacteria 3520
40 Ga0075367_10077307 3300006178 Bacteria 2009
41 Ga0075369_10024687 3300006186 Bacteria 2493
42 Ga0075369_10085838 3300006186 Bacteria 1400
43 Ga0075366_10006955 3300006195 Bacteria 6229
44 Ga0075366_10281146 3300006195 Bacteria 1017
45 Ga0075370_10063693 3300006353 Bacteria 2102
46 Ga0075370_10204617 3300006353 Bacteria 1165
47 Ga0079104_1000125 3300006946 Bacteria 110104
48 Ga0079104_1000777 3300006946 Bacteria 27197
49 Ga0105246_10061544 3300011119 Bacteria 2612
50 Ga0157373_10109308 3300013100 Bacteria 1944
51 Ga0157371_10000004 3300013102 Bacteria 512593
52 Ga0157371_10207679 3300013102 Bacteria 1405
53 Ga0157370_10001506 3300013104 Bacteria 28774
54 Ga0157370_10101625 3300013104 Bacteria 2693
55 Ga0157369_10031233 3300013105 Bacteria 5867
56 Ga0171463_1001 3300013249 Bacteria 1406070
57 Ga0163162_10870853 3300013306 Bacteria 1015
58 Ga0157372_11173888 3300013307 Bacteria 887
59 Ga0183363_1053 3300015690 Bacteria 36839
60 Ga0214544_1000434 3300021320 Bacteria 75507
61 Ga0214542_1000146 3300021321 Bacteria 103035
62 Ga0214542_1011454 3300021321 Bacteria 12129
63 Ga0214543_1000049 3300021327 Bacteria 149506
64 Ga0214543_1000054 3300021327 Bacteria 140288
65 Ga0228711_1000006 3300022739 Bacteria 202437
66 Ga0228710_1000004 3300022740 Bacteria 250560
67 Ga0209435_100049 3300025206 Bacteria 92067
68 Ga0209436_102607 3300025208 Bacteria 5289
69 Ga0209436_105698 3300025208 Bacteria 2822
70 Ga0209672_102811 3300025228 Bacteria 3965
71 Ga0209437_100376 3300025233 Bacteria 45400
72 Ga0209646_1000159 3300025246 Bacteria 92067
73 Ga0209646_1004347 3300025246 Bacteria 2591
74 Ga0209026_1000183 3300025250 Bacteria 92067
75 Ga0209759_1000206 3300025256 Bacteria 92067
76 Ga0209233_1000423 3300025261 Bacteria 31308
77 Ga0209455_1013063 3300025272 Bacteria 1948
78 Ga0209130_1000005 3300025284 Bacteria 599620
79 Ga0209130_1000377 3300025284 Bacteria 50153
80 Ga0209130_1020194 3300025284 Bacteria 1530
81 Ga0209676_1002658 3300025292 Bacteria 12146
82 Ga0209676_1004825 3300025292 Bacteria 7321
83 Ga0209025_1000037 3300025294 Bacteria 383429
84 Ga0209025_1000553 3300025294 Bacteria 69760
85 Ga0209025_1012810 3300025294 Bacteria 5334
86 Ga0209025_1043903 3300025294 Bacteria 1876
87 Ga0209564_1000113 3300025295 Bacteria 211564
88 Ga0209758_1001799 3300025297 Bacteria 23675
89 Ga0209758_1021605 3300025297 Bacteria 2993
90 Ga0209050_1006969 3300025298 Bacteria 6511
91 Ga0209050_1020810 3300025298 Bacteria 2422
92 Ga0209256_1000779 3300025299 Bacteria 41192
93 Ga0207426_1000015 3300025302 Bacteria 599316
94 Ga0207426_1000330 3300025302 Bacteria 89992
95 Ga0209051_1000574 3300025303 Bacteria 44189
96 Ga0209051_1003992 3300025303 Bacteria 9367
97 Ga0209257_1004397 3300025304 Bacteria 10948
98 Ga0209257_1008447 3300025304 Bacteria 5851
99 Ga0209257_1036704 3300025304 Bacteria 1502
100 Ga0207681_10104953 3300025923 Bacteria 2045
101 Ga0207709_10025163 3300025935 Bacteria 3406
102 Ga0207668_10317085 3300025972 Bacteria 1292
103 Ga0209281_1000102 3300027111 Bacteria 221665
104 Ga0209281_1000242 3300027111 Bacteria 110116
105 Ga0209281_1000695 3300027111 Bacteria 34292
106 Ga0209371_1000009 3300027312 Bacteria 963030
107 Ga0209371_1002721 3300027312 Bacteria 9525
108 Ga0209371_1003521 3300027312 Bacteria 7544
109 Ga0209371_1007312 3300027312 Bacteria 3873
110 Ga0209282_1000013 3300027666 Bacteria 215053
111 Ga0209282_1017023 3300027666 Bacteria 4623
112 Ga0209813_10002444 3300027866 Bacteria 4253
113 Ga0268266_10004006 3300028379 Bacteria 14250
114 Ga0307515_10000029 3300028794 Bacteria 365410
115 Ga0307515_10001299 3300028794 Bacteria 56720
116 Ga0307515_10013457 3300028794 Bacteria 15291
117 Ga0268256_1000010 3300030500 Bacteria 963034
118 Ga0268256_1004458 3300030500 Bacteria 5795
119 Ga0316181_1071942 3300030744 Bacteria 2284
120 Ga0307513_10014973 3300031456 Bacteria 9419
121 Ga0307408_100077851 3300031548 Bacteria 2470
122 Ga0307408_100105519 3300031548 Bacteria 2154
123 Ga0307413_10141612 3300031824 Bacteria 1663
124 Ga0307410_10064321 3300031852 Bacteria 2520
125 Ga0307410_10180457 3300031852 Bacteria 1598
126 Ga0307412_10022874 3300031911 Bacteria 3838
127 Ga0315914_1000004 3300031967 Bacteria 288534
128 Ga0307409_100097464 3300031995 Bacteria 2429
129 Ga0307409_100100191 3300031995 Bacteria 2401
130 Ga0307414_10031027 3300032004 Bacteria 3499
131 Ga0307414_10661224 3300032004 Bacteria 943
132 Ga0315913_1000011 3300033430 Bacteria 140532
133 Ga0315915_1000003 3300033464 Bacteria 407996
134 Ga0373927_0000057 3300035695 Bacteria 80218
135 Ga0373925_0006596 3300037068 Bacteria 8527
136 Ga0395905_0069428 3300037471 Bacteria 3300
137 Ga0436363_0014225 3300039450 Bacteria 4317
138 Ga0439436_0008780 3300041404 Bacteria 3102
139 Ga0439439_0016930 3300041406 Bacteria 1789
140 Ga0439447_034557 3300041407 Bacteria 1256
141 Ga0439465_0014530 3300041413 Bacteria 2454
142 Ga0439465_0105297 3300041413 Bacteria 977
143 Ga0451837_0665125 3300041494 Bacteria 833
144 Ga0439431_0044702 3300041997 Bacteria 1136
145 Ga0439433_0049451 3300041999 Bacteria 989
146 Ga0439433_0079928 3300041999 Bacteria 794
147 Ga0439449_0004780 3300042007 Bacteria 5228
148 Ga0439462_0022286 3300042015 Bacteria 1656
149 Ga0450920_012815 3300042122 Bacteria 1575
150 Ga0450923_026839 3300042125 Bacteria 1155
151 Ga0450906_009638 3300042145 Bacteria 1836
152 Ga0450908_022446 3300042184 Bacteria 1106
153 Ga0439434_0054283 3300042435 Bacteria 1246
154 Ga0466965_0140861 3300044683 Bacteria 1255
155 Ga0466960_0261221 3300044901 Bacteria 965
156 Ga0495592_0177916 3300046454 Bacteria 1451
157 Ga0495638_0036481 3300046460 Bacteria 3132
