F469596

General Info

Members Datasets Scaffolds Average Seq Length
616 365 1218 323

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006978542|3006978645
Length 383
Sequence RTFVDLEVISQSAKKVKEQLSRRPVLCLSGVTKALALFLANGKKGVTSMLTYTVRRVFSLIPVLFGMTLIVFAIIHAIPGNPAQVILGQRATQESIALVTKELGLDRPWYIQYFDYINKLLHGDLGTSLRTRGPINEEIWPFLAATFELTLVAMFIAIIIGVNAGIISAWFSKSWFDYFAMLLALIGVSMPIFWLGLMMQWGFANELGLFPTTGRENVRDPVNSITNLYLIDTLLQGRFDQFATVVKHLVLPSFALATIPMAIIARMTRATMLEVMKSDYIRTARAKGLRMFWVVYKHSLKNAVIPVLTVIGLQTGLLLGGAILTETIFGWPGIGRYLYDAILYRDYPVIQSGILIIAAIFVLINLIVDLLYVFVDPRIKYTK

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
134 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
143 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
153 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
154 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
155 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
158 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
183 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
184 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
216 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
239 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
268 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
289 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
290 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
291 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
292 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
293 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
294 2554235283 Bacillus safensis VK Isolate Rhizosphere
295 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
296 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
297 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
298 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
299 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
300 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
301 2643221735 Bacillus sp. Root920 Isolate Unclassified
302 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
303 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
304 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
305 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
306 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
307 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
308 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
309 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
310 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
311 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
312 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
313 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
314 2811994870 Bacillus sp. JB4 Isolate Unclassified
315 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
316 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
317 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
318 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
319 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
320 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
321 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
322 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
323 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
324 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
325 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
326 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
327 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
328 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
329 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
330 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