158 Ga0495638_0047557 3300046460 Bacteria 2689
159 Ga0495651_0125840 3300046462 Bacteria 1877
160 Ga0495662_0032746 3300046476 Bacteria 2511
161 Ga0495607_0117908 3300046501 Bacteria 1398
162 Ga0495610_0080327 3300046512 Bacteria 1499
163 Ga0495632_0112964 3300046519 Bacteria 1274
164 Ga0495643_0185087 3300046522 Bacteria 1009
165 Ga0495652_0155862 3300046529 Bacteria 1779
166 Ga0495654_0020779 3300046530 Bacteria 3419
167 Ga0495622_0028242 3300046557 Bacteria 2619
168 Ga0495633_0050426 3300046558 Bacteria 1962
169 Ga0495635_0140641 3300046663 Bacteria 1644
170 Ga0495588_0041804 3300046674 Bacteria 2342
171 Ga0495588_0053591 3300046674 Bacteria 2080
172 Ga0495600_0014290 3300046809 Bacteria 5001
173 Ga0495604_0046705 3300047317 Bacteria 3376
174 Ga0495681_0027022 3300047470 Bacteria 2976
175 Ga0495686_0256200 3300047472 Bacteria 981
176 Ga0496104_0281215 3300048907 Bacteria 1577
177 Ga0496111_0053371 3300048914 Bacteria 2920
178 Ga0496113_0124369 3300048916 Bacteria 2019
179 Ga0496114_0106688 3300048917 Bacteria 2397
180 Ga0496115_0596283 3300048918 Bacteria 879
181 Ga0496116_0046609 3300048919 Bacteria 2924
182 Ga0496116_0051897 3300048919 Bacteria 2720
183 Ga0496117_0000002 3300048920 Bacteria 2483758
184 Ga0496117_0007528 3300048920 Bacteria 10614
185 Ga0496117_0058034 3300048920 Bacteria 2683
186 Ga0496118_0001144 3300048921 Bacteria 40942
187 Ga0496118_0082894 3300048921 Bacteria 2244
188 Ga0496118_0091110 3300048921 Bacteria 2098
189 Ga0496118_0092612 3300048921 Bacteria 2073
190 Ga0496118_0096181 3300048921 Bacteria 2019
191 Ga0496119_0052789 3300048922 Bacteria 2487
192 Ga0496119_0137169 3300048922 Bacteria 1325
193 Ga0496119_0183209 3300048922 Bacteria 1097
194 Ga0496120_0000897 3300048923 Bacteria 41807
195 Ga0496120_0013272 3300048923 Bacteria 5556
196 Ga0496120_0056191 3300048923 Bacteria 2223
197 Ga0496120_0064145 3300048923 Bacteria 2040
198 Ga0496121_0000001 3300048924 Bacteria 1830318
199 Ga0496121_0079582 3300048924 Bacteria 2601
200 Ga0496121_0095491 3300048924 Bacteria 2310
201 Ga0496122_0000001 3300048925 Bacteria 1827766
202 Ga0496122_0000147 3300048925 Bacteria 165589
203 Ga0496122_0043000 3300048925 Bacteria 3545
204 Ga0496122_0059782 3300048925 Bacteria 2811
205 Ga0496123_0000001 3300048926 Bacteria 1831497
206 Ga0496123_0000339 3300048926 Bacteria 88118
207 Ga0496123_0042086 3300048926 Bacteria 3157
208 Ga0496123_0049704 3300048926 Bacteria 2808
209 Ga0496124_0000855 3300048927 Bacteria 49698
210 Ga0496124_0005152 3300048927 Bacteria 14874
211 Ga0496124_0044402 3300048927 Bacteria 3813
212 Ga0496124_0046150 3300048927 Bacteria 3732
213 Ga0496124_0075078 3300048927 Bacteria 2793
214 Ga0496125_0000001 3300048928 Bacteria 1766138
215 Ga0496125_0000299 3300048928 Bacteria 97532
216 Ga0496125_0048956 3300048928 Bacteria 3517
217 Ga0496126_0007868 3300048929 Bacteria 11604
218 Ga0496126_0008341 3300048929 Bacteria 11182
219 Ga0496126_0091131 3300048929 Bacteria 2681
220 Ga0496126_0267696 3300048929 Bacteria 1419
221 Ga0501306_002664 3300049127 Bacteria 1857
222 Ga0495678_083882 3300049459 Bacteria 1138
223 Ga0501300_019002 3300049523 Bacteria 1004
224 Ga0501032_0043399 3300049569 Bacteria 3046
225 Ga0501034_0609531 3300049571 Bacteria 996
226 Ga0501036_0224438 3300049572 Bacteria 1577
227 Ga0501036_0298988 3300049572 Bacteria 1346
228 Ga0501037_0152901 3300049573 Bacteria 1648
229 Ga0501039_0300406 3300049575 Bacteria 1262
230 Ga0501043_0154101 3300049579 Bacteria 1797
231 Ga0501073_0099817 3300049589 Bacteria 2016
232 Ga0501080_0108616 3300049742 Bacteria 2571
233 Ga0501276_011039 3300049773 Bacteria 766
234 Ga0501280_008486 3300049776 Bacteria 1431
235 Ga0501035_0110137 3300049822 Bacteria 2413
236 nmdc:mga03683_10158_c1 3300050489 Bacteria 3371
237 nmdc:mga03n38_4766_c1 3300050490 Bacteria 4535
238 nmdc:mga00v17_102_c1 3300050491 Bacteria 50732
239 nmdc:mga00v17_271563_c1 3300050491 Bacteria 1100
240 nmdc:mga00v17_34302_c1 3300050491 Bacteria 3013
241 nmdc:mga00v17_81726_c1 3300050491 Bacteria 2019
242 nmdc:mga0yw44_1468_c1 3300050492 Bacteria 9385
243 nmdc:mga0k408_244480_c1 3300050493 Bacteria 1072
244 nmdc:mga07m45_93523_c1 3300050496 Bacteria 1724
245 nmdc:mga0sz30_22228_c1 3300050516 Bacteria 2573
246 nmdc:mga0sz30_53142_c1 3300050516 Bacteria 1721
247 Ga0495619_0142330 3300053085 Bacteria 1652
248 Ga0500560_021899 3300053107 Bacteria 1833
249 Ga0500572_030457 3300053111 Bacteria 1500
250 Ga0500608_058479 3300053122 Bacteria 1846
251 Ga0500618_007341 3300053125 Bacteria 3152
252 Ga0500618_022420 3300053125 Bacteria 1534
253 Ga0500655_040144 3300053133 Bacteria 917
254 Ga0500561_0003326 3300053137 Bacteria 2800
255 Ga0500590_032623 3300053148 Bacteria 2701
256 Ga0500616_0045975 3300053153 Bacteria 2322
257 Ga0500624_002137 3300053157 Bacteria 2747
258 Ga0500624_011822 3300053157 Bacteria 1281
259 Ga0500634_0005672 3300053161 Bacteria 5955
260 Ga0500634_0047361 3300053161 Bacteria 2321
261 Ga0500636_0000094 3300053177 Bacteria 44967
262 Ga0500636_0047373 3300053177 Bacteria 2532
263 Ga0587077_004245 3300059493 Bacteria 1869
264 Ga0587090_000399 3300059510 Bacteria 3516
265 Ga0587068_000617 3300059641 Bacteria 3408
266 Ga0587072_000562 3300059643 Bacteria 3878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006048 Ga0075363_100149468 Ga0075363_1001494682 201
2 3300031548 Ga0307408_100105519 Ga0307408_1001055192 201
3 3300042122 Ga0450920_012815 Ga0450920_012815_205_888 201
4 3300042125 Ga0450923_026839 Ga0450923_026839_290_973 201
5 3300006195 Ga0075366_10281146 Ga0075366_102811462 205
6 3300028794 Ga0307515_10001299 Ga0307515_1000129947 205
7 3300035695 Ga0373927_0000057 Ga0373927_0000057_52454_53074 205
8 3300037068 Ga0373925_0006596 Ga0373925_0006596_3855_4475 205
9 3300041494 Ga0451837_0665125 Ga0451837_0665125_91_714 205
10 3300048921 Ga0496118_0096181 Ga0496118_0096181_32_652 206
11 3300049572 Ga0501036_0298988 Ga0501036_0298988_701_1321 206
12 3300003320 rootH2_10181262 rootH2_101812622 208
13 3300003323 rootH1_10037831 rootH1_100378312 208
14 3300032004 Ga0307414_10661224 Ga0307414_106612241 208
15 3300046460 Ga0495638_0036481 Ga0495638_0036481_1322_1957 208
16 3300048929 Ga0496126_0267696 Ga0496126_0267696_257_889 208
17 3300037471 Ga0395905_0069428 Ga0395905_0069428_1298_1948 210
18 3300046460 Ga0495638_0047557 Ga0495638_0047557_1400_2050 210
19 3300053122 Ga0500608_058479 Ga0500608_058479_530_1180 210
20 3300025294 Ga0209025_1043903 Ga0209025_10439032 211
21 3300025304 Ga0209257_1036704 Ga0209257_10367042 211
22 3300041404 Ga0439436_0008780 Ga0439436_0008780_1794_2477 211
23 3300041406 Ga0439439_0016930 Ga0439439_0016930_1034_1717 211
24 3300041407 Ga0439447_034557 Ga0439447_034557_138_821 211
25 3300041413 Ga0439465_0014530 Ga0439465_0014530_1126_1809 211
26 3300041997 Ga0439431_0044702 Ga0439431_0044702_230_910 211
27 3300041999 Ga0439433_0079928 Ga0439433_0079928_50_733 211
28 3300042015 Ga0439462_0022286 Ga0439462_0022286_948_1631 211
29 3300042145 Ga0450906_009638 Ga0450906_009638_50_733 211
30 3300042184 Ga0450908_022446 Ga0450908_022446_184_867 211
31 3300042435 Ga0439434_0054283 Ga0439434_0054283_309_992 211
32 iso_pu_bacteria 2989349275 2989351541 213
33 3300006946 Ga0079104_1000777 Ga0079104_100077714 214
34 3300022739 Ga0228711_1000006 Ga0228711_100000661 214
35 3300022740 Ga0228710_1000004 Ga0228710_1000004109 214
36 3300027111 Ga0209281_1000102 Ga0209281_100010244 214
37 3300027666 Ga0209282_1000013 Ga0209282_100001379 214
38 3300031967 Ga0315914_1000004 Ga0315914_1000004114 214
39 3300033430 Ga0315913_1000011 Ga0315913_100001176 214
40 3300033464 Ga0315915_1000003 Ga0315915_1000003221 214
41 iso_pu_bacteria 2891373044 2891375052 214
42 3300031824 Ga0307413_10141612 Ga0307413_101416122 215
43 iso_pu_bacteria 3003930520 3003931406 215
44 3300025299 Ga0209256_1000779 Ga0209256_100077948 216
45 3300049523 Ga0501300_019002 Ga0501300_019002_256_939 216
46 3300049776 Ga0501280_008486 Ga0501280_008486_362_1045 216
47 iso_pu_bacteria 8054558443 8054562464 216
48 3300003187 JGI25151J46595_10033052 JGI25151J46595_100330522 217
49 3300003794 Ga0055531_10004782 Ga0055531_100047822 217
50 3300025294 Ga0209025_1000037 Ga0209025_1000037303 217
51 3300046454 Ga0495592_0177916 Ga0495592_0177916_453_1145 217
52 3300046462 Ga0495651_0125840 Ga0495651_0125840_651_1343 217
53 3300046476 Ga0495662_0032746 Ga0495662_0032746_393_1085 217
54 3300046529 Ga0495652_0155862 Ga0495652_0155862_609_1301 217
55 3300046557 Ga0495622_0028242 Ga0495622_0028242_599_1291 217
56 3300046663 Ga0495635_0140641 Ga0495635_0140641_371_1063 217
57 3300046674 Ga0495588_0053591 Ga0495588_0053591_529_1221 217
58 3300046809 Ga0495600_0014290 Ga0495600_0014290_3240_3932 217
59 3300047317 Ga0495604_0046705 Ga0495604_0046705_2132_2824 217
60 3300048920 Ga0496117_0007528 Ga0496117_0007528_1200_1856 217
61 3300048921 Ga0496118_0091110 Ga0496118_0091110_521_1177 217
62 3300048923 Ga0496120_0056191 Ga0496120_0056191_1070_1726 217
63 3300048925 Ga0496122_0000147 Ga0496122_0000147_68866_69522 217
64 3300048926 Ga0496123_0000339 Ga0496123_0000339_79138_79794 217
65 3300048927 Ga0496124_0046150 Ga0496124_0046150_2445_3101 217
66 3300048928 Ga0496125_0000299 Ga0496125_0000299_1785_2441 217
67 3300048929 Ga0496126_0007868 Ga0496126_0007868_2220_2876 217
68 3300049569 Ga0501032_0043399 Ga0501032_0043399_1058_1711 217
69 3300049571 Ga0501034_0609531 Ga0501034_0609531_59_712 217
70 3300049572 Ga0501036_0224438 Ga0501036_0224438_186_839 217
71 3300049573 Ga0501037_0152901 Ga0501037_0152901_534_1187 217
72 3300049579 Ga0501043_0154101 Ga0501043_0154101_977_1630 217
73 3300049822 Ga0501035_0110137 Ga0501035_0110137_1574_2227 217
74 3300053085 Ga0495619_0142330 Ga0495619_0142330_271_963 217
75 3300053148 Ga0500590_032623 Ga0500590_032623_1456_2148 217
76 3300002987 JGI25159J45721_1000192 JGI25159J45721_100019218 218
77 3300003187 JGI25151J46595_10003061 JGI25151J46595_100030618 218
78 3300003187 JGI25151J46595_10025492 JGI25151J46595_100254922 218
79 3300003354 JGI25160J50197_1000003 JGI25160J50197_10000039 218
80 3300003374 JGI25161J50226_1000299 JGI25161J50226_100029923 218
81 3300003771 Ga0055526_1003881 Ga0055526_10038817 218
82 3300003775 Ga0055524_1008392 Ga0055524_10083923 218
83 3300003781 Ga0055536_1009111 Ga0055536_10091114 218
84 3300003791 Ga0055530_10014888 Ga0055530_100148882 218
85 3300004625 Ga0055543_1001880 Ga0055543_10018805 218
86 3300005262 Ga0065165_1000047 Ga0065165_1000047129 218
87 3300025208 Ga0209436_102607 Ga0209436_1026072 218
88 3300025284 Ga0209130_1000005 Ga0209130_1000005471 218
89 3300025292 Ga0209676_1004825 Ga0209676_10048254 218
90 3300025294 Ga0209025_1012810 Ga0209025_10128102 218
91 3300025295 Ga0209564_1000113 Ga0209564_1000113162 218
92 3300025298 Ga0209050_1006969 Ga0209050_10069692 218
93 3300025302 Ga0207426_1000015 Ga0207426_1000015128 218
94 3300025303 Ga0209051_1003992 Ga0209051_10039922 218
95 3300025304 Ga0209257_1004397 Ga0209257_10043977 218
96 3300049589 Ga0501073_0099817 Ga0501073_0099817_169_858 218
97 iso_pu_bacteria 2600254933 2600376818 218
98 3300028794 Ga0307515_10000029 Ga0307515_1000002922 219
99 3300031456 Ga0307513_10014973 Ga0307513_100149733 219
100 3300039450 Ga0436363_0014225 Ga0436363_0014225_1907_2614 219
101 iso_pu_bacteria 2643221637 2644207301 220