331 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
332 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
333 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
334 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
335 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
336 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
337 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
338 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
339 2919726948 Bacillus pumilus 4489 Isolate Unclassified
340 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
341 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
342 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
343 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
344 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
345 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
346 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
347 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
348 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
349 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
350 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
351 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
352 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
353 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
354 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
355 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
356 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
357 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
358 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
359 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
360 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
361 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
362 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
363 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
364 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
365 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.2
Metatranscriptomes 0.81
Isolates 12.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.95
Nodule 0.49
Rhizoplane 8.44
Rhizosphere 80.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10000399 3300001991 Bacteria 4898
2 JGI24743J22301_10004566 3300001991 Bacteria 2265
3 JGI25151J46595_10000103 3300003187 Bacteria 114459
4 Ga0006562J51391_1004806 3300003578 Bacteria 7160
5 JGI25404J52841_10003241 3300003659 Bacteria 3191
6 Ga0055538_1000145 3300003751 Bacteria 49978
7 Ga0055536_1025782 3300003781 Bacteria 1665
8 Ga0070666_10020555 3300005335 Bacteria 4269
9 Ga0070680_100077822 3300005336 Bacteria 2732
10 Ga0070682_100091514 3300005337 Bacteria 1991
11 Ga0070682_100169652 3300005337 Bacteria 1515
12 Ga0068868_100043413 3300005338 Bacteria 3512
13 Ga0068868_100050915 3300005338 Bacteria 3254
14 Ga0068868_100286325 3300005338 Bacteria 1396
15 Ga0068868_100286452 3300005338 Bacteria 1396
16 Ga0070660_100054884 3300005339 Bacteria 3078
17 Ga0070660_100079064 3300005339 Bacteria 2580
18 Ga0070691_10016123 3300005341 Bacteria 3434
19 Ga0070691_10034562 3300005341 Bacteria 2380
20 Ga0070691_10100260 3300005341 Bacteria 1437
21 Ga0070687_100187552 3300005343 Bacteria 1244
22 Ga0070668_100012251 3300005347 Bacteria 6390
23 Ga0070659_100029616 3300005366 Bacteria 4231
24 Ga0070659_100220983 3300005366 Bacteria 1563
25 Ga0070709_10053311 3300005434 Bacteria 2546
26 Ga0070714_100009735 3300005435 Bacteria 7572
27 Ga0070714_100053613 3300005435 Bacteria 3443
28 Ga0070713_100181225 3300005436 Bacteria 1893
29 Ga0070710_10132572 3300005437 Bacteria 1520
30 Ga0070705_100003304 3300005440 Bacteria 7922
31 Ga0070705_100006575 3300005440 Bacteria 5709
32 Ga0070705_100029973 3300005440 Bacteria 3000