102 iso_pu_bacteria 2643221718 2644650949 220
103 iso_pu_bacteria 2791355094 2792637606 220
104 iso_pu_bacteria 8018150411 8018151100 220
105 iso_pu_bacteria 8056875544 8056878578 220
106 3300013100 Ga0157373_10109308 Ga0157373_101093081 221
107 3300048929 Ga0496126_0008341 Ga0496126_0008341_1064_1732 221
108 iso_pu_bacteria 2513237159 2513996239 221
109 iso_pu_bacteria 2516143018 2516204842 221
110 iso_pu_bacteria 2558860983 2561467860 221
111 iso_pu_bacteria 2582581283 2585164407 221
112 iso_pu_bacteria 2582581306 2585264703 221
113 iso_pu_bacteria 2582581865 2585386226 221
114 iso_pu_bacteria 2582581866 2585394835 221
115 iso_pu_bacteria 2643221607 2644051654 221
116 iso_pu_bacteria 2643221636 2644200137 221
117 iso_pu_bacteria 2643221686 2644480523 221
118 iso_pu_bacteria 2643221688 2644495340 221
119 iso_pu_bacteria 2643221689 2644498764 221
120 iso_pu_bacteria 2751185821 2753459965 221
121 iso_pu_bacteria 2842521101 2842521196 221
122 iso_pu_bacteria 8055431914 8055433836 221
123 3300013102 Ga0157371_10207679 Ga0157371_102076792 222
124 3300013104 Ga0157370_10101625 Ga0157370_101016252 222
125 3300013105 Ga0157369_10031233 Ga0157369_100312334 222
126 iso_pu_bacteria 2510917026 2511170006 222
127 iso_pu_bacteria 2585427633 2585998329 222
128 iso_pu_bacteria 2585427634 2586002891 222
129 iso_pu_bacteria 2599185236 2599718570 222
130 iso_pu_bacteria 2643221558 2643812431 222
131 iso_pu_bacteria 2818991461 2819685735 222
132 iso_pu_bacteria 2821123053 2821123122 222
133 iso_pu_bacteria 2838736955 2838739854 222
134 iso_pu_bacteria 2841840854 2841844022 222
135 iso_pu_bacteria 2842140634 2842143743 222
136 iso_pu_bacteria 2854896431 2854900953 222
137 iso_pu_bacteria 2854916844 2854918150 222
138 iso_pu_bacteria 2857531043 2857533925 222
139 iso_pu_bacteria 2919171160 2919172584 222
140 iso_pu_bacteria 2929138655 2929138908 222
141 3300013249 Ga0171463_1001 Ga0171463_10011274 223
142 3300015690 Ga0183363_1053 Ga0183363_105337 223
143 3300021320 Ga0214544_1000434 Ga0214544_100043423 223
144 3300021321 Ga0214542_1000146 Ga0214542_100014617 223
145 3300021321 Ga0214542_1011454 Ga0214542_10114544 223
146 3300021327 Ga0214543_1000049 Ga0214543_100004917 223
147 3300021327 Ga0214543_1000054 Ga0214543_100005479 223
148 3300027111 Ga0209281_1000695 Ga0209281_10006955 223
149 3300031852 Ga0307410_10064321 Ga0307410_100643212 223
150 3300031995 Ga0307409_100100191 Ga0307409_1001001912 223
151 3300041413 Ga0439465_0105297 Ga0439465_0105297_246_938 223
152 3300041999 Ga0439433_0049451 Ga0439433_0049451_206_898 223
153 3300042007 Ga0439449_0004780 Ga0439449_0004780_3302_3994 223
154 3300049127 Ga0501306_002664 Ga0501306_002664_598_1290 223
155 3300049575 Ga0501039_0300406 Ga0501039_0300406_197_886 223
156 3300049742 Ga0501080_0108616 Ga0501080_0108616_1602_2291 223
157 iso_pu_bacteria 2508501122 2509111510 223
158 iso_pu_bacteria 2509276019 2509375493 223
159 iso_pu_bacteria 2510065057 2510307104 223
160 iso_pu_bacteria 2511231052 2511498839 223
161 iso_pu_bacteria 2512047086 2512534975 223
162 iso_pu_bacteria 2513237086 2513587527 223
163 iso_pu_bacteria 2513237091 2513619066 223
164 iso_pu_bacteria 2513237140 2513882554 223
165 iso_pu_bacteria 2513237143 2513904538 223
166 iso_pu_bacteria 2515154107 2515607267 223
167 iso_pu_bacteria 2516653046 2516895117 223
168 iso_pu_bacteria 2524023207 2524452478 223
169 iso_pu_bacteria 2551306084 2551678031 223
170 iso_pu_bacteria 2551306085 2551685821 223
171 iso_pu_bacteria 2551306086 2551691713 223
172 iso_pu_bacteria 2551306087 2551700192 223
173 iso_pu_bacteria 2551306089 2551711570 223
174 iso_pu_bacteria 2551306090 2551716265 223
175 iso_pu_bacteria 2551306091 2551726491 223
176 iso_pu_bacteria 2551306092 2551738000 223
177 iso_pu_bacteria 2551306093 2551743345 223
178 iso_pu_bacteria 2558860100 2558866591 223
179 iso_pu_bacteria 2643221618 2644103815 223
180 iso_pu_bacteria 2643221626 2644144697 223
181 iso_pu_bacteria 2643221653 2644298122 223
182 iso_pu_bacteria 2643221655 2644306745 223
183 iso_pu_bacteria 2643221659 2644330937 223
184 iso_pu_bacteria 2643221698 2644541156 223
185 iso_pu_bacteria 2643221712 2644612356 223
186 iso_pu_bacteria 2643221719 2644656374 223
187 iso_pu_bacteria 2657244999 2657682777 223
188 iso_pu_bacteria 2690316117 2692320633 223
189 iso_pu_bacteria 2738541317 2738946802 223
190 iso_pu_bacteria 2791355082 2792583418 223
191 iso_pu_bacteria 2791355091 2792620960 223
192 iso_pu_bacteria 2791355092 2792625176 223
193 iso_pu_bacteria 2802429268 2804753998 223
194 iso_pu_bacteria 2818991272 2819244286 223
195 iso_pu_bacteria 2838074704 2838074867 223
196 iso_pu_bacteria 2844163670 2844164763 223
197 iso_pu_bacteria 2847417321 2847421261 223
198 iso_pu_bacteria 2848992105 2848996049 223
199 iso_pu_bacteria 2850079185 2850079440 223
200 iso_pu_bacteria 2855825444 2855827751 223
201 iso_pu_bacteria 2855839649 2855843126 223
202 iso_pu_bacteria 2855872281 2855877757 223
203 iso_pu_bacteria 2858800743 2858802858 223
204 iso_pu_bacteria 2896384573 2896388659 223
205 iso_pu_bacteria 2913295892 2913298405 223
206 iso_pu_bacteria 2913308742 2913311838 223
207 iso_pu_bacteria 2915986958 2915988034 223
208 iso_pu_bacteria 2915993759 2915999750 223
209 iso_pu_bacteria 2916000859 2916002260 223
210 iso_pu_bacteria 2916007675 2916013202 223
211 iso_pu_bacteria 2916014648 2916019674 223
212 iso_pu_bacteria 2916021584 2916022674 223
213 iso_pu_bacteria 2916028427 2916033431 223
214 iso_pu_bacteria 2916035215 2916037082 223
215 iso_pu_bacteria 2916041962 2916046985 223
216 iso_pu_bacteria 2916048683 2916054932 223
217 iso_pu_bacteria 2916055098 2916056729 223
218 iso_pu_bacteria 2916068649 2916073135 223
219 iso_pu_bacteria 2916076590 2916080721 223
220 iso_pu_bacteria 2920760137 2920763887 223
221 iso_pu_bacteria 2920822456 2920822809 223
222 iso_pu_bacteria 2921201388 2921207889 223
223 iso_pu_bacteria 2921208531 2921214799 223
224 iso_pu_bacteria 2921237296 2921238524 223
225 iso_pu_bacteria 2921244191 2921244374 223
226 iso_pu_bacteria 2921257292 2921261453 223
227 iso_pu_bacteria 2921263974 2921265831 223
228 iso_pu_bacteria 2921282425 2921286368 223
229 iso_pu_bacteria 2921289301 2921294734 223
230 iso_pu_bacteria 2921296804 2921299685 223
231 iso_pu_bacteria 2924144063 2924145320 223
232 iso_pu_bacteria 2924150972 2924155188 223
233 iso_pu_bacteria 2924158325 2924162514 223
234 iso_pu_bacteria 2924165586 2924172116 223
235 iso_pu_bacteria 2924172951 2924177667 223
236 iso_pu_bacteria 2924179722 2924182781 223
237 iso_pu_bacteria 2924186466 2924187238 223
238 iso_pu_bacteria 2924193448 2924197296 223
239 iso_pu_bacteria 2924200457 2924202141 223
240 iso_pu_bacteria 2924207177 2924210995 223
241 iso_pu_bacteria 2924214083 2924220716 223
242 iso_pu_bacteria 2924221636 2924225195 223
243 iso_pu_bacteria 2924228884 2924230399 223
244 iso_pu_bacteria 2936996657 2936998744 223
245 iso_pu_bacteria 2937002841 2937005804 223
246 iso_pu_bacteria 2937009748 2937010509 223
247 iso_pu_bacteria 2937016420 2937017312 223
248 iso_pu_bacteria 2937023124 2937025640 223
249 iso_pu_bacteria 2937042894 2937045685 223
250 iso_pu_bacteria 2937049772 2937054857 223
251 iso_pu_bacteria 2937056579 2937062789 223
252 iso_pu_bacteria 2937063883 2937070878 223
253 iso_pu_bacteria 2937071275 2937076162 223
254 iso_pu_bacteria 2937091812 2937096669 223
255 iso_pu_bacteria 2937098957 2937104458 223
256 iso_pu_bacteria 2937106411 2937111659 223
257 iso_pu_bacteria 2937113482 2937115881 223
258 iso_pu_bacteria 2937119839 2937122123 223
259 iso_pu_bacteria 2937126314 2937130815 223
260 iso_pu_bacteria 2941499720 2941504043 223
261 iso_pu_bacteria 2957382221 2957383304 223
262 iso_pu_bacteria 2957388812 2957390601 223
263 iso_pu_bacteria 2957395598 2957401446 223
264 iso_pu_bacteria 2957402308 2957407370 223
265 iso_pu_bacteria 2957408893 2957409963 223
266 iso_pu_bacteria 2957422303 2957426723 223
267 iso_pu_bacteria 2957430029 2957435150 223
268 iso_pu_bacteria 2957443900 2957447792 223
269 iso_pu_bacteria 2957450854 2957451824 223
270 iso_pu_bacteria 2957457609 2957460728 223
271 iso_pu_bacteria 2957464669 2957468056 223
272 iso_pu_bacteria 2957471148 2957475912 223
273 iso_pu_bacteria 2957478035 2957481823 223
274 iso_pu_bacteria 2957484790 2957490826 223
275 iso_pu_bacteria 2957491536 2957492750 223
276 iso_pu_bacteria 2957498199 2957502953 223
277 iso_pu_bacteria 2957505466 2957510820 223
278 iso_pu_bacteria 2960584000 2960585940 223
279 iso_pu_bacteria 2960597568 2960600916 223
280 iso_pu_bacteria 2960603979 2960607738 223
281 iso_pu_bacteria 2960610863 2960615647 223
282 iso_pu_bacteria 2960617483 2960620922 223
283 iso_pu_bacteria 2960624210 2960626212 223
284 iso_pu_bacteria 2960637947 2960640400 223
285 iso_pu_bacteria 2960645483 2960650827 223
286 iso_pu_bacteria 2960652885 2960656392 223
287 iso_pu_bacteria 2960660292 2960664281 223
288 iso_pu_bacteria 2960667422 2960670929 223
289 iso_pu_bacteria 2960674078 2960677450 223
290 iso_pu_bacteria 2960687367 2960692778 223
291 iso_pu_bacteria 2964607997 2964614913 223
292 iso_pu_bacteria 2964615318 2964618239 223
293 iso_pu_bacteria 2964621998 2964627381 223
294 iso_pu_bacteria 2964628898 2964631536 223
295 iso_pu_bacteria 2964636051 2964641348 223
296 iso_pu_bacteria 2964643177 2964645461 223
297 iso_pu_bacteria 2964649959 2964651380 223
298 iso_pu_bacteria 2964656573 2964662949 223
299 iso_pu_bacteria 2964663802 2964668661 223
300 iso_pu_bacteria 2964670856 2964673554 223
301 iso_pu_bacteria 2964678106 2964682263 223
302 iso_pu_bacteria 2964685014 2964690647 223
303 iso_pu_bacteria 2964691889 2964695205 223
304 iso_pu_bacteria 2964698721 2964699984 223
305 iso_pu_bacteria 2964705432 2964710010 223
306 iso_pu_bacteria 2964712639 2964716088 223
307 iso_pu_bacteria 2964719344 2964725876 223
308 iso_pu_bacteria 2967664464 2967669292 223
309 iso_pu_bacteria 2967671571 2967676757 223
310 iso_pu_bacteria 2967678726 2967683488 223
311 iso_pu_bacteria 2967693043 2967694579 223
312 iso_pu_bacteria 2967699805 2967704370 223
313 iso_pu_bacteria 2967706974 2967707430 223
314 iso_pu_bacteria 2967714385 2967716271 223
315 iso_pu_bacteria 2967721400 2967725883 223
316 iso_pu_bacteria 2967735183 2967740918 223
317 iso_pu_bacteria 2967742019 2967748147 223
318 iso_pu_bacteria 2967748971 2967751528 223
319 iso_pu_bacteria 2967755722 2967758496 223
320 iso_pu_bacteria 2967762386 2967766378 223
321 iso_pu_bacteria 2967769361 2967771901 223
322 iso_pu_bacteria 2967775926 2967776953 223
323 iso_pu_bacteria 2970019648 2970020882 223
324 iso_pu_bacteria 2970033650 2970038049 223
325 iso_pu_bacteria 2970040964 2970046490 223
326 iso_pu_bacteria 2970047711 2970052153 223
327 iso_pu_bacteria 2970054988 2970056007 223
328 iso_pu_bacteria 2970061556 2970064601 223
329 iso_pu_bacteria 2970068827 2970073401 223
330 iso_pu_bacteria 2970076120 2970077159 223
331 iso_pu_bacteria 2970082768 2970085075 223
332 iso_pu_bacteria 2970088815 2970094292 223
333 iso_pu_bacteria 2970095765 2970099303 223
334 iso_pu_bacteria 2970102677 2970106251 223
335 iso_pu_bacteria 2970109326 2970112606 223
336 iso_pu_bacteria 2970116247 2970118883 223
337 iso_pu_bacteria 2970129317 2970130912 223
338 iso_pu_bacteria 2970136068 2970139356 223
339 iso_pu_bacteria 2970149975 2970153315 223