33 Ga0070694_100020211 3300005444 Bacteria 4243
34 Ga0070708_100467605 3300005445 Bacteria 1190
35 Ga0070663_100006489 3300005455 Bacteria 7043
36 Ga0070678_100012254 3300005456 Bacteria 5321
37 Ga0070662_100008646 3300005457 Bacteria 6643
38 Ga0070662_100011226 3300005457 Bacteria 5904
39 Ga0070662_100121741 3300005457 Bacteria 2001
40 Ga0070681_10053329 3300005458 Bacteria 4030
41 Ga0070706_100005655 3300005467 Bacteria 11892
42 Ga0070706_100435278 3300005467 Bacteria 1221
43 Ga0070707_100017208 3300005468 Bacteria 6793
44 Ga0070698_100320873 3300005471 Bacteria 1480
45 Ga0070698_100441516 3300005471 Bacteria 1236
46 Ga0070699_100290147 3300005518 Bacteria 1467
47 Ga0070679_100027902 3300005530 Bacteria 5562
48 Ga0070679_100051193 3300005530 Bacteria 4113
49 Ga0070684_100204153 3300005535 Bacteria 1801
50 Ga0070697_100067881 3300005536 Bacteria 2918
51 Ga0070697_100303948 3300005536 Bacteria 1372
52 Ga0068853_100029960 3300005539 Bacteria 4592
53 Ga0068853_100277354 3300005539 Bacteria 1545
54 Ga0070672_100106138 3300005543 Bacteria 2285
55 Ga0070686_100004292 3300005544 Bacteria 7857
56 Ga0070686_100040015 3300005544 Bacteria 2923
57 Ga0070686_100069152 3300005544 Bacteria 2305
58 Ga0070695_100065000 3300005545 Bacteria 2374
59 Ga0070695_100244680 3300005545 Bacteria 1303
60 Ga0070693_100007061 3300005547 Bacteria 5470
61 Ga0070665_100102330 3300005548 Bacteria 2867
62 Ga0070665_100341557 3300005548 Bacteria 1502
63 Ga0068855_100052063 3300005563 Bacteria 4820
64 Ga0068855_100062032 3300005563 Bacteria 4365
65 Ga0068857_100124682 3300005577 Bacteria 2321
66 Ga0068854_100020589 3300005578 Bacteria 4466
67 Ga0068856_100113843 3300005614 Bacteria 2704
68 Ga0068856_100250638 3300005614 Bacteria 1786
69 Ga0070702_100059638 3300005615 Bacteria 2215
70 Ga0068859_100576609 3300005617 Bacteria 1219
71 Ga0068864_100081656 3300005618 Bacteria 2834
72 Ga0068864_100193565 3300005618 Bacteria 1865
73 Ga0068861_100003660 3300005719 Bacteria 10250
74 Ga0068861_100102633 3300005719 Bacteria 2277
75 Ga0081455_10061667 3300005937 Bacteria 3155
76 Ga0081538_10015247 3300005981 Bacteria 5960
77 Ga0081540_1008192 3300005983 Bacteria 7321
78 Ga0081540_1013419 3300005983 Bacteria 5324
79 Ga0070717_10007665 3300006028 Bacteria 8023
80 Ga0070717_10011845 3300006028 Bacteria 6635
81 Ga0070717_10448938 3300006028 Bacteria 1162
82 Ga0075363_100007735 3300006048 Bacteria 4963
83 Ga0070716_100050783 3300006173 Bacteria 2355
84 Ga0097621_100326257 3300006237 Bacteria 1361
85 Ga0075370_10057657 3300006353 Bacteria 2207
86 Ga0068871_100051642 3300006358 Bacteria 3329
87 Ga0075428_100043818 3300006844 Bacteria 4919
88 Ga0075428_100166589 3300006844 Bacteria 2390
89 Ga0075428_100390429 3300006844 Bacteria 1492
90 Ga0075430_100125056 3300006846 Bacteria 2143
91 Ga0075431_100408324 3300006847 Bacteria 1358
92 Ga0075433_10102626 3300006852 Bacteria 2533
93 Ga0075433_10215010 3300006852 Bacteria 1708
94 Ga0075434_100076407 3300006871 Bacteria 3344
95 Ga0075429_100027327 3300006880 Bacteria 4951
96 Ga0075429_100075664 3300006880 Bacteria 2933
97 Ga0075429_100186645 3300006880 Bacteria 1817
98 Ga0075436_100223650 3300006914 Bacteria 1336
99 Ga0097620_100576539 3300006931 Bacteria 1219
100 Ga0079104_1002396 3300006946 Bacteria 10208
101 Ga0075435_100066087 3300007076 Bacteria 2941
102 Ga0075435_100104453 3300007076 Bacteria 2350
103 Ga0075435_100390468 3300007076 Bacteria 1196
104 Ga0105244_10007307 3300009036 Bacteria 7029
105 Ga0105240_10021891 3300009093 Bacteria 8493
106 Ga0111539_10013355 3300009094 Bacteria 10263
107 Ga0111539_10142316 3300009094 Bacteria 2807
108 Ga0111539_10323561 3300009094 Bacteria 1794
109 Ga0105245_10016372 3300009098 Bacteria 6466
110 Ga0105245_10028267 3300009098 Bacteria 4944