340 iso_pu_bacteria 2970156795 2970160467 223
341 iso_pu_bacteria 2970164137 2970165631 223
342 iso_pu_bacteria 2970170962 2970172254 223
343 iso_pu_bacteria 2970177841 2970182096 223
344 iso_pu_bacteria 2970184632 2970190687 223
345 iso_pu_bacteria 2970191845 2970194391 223
346 iso_pu_bacteria 2977516862 2977522203 223
347 iso_pu_bacteria 2977537788 2977538791 223
348 iso_pu_bacteria 2977551784 2977556327 223
349 iso_pu_bacteria 2977558990 2977561862 223
350 iso_pu_bacteria 2977565890 2977570602 223
351 iso_pu_bacteria 2977572785 2977576283 223
352 iso_pu_bacteria 2977579622 2977581055 223
353 iso_pu_bacteria 2989776772 2989776938 223
354 iso_pu_bacteria 643692032 643827751 223
355 iso_pu_bacteria 648276728 648738272 223
356 iso_pu_bacteria 8003992118 8003995712 223
357 iso_pu_bacteria 8005246636 8005248035 223
358 iso_pu_bacteria 8049293176 8049296604 223
359 3300025284 Ga0209130_1020194 Ga0209130_10201942 224
360 3300028794 Ga0307515_10013457 Ga0307515_1001345712 224
361 3300031548 Ga0307408_100077851 Ga0307408_1000778512 224
362 3300031852 Ga0307410_10180457 Ga0307410_101804571 224
363 3300031911 Ga0307412_10022874 Ga0307412_100228742 224
364 3300031995 Ga0307409_100097464 Ga0307409_1000974642 224
365 3300032004 Ga0307414_10031027 Ga0307414_100310273 224
366 3300053157 Ga0500624_011822 Ga0500624_011822_29_715 224
367 iso_pu_bacteria 2599185156 2599332641 224
368 iso_pu_bacteria 2842922631 2842922916 224
369 iso_pu_bacteria 2899803654 2899808344 224
370 iso_pu_bacteria 2933016740 2933022038 224
371 iso_pu_bacteria 3005445848 3005449979 224
372 iso_pu_bacteria 8005658619 8005661430 224
373 3300003781 Ga0055536_1007369 Ga0055536_10073692 225
374 3300003791 Ga0055530_10030323 Ga0055530_100303232 225
375 3300003792 Ga0055540_1003768 Ga0055540_10037686 225
376 3300006051 Ga0075364_10022285 Ga0075364_100222852 225
377 3300006946 Ga0079104_1000125 Ga0079104_1000125100 225
378 3300025292 Ga0209676_1002658 Ga0209676_100265810 225
379 3300025297 Ga0209758_1001799 Ga0209758_100179915 225
380 3300025298 Ga0209050_1020810 Ga0209050_10208102 225
381 3300025303 Ga0209051_1000574 Ga0209051_100057410 225
382 3300025304 Ga0209257_1008447 Ga0209257_10084473 225
383 3300027111 Ga0209281_1000242 Ga0209281_100024297 225
384 3300044683 Ga0466965_0140861 Ga0466965_0140861_240_926 225
385 3300044901 Ga0466960_0261221 Ga0466960_0261221_258_944 225
386 3300046501 Ga0495607_0117908 Ga0495607_0117908_490_1179 225
387 3300046512 Ga0495610_0080327 Ga0495610_0080327_356_1045 225
388 3300046519 Ga0495632_0112964 Ga0495632_0112964_63_752 225
389 3300046522 Ga0495643_0185087 Ga0495643_0185087_288_977 225
390 3300046530 Ga0495654_0020779 Ga0495654_0020779_2180_2893 225
391 3300047472 Ga0495686_0256200 Ga0495686_0256200_134_847 225
392 3300048914 Ga0496111_0053371 Ga0496111_0053371_621_1325 225
393 3300048919 Ga0496116_0046609 Ga0496116_0046609_296_985 225
394 3300048921 Ga0496118_0092612 Ga0496118_0092612_720_1409 225
395 3300048922 Ga0496119_0052789 Ga0496119_0052789_1312_2001 225
396 3300048922 Ga0496119_0183209 Ga0496119_0183209_45_749 225
397 3300048923 Ga0496120_0013272 Ga0496120_0013272_655_1344 225
398 3300048924 Ga0496121_0000001 Ga0496121_0000001_351897_352586 225
399 3300048924 Ga0496121_0095491 Ga0496121_0095491_374_1063 225
400 3300048925 Ga0496122_0059782 Ga0496122_0059782_1495_2199 225
401 3300048926 Ga0496123_0042086 Ga0496123_0042086_1080_1769 225
402 3300048926 Ga0496123_0049704 Ga0496123_0049704_1486_2190 225
403 3300048927 Ga0496124_0005152 Ga0496124_0005152_6423_7112 225
404 3300048927 Ga0496124_0075078 Ga0496124_0075078_1514_2218 225
405 3300048928 Ga0496125_0000001 Ga0496125_0000001_463913_464602 225
406 3300049459 Ga0495678_083882 Ga0495678_083882_90_803 225
407 3300049773 Ga0501276_011039 Ga0501276_011039_46_750 225
408 3300050491 nmdc:mga00v17_81726_c1 nmdc:mga00v17_81726_c1_832_1521 225
409 3300053125 Ga0500618_007341 Ga0500618_007341_785_1498 225
410 3300053125 Ga0500618_022420 Ga0500618_022420_538_1227 225
411 3300053133 Ga0500655_040144 Ga0500655_040144_115_804 225
412 3300053153 Ga0500616_0045975 Ga0500616_0045975_413_1117 225
413 3300059493 Ga0587077_004245 Ga0587077_004245_763_1449 225
414 iso_pu_bacteria 2524023209 2524462152 225
415 iso_pu_bacteria 2599185352 2600195255 225
416 iso_pu_bacteria 2615840698 2616551712 225
417 iso_pu_bacteria 2643221557 2643805762 225
418 iso_pu_bacteria 2643221599 2644004245 225
419 iso_pu_bacteria 2643221610 2644065937 225
420 iso_pu_bacteria 2643221668 2644380242 225
421 iso_pu_bacteria 2643221675 2644417268 225
422 iso_pu_bacteria 2643221680 2644450664 225
423 iso_pu_bacteria 2643221723 2644671449 225
424 iso_pu_bacteria 2643221726 2644692911 225
425 iso_pu_bacteria 2775507049 2776915886 225
426 iso_pu_bacteria 2791355253 2793282592 225
427 iso_pu_bacteria 2818991448 2819613245 225
428 iso_pu_bacteria 2842298080 2842303510 225
429 iso_pu_bacteria 2842357229 2842362781 225
430 iso_pu_bacteria 2842509118 2842515331 225
431 iso_pu_bacteria 3005452660 3005456244 225
432 iso_pu_bacteria 8005682033 8005687724 225
433 iso_pu_bacteria 8054460903 8054463985 225
434 3300006051 Ga0075364_10001311 Ga0075364_1000131112 226
435 3300048924 Ga0496121_0079582 Ga0496121_0079582_1300_1992 226
436 3300050491 nmdc:mga00v17_34302_c1 nmdc:mga00v17_34302_c1_782_1474 226
437 iso_pu_bacteria 2554235003 2554246128 226
438 iso_pu_bacteria 2558860242 2559293351 226
439 iso_pu_bacteria 2599185210 2599604234 226
440 iso_pu_bacteria 2600255279 2601609630 226
441 iso_pu_bacteria 2600255308 2601746405 226
442 iso_pu_bacteria 2643221582 2643920508 226
443 iso_pu_bacteria 2643221693 2644519683 226