111 Ga0105245_10043749 3300009098 Bacteria 3995
112 Ga0105245_10072283 3300009098 Bacteria 3133
113 Ga0105245_10200570 3300009098 Bacteria 1916
114 Ga0114129_10011990 3300009147 Bacteria 12330
115 Ga0114129_10014967 3300009147 Bacteria 11052
116 Ga0114129_10016367 3300009147 Bacteria 10557
117 Ga0114129_10029547 3300009147 Bacteria 7762
118 Ga0114129_10042097 3300009147 Bacteria 6431
119 Ga0114129_10065449 3300009147 Bacteria 5073
120 Ga0114129_10201854 3300009147 Bacteria 2692
121 Ga0114129_10313028 3300009147 Bacteria 2089
122 Ga0114129_10350859 3300009147 Bacteria 1955
123 Ga0114129_10510959 3300009147 Bacteria 1568
124 Ga0105241_10038852 3300009174 Bacteria 3589
125 Ga0105242_10090652 3300009176 Bacteria 2572
126 Ga0105242_10143914 3300009176 Bacteria 2072
127 Ga0105248_10124601 3300009177 Bacteria 2907
128 Ga0105237_10004487 3300009545 Bacteria 16128
129 Ga0105238_10010543 3300009551 Bacteria 9280
130 Ga0105238_10383106 3300009551 Bacteria 1398
131 Ga0105249_10012136 3300009553 Bacteria 7584
132 Ga0105249_10095999 3300009553 Bacteria 2780
133 Ga0105239_10007362 3300010375 Bacteria 12640
134 Ga0105239_10009499 3300010375 Bacteria 10952
135 Ga0105239_10024120 3300010375 Bacteria 6700
136 Ga0105239_10025482 3300010375 Bacteria 6512
137 Ga0105239_10064707 3300010375 Bacteria 4014
138 Ga0105239_10354255 3300010375 Bacteria 1657
139 Ga0105246_10001172 3300011119 Bacteria 15224
140 Ga0157316_1000916 3300012510 Bacteria 1701
141 Ga0157373_10013686 3300013100 Bacteria 5949
142 Ga0157371_10002178 3300013102 Bacteria 19027
143 Ga0157371_10014071 3300013102 Bacteria 6052
144 Ga0157369_10545110 3300013105 Bacteria 1199
145 Ga0157372_10005383 3300013307 Bacteria 13609
146 Ga0157375_10016940 3300013308 Bacteria 6565
147 Ga0157375_10145375 3300013308 Bacteria 2502
148 Ga0157375_10260956 3300013308 Bacteria 1894
149 Ga0157375_10416161 3300013308 Bacteria 1510
150 Ga0163163_10044949 3300014325 Bacteria 4334
151 Ga0163163_10081748 3300014325 Bacteria 3233
152 Ga0157379_10025195 3300014968 Bacteria 5281
153 Ga0206350_10180134 3300020080 Bacteria 1449
154 Ga0209784_100230 3300025224 Bacteria 37229
155 Ga0209147_100068 3300025229 Bacteria 230150
156 Ga0209437_100516 3300025233 Bacteria 27324
157 Ga0209676_1002223 3300025292 Bacteria 14415
158 Ga0209025_1004212 3300025294 Bacteria 12678
159 Ga0209025_1004842 3300025294 Bacteria 11367
160 Ga0207655_1009289 3300025728 Bacteria 6124
161 Ga0207692_10000002 3300025898 Bacteria 453100
162 Ga0207692_10027447 3300025898 Bacteria 2682
163 Ga0207680_10038914 3300025903 Bacteria 2755
164 Ga0207699_10178347 3300025906 Bacteria 1426
165 Ga0207684_10021703 3300025910 Bacteria 5482
166 Ga0207684_10283769 3300025910 Bacteria 1428
167 Ga0207654_10009521 3300025911 Bacteria 4936
168 Ga0207654_10096883 3300025911 Bacteria 1810
169 Ga0207695_10099780 3300025913 Bacteria 2900
170 Ga0207671_10002832 3300025914 Bacteria 18036
171 Ga0207693_10014720 3300025915 Bacteria 6285
172 Ga0207693_10025237 3300025915 Bacteria 4713
173 Ga0207693_10096915 3300025915 Bacteria 2313
174 Ga0207663_10001302 3300025916 Bacteria 11566
175 Ga0207660_10034146 3300025917 Bacteria 3524
176 Ga0207652_10033665 3300025921 Bacteria 4316
177 Ga0207652_10184016 3300025921 Bacteria 1878
178 Ga0207646_10040711 3300025922 Bacteria 4178
179 Ga0207646_10108403 3300025922 Bacteria 2492
180 Ga0207681_10054951 3300025923 Bacteria 2710
181 Ga0207694_10213814 3300025924 Bacteria 1571
182 Ga0207687_10011970 3300025927 Bacteria 5674
183 Ga0207687_10061234 3300025927 Bacteria 2657
184 Ga0207687_10061577 3300025927 Bacteria 2651
185 Ga0207700_10302099 3300025928 Bacteria 1382
186 Ga0207700_10303419 3300025928 Bacteria 1379
187 Ga0207700_10326152 3300025928 Bacteria 1332