444 iso_pu_bacteria 2667528174 2671116337 226
445 iso_pu_bacteria 2808606387 2808986880 226
446 iso_pu_bacteria 2818991439 2819556954 226
447 iso_pu_bacteria 2838029111 2838034328 226
448 iso_pu_bacteria 2838675328 2838677693 226
449 iso_pu_bacteria 2838714209 2838716582 226
450 iso_pu_bacteria 2838719591 2838719618 226
451 iso_pu_bacteria 2838724970 2838727333 226
452 iso_pu_bacteria 2841846520 2841846547 226
453 iso_pu_bacteria 2841859092 2841860921 226
454 iso_pu_bacteria 2842124991 2842127424 226
455 iso_pu_bacteria 2842130223 2842132586 226
456 iso_pu_bacteria 2842152218 2842152245 226
457 iso_pu_bacteria 2842170452 2842172828 226
458 iso_pu_bacteria 2842175837 2842175864 226
459 iso_pu_bacteria 2842187318 2842189690 226
460 iso_pu_bacteria 2842211629 2842214004 226
461 iso_pu_bacteria 2842224351 2842224378 226
462 iso_pu_bacteria 2842475841 2842481074 226
463 iso_pu_bacteria 2842502639 2842507794 226
464 iso_pu_bacteria 2842515876 2842517706 226
465 iso_pu_bacteria 2852387548 2852387668 226
466 iso_pu_bacteria 2899792073 2899794254 226
467 iso_pu_bacteria 2899845264 2899849018 226
468 iso_pu_bacteria 2919114240 2919116798 226
469 iso_pu_bacteria 2919408235 2919414101 226
470 iso_pu_bacteria 2926754445 2926754810 226
471 iso_pu_bacteria 2926760298 2926761976 226
472 iso_pu_bacteria 2933006813 2933006891 226
473 iso_pu_bacteria 2933011516 2933015518 226
474 iso_pu_bacteria 2933594066 2933594092 226
475 iso_pu_bacteria 2979089926 2979092756 226
476 iso_pu_bacteria 2979095461 2979099854 226
477 iso_pu_bacteria 2979100975 2979104729 226
478 iso_pu_bacteria 2984509177 2984513473 226
479 iso_pu_bacteria 2984518228 2984520158 226
480 iso_pu_bacteria 2984537506 2984539455 226
481 iso_pu_bacteria 650716007 650738586 226
482 iso_pu_bacteria 8003570095 8003572127 226
483 iso_pu_bacteria 8005314921 8005317567 226
484 iso_pu_bacteria 8005484373 8005489285 226
485 iso_pu_bacteria 8005645114 8005645418 226
486 iso_pu_bacteria 8046767195 8046771525 226
487 iso_pu_bacteria 8057575449 8057577891 226
488 3300046674 Ga0495588_0041804 Ga0495588_0041804_1101_1799 227
489 iso_pu_bacteria 2513237089 2513603563 227
490 iso_pu_bacteria 2513237156 2513983267 227
491 iso_pu_bacteria 2513237160 2514005803 227
492 iso_pu_bacteria 2517487022 2517571794 227
493 iso_pu_bacteria 2802428858 2802720844 227
494 iso_pu_bacteria 2802428859 2802724450 227
495 iso_pu_bacteria 2802428860 2802729885 227
496 iso_pu_bacteria 2802428861 2802737229 227
497 iso_pu_bacteria 2802428862 2802746359 227
498 iso_pu_bacteria 2802428863 2802751848 227
499 iso_pu_bacteria 2915980308 2915982700 227
500 iso_pu_bacteria 2916061851 2916063914 227
501 iso_pu_bacteria 2921250672 2921256325 227
502 iso_pu_bacteria 2937029754 2937030586 227
503 iso_pu_bacteria 2937036028 2937039054 227
504 iso_pu_bacteria 2937078374 2937083927 227
505 iso_pu_bacteria 2937084907 2937088540 227
506 iso_pu_bacteria 2957375807 2957378020 227
507 iso_pu_bacteria 2957437181 2957441440 227
508 iso_pu_bacteria 2960591022 2960593166 227
509 iso_pu_bacteria 2960631154 2960635375 227
510 iso_pu_bacteria 2960680706 2960682660 227
511 iso_pu_bacteria 2960693952 2960700476 227
512 iso_pu_bacteria 2967686174 2967688450 227
513 iso_pu_bacteria 2967728569 2967733815 227
514 iso_pu_bacteria 2970026789 2970031964 227
515 iso_pu_bacteria 2970122695 2970122781 227
516 iso_pu_bacteria 2970143518 2970145304 227
517 iso_pu_bacteria 2977530762 2977530899 227
518 iso_pu_bacteria 2977544691 2977546925 227
519 iso_pu_bacteria 8003999396 8004003465 227
520 3300006051 Ga0075364_10326552 Ga0075364_103265522 228
521 3300006353 Ga0075370_10204617 Ga0075370_102046172 228
522 3300048925 Ga0496122_0043000 Ga0496122_0043000_2232_2930 228
523 3300048927 Ga0496124_0000855 Ga0496124_0000855_21857_22555 228
524 3300050491 nmdc:mga00v17_271563_c1 nmdc:mga00v17_271563_c1_167_859 228
525 3300053111 Ga0500572_030457 Ga0500572_030457_602_1294 228
526 3300053177 Ga0500636_0000094 Ga0500636_0000094_5214_5909 228
527 3300053177 Ga0500636_0047373 Ga0500636_0047373_1191_1883 228
528 3300002704 JGI25155J39150_1000069 JGI25155J39150_100006924 229
529 3300002705 JGI25156J39149_1000095 JGI25156J39149_100009524 229
530 3300002738 JGI25154J39366_1000737 JGI25154J39366_100073712 229
531 3300002741 JGI25157J39369_1000216 JGI25157J39369_100021647 229
532 3300003320 rootH2_10015912 rootH2_100159123 229
533 3300003354 JGI25160J50197_1000287 JGI25160J50197_100028720 229
534 3300003374 JGI25161J50226_1000176 JGI25161J50226_100017624 229
535 3300004625 Ga0055543_1000114 Ga0055543_100011455 229
536 3300005262 Ga0065165_1000511 Ga0065165_100051155 229
537 3300005548 Ga0070665_100000937 Ga0070665_10000093727 229
538 3300006038 Ga0075365_10004993 Ga0075365_100049933 229
539 3300006038 Ga0075365_10192580 Ga0075365_101925802 229
540 3300006042 Ga0075368_10000580 Ga0075368_100005802 229
541 3300006048 Ga0075363_100005802 Ga0075363_1000058022 229
542 3300006051 Ga0075364_10056667 Ga0075364_100566672 229
543 3300006177 Ga0075362_10001149 Ga0075362_100011494 229
544 3300006178 Ga0075367_10022729 Ga0075367_100227292 229
545 3300006178 Ga0075367_10077307 Ga0075367_100773071 229
546 3300006186 Ga0075369_10024687 Ga0075369_100246872 229
547 3300006186 Ga0075369_10085838 Ga0075369_100858382 229
548 3300006195 Ga0075366_10006955 Ga0075366_100069552 229
549 3300006353 Ga0075370_10063693 Ga0075370_100636932 229
550 3300011119 Ga0105246_10061544 Ga0105246_100615442 229
551 3300013102 Ga0157371_10000004 Ga0157371_1000000427 229
552 3300013104 Ga0157370_10001506 Ga0157370_1000150622 229
553 3300013306 Ga0163162_10870853 Ga0163162_108708531 229
554 3300013307 Ga0157372_11173888 Ga0157372_111738881 229
555 3300025206 Ga0209435_100049 Ga0209435_10004945 229
556 3300025208 Ga0209436_105698 Ga0209436_1056982 229
557 3300025228 Ga0209672_102811 Ga0209672_1028112 229
558 3300025233 Ga0209437_100376 Ga0209437_10037647 229
559 3300025246 Ga0209646_1000159 Ga0209646_100015945 229
560 3300025246 Ga0209646_1004347 Ga0209646_10043472 229
561 3300025250 Ga0209026_1000183 Ga0209026_100018345 229
562 3300025256 Ga0209759_1000206 Ga0209759_100020645 229
563 3300025261 Ga0209233_1000423 Ga0209233_10004232 229
564 3300025272 Ga0209455_1013063 Ga0209455_10130632 229
565 3300025284 Ga0209130_1000377 Ga0209130_100037753 229
566 3300025294 Ga0209025_1000553 Ga0209025_100055357 229
567 3300025297 Ga0209758_1021605 Ga0209758_10216052 229
568 3300025302 Ga0207426_1000330 Ga0207426_100033043 229
569 3300025923 Ga0207681_10104953 Ga0207681_101049532 229
570 3300025935 Ga0207709_10025163 Ga0207709_100251632 229
571 3300025972 Ga0207668_10317085 Ga0207668_103170852 229
572 3300027312 Ga0209371_1000009 Ga0209371_1000009966 229
573 3300027312 Ga0209371_1002721 Ga0209371_10027214 229
574 3300027312 Ga0209371_1003521 Ga0209371_10035216 229
575 3300027312 Ga0209371_1007312 Ga0209371_10073124 229
576 3300027666 Ga0209282_1017023 Ga0209282_10170232 229
577 3300027866 Ga0209813_10002444 Ga0209813_100024442 229
578 3300028379 Ga0268266_10004006 Ga0268266_100040063 229
579 3300030500 Ga0268256_1000010 Ga0268256_1000010965 229
580 3300030500 Ga0268256_1004458 Ga0268256_10044582 229
581 3300030744 Ga0316181_1071942 Ga0316181_10719422 229
582 3300046558 Ga0495633_0050426 Ga0495633_0050426_626_1327 229
583 3300047470 Ga0495681_0027022 Ga0495681_0027022_2046_2747 229
584 3300048907 Ga0496104_0281215 Ga0496104_0281215_15_716 229
585 3300048916 Ga0496113_0124369 Ga0496113_0124369_757_1458 229
586 3300048917 Ga0496114_0106688 Ga0496114_0106688_355_1044 229
587 3300048918 Ga0496115_0596283 Ga0496115_0596283_127_843 229
588 3300048919 Ga0496116_0051897 Ga0496116_0051897_1474_2175 229
589 3300048920 Ga0496117_0000002 Ga0496117_0000002_2455077_2455778 229
590 3300048920 Ga0496117_0058034 Ga0496117_0058034_403_1104 229
591 3300048921 Ga0496118_0001144 Ga0496118_0001144_34902_35603 229
592 3300048921 Ga0496118_0082894 Ga0496118_0082894_356_1057 229
593 3300048922 Ga0496119_0137169 Ga0496119_0137169_226_927 229
594 3300048923 Ga0496120_0000897 Ga0496120_0000897_34927_35628 229
595 3300048923 Ga0496120_0064145 Ga0496120_0064145_929_1630 229
596 3300048925 Ga0496122_0000001 Ga0496122_0000001_1799085_1799786 229
597 3300048926 Ga0496123_0000001 Ga0496123_0000001_1802816_1803517 229
598 3300048927 Ga0496124_0044402 Ga0496124_0044402_1416_2117 229
599 3300048928 Ga0496125_0048956 Ga0496125_0048956_582_1283 229
600 3300048929 Ga0496126_0091131 Ga0496126_0091131_1269_1985 229
601 3300050489 nmdc:mga03683_10158_c1 nmdc:mga03683_10158_c1_1920_2621 229
602 3300050490 nmdc:mga03n38_4766_c1 nmdc:mga03n38_4766_c1_575_1276 229
603 3300050491 nmdc:mga00v17_102_c1 nmdc:mga00v17_102_c1_28035_28736 229
604 3300050492 nmdc:mga0yw44_1468_c1 nmdc:mga0yw44_1468_c1_2723_3424 229
605 3300050493 nmdc:mga0k408_244480_c1 nmdc:mga0k408_244480_c1_69_770 229
606 3300050496 nmdc:mga07m45_93523_c1 nmdc:mga07m45_93523_c1_729_1430 229
607 3300050516 nmdc:mga0sz30_22228_c1 nmdc:mga0sz30_22228_c1_1654_2355 229
608 3300050516 nmdc:mga0sz30_53142_c1 nmdc:mga0sz30_53142_c1_214_915 229
609 3300053107 Ga0500560_021899 Ga0500560_021899_570_1271 229
610 3300053137 Ga0500561_0003326 Ga0500561_0003326_1745_2446 229
611 3300053157 Ga0500624_002137 Ga0500624_002137_1466_2167 229
612 3300053161 Ga0500634_0005672 Ga0500634_0005672_4740_5435 229
613 3300053161 Ga0500634_0047361 Ga0500634_0047361_1050_1751 229
614 3300059510 Ga0587090_000399 Ga0587090_000399_2047_2748 229
615 3300059641 Ga0587068_000617 Ga0587068_000617_2363_3064 229
616 3300059643 Ga0587072_000562 Ga0587072_000562_2377_3078 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04296

YlxR

Protein of unknown function (DUF448)

42

119

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v7q-assembly3.cif.gz_C crystal structure of b. subtilis ylxq at 1.55 a resolution 0.8317 104 203
7qep-assembly1.cif.gz_O0 cryo-em structure of the ribosome from encephalitozoon cuniculi 0.8311 118 195
3on1-assembly1.cif.gz_A the structure of a protein with unknown function from bacillus halodurans c 0.8178 103 209
1g2r-assembly1.cif.gz_A structure of cytosolic protein of unknown function coded by gene from nusa/infb region, a ylxr homologue 0.7992 23 96
3ra6-assembly1.cif.gz_A crystal structure of t. celer l30e e62a/k46a variant 0.7908 105 194
ID Description Score Start End Superfamily
af_I6XFF7_1_86_3.30.1230.10 Alpha Beta;2-Layer Sandwich;Hypothetical Cytosolic Protein; Chain: A;;YlxR-like 0.8462 23 93 3.30.1230.10
3v7qC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.8317 104 203 3.30.1330.30
3on1A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.8179 103 209 3.30.1330.30
1g2rA00 Alpha Beta;2-Layer Sandwich;Hypothetical Cytosolic Protein; Chain: A;;YlxR-like 0.7987 23 96 3.30.1230.10
3on1A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.7889 103 209 3.30.1330.30
ID Description Score Start End GO Terms
AF-A0A1U9Z6U1-F1-model_v4 YlxR domain-containing protein 0.994 23 212
AF-A0A4S0YYC5-F1-model_v4 deleted 0.9816 36 158
AF-A0A531LJE6-F1-model_v4 DUF448 domain-containing protein 0.9735 23 93
AF-A0A3E0NE19-F1-model_v4 deleted 0.9629 23 96
AF-A0A519PSQ6-F1-model_v4 DUF448 domain-containing protein 0.9607 23 132

Feature Viewer

pLDDT pTM Quality
86.02 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map