188 Ga0207700_10329833 3300025928 Bacteria 1324
189 Ga0207664_10016386 3300025929 Bacteria 5407
190 Ga0207664_10023928 3300025929 Bacteria 4584
191 Ga0207644_10154604 3300025931 Bacteria 1778
192 Ga0207706_10012501 3300025933 Bacteria 7733
193 Ga0207706_10015392 3300025933 Bacteria 6910
194 Ga0207706_10021836 3300025933 Bacteria 5745
195 Ga0207665_10001598 3300025939 Bacteria 15259
196 Ga0207689_10077234 3300025942 Bacteria 2738
197 Ga0207661_10298495 3300025944 Bacteria 1444
198 Ga0207661_10346680 3300025944 Bacteria 1339
199 Ga0207667_10084398 3300025949 Bacteria 3288
200 Ga0207712_10033599 3300025961 Bacteria 3469
201 Ga0207668_10032376 3300025972 Bacteria 3454
202 Ga0207639_10146257 3300026041 Bacteria 1974
203 Ga0207678_10020634 3300026067 Bacteria 5776
204 Ga0207702_10105736 3300026078 Bacteria 2493
205 Ga0207702_10182288 3300026078 Bacteria 1934
206 Ga0207648_10031155 3300026089 Bacteria 4716
207 Ga0207676_10020291 3300026095 Bacteria 4861
208 Ga0207676_10181537 3300026095 Bacteria 1843
209 Ga0207674_10022244 3300026116 Bacteria 6812
210 Ga0207674_10128303 3300026116 Bacteria 2501
211 Ga0207675_100004730 3300026118 Bacteria 13109
212 Ga0207675_100050616 3300026118 Bacteria 3876
213 Ga0207675_100072576 3300026118 Bacteria 3219
214 Ga0207683_10002488 3300026121 Bacteria 16072
215 Ga0209281_1000705 3300027111 Bacteria 33820
216 Ga0207428_10005836 3300027907 Bacteria 11420
217 Ga0268266_10022598 3300028379 Bacteria 5356
218 Ga0268265_10447531 3300028380 Bacteria 1206
219 Ga0268264_10428471 3300028381 Bacteria 1277
220 Ga0265334_10021137 3300028573 Bacteria 2659
221 Ga0265322_10015627 3300028654 Bacteria 2192
222 Ga0307515_10163155 3300028794 Bacteria 2261
223 Ga0265338_10002932 3300028800 Bacteria 24747
224 Ga0265339_10097350 3300031249 Bacteria 1535
225 Ga0265327_10046310 3300031251 Bacteria 2303
226 Ga0265327_10129453 3300031251 Bacteria 1189
227 Ga0265316_10004110 3300031344 Bacteria 14570
228 Ga0307408_100009124 3300031548 Bacteria 6542
229 Ga0265313_10010463 3300031595 Bacteria 5860
230 Ga0307514_10003388 3300031649 Bacteria 15385
231 Ga0316579_10001673 3300031691 Bacteria 8137
232 Ga0316579_10003913 3300031691 Bacteria 5867
233 Ga0316579_10016425 3300031691 Bacteria 3233
234 Ga0265314_10004174 3300031711 Bacteria 13580
235 Ga0265342_10072576 3300031712 Bacteria 2003
236 Ga0316576_10008526 3300031727 Bacteria 6547
237 Ga0316576_10021301 3300031727 Bacteria 4481
238 Ga0316578_10004401 3300031728 Bacteria 6649
239 Ga0316577_10002076 3300031733 Bacteria 9785
240 Ga0316577_10004822 3300031733 Bacteria 7014
241 Ga0316577_10009407 3300031733 Bacteria 5256
242 Ga0316577_10010974 3300031733 Bacteria 4902
243 Ga0316577_10020065 3300031733 Bacteria 3704
244 Ga0316577_10057472 3300031733 Bacteria 2172
245 Ga0307413_10043867 3300031824 Bacteria 2639
246 Ga0307412_10103427 3300031911 Bacteria 2019
247 Ga0307416_100002337 3300032002 Bacteria 10842
248 Ga0316583_10005944 3300032133 Bacteria 4383
249 Ga0316583_10016540 3300032133 Bacteria 2655
250 Ga0316585_10021589 3300032137 Bacteria 1977
251 Ga0316580_10001198 3300032139 Bacteria 6616
252 Ga0316588_1002595 3300033528 Bacteria 3166
253 Ga0316596_1001952 3300033541 Bacteria 4326
254 Ga0373944_0018256 3300035089 Bacteria 2001
255 Ga0373951_0006008 3300035091 Bacteria 2797
256 Ga0373932_0024579 3300035112 Bacteria 1623
257 Ga0373939_0018084 3300035114 Bacteria 1882
258 Ga0373941_0006172 3300035115 Bacteria 2871
259 Ga0373945_0006113 3300035116 Bacteria 3871
260 Ga0373960_0042159 3300035121 Bacteria 1324
261 Ga0373943_0003130 3300035170 Bacteria 7522
262 Ga0373943_0008985 3300035170 Bacteria 4478
263 Ga0373943_0018874 3300035170 Bacteria 3170
264 Ga0373946_0008892 3300035171 Bacteria 3691
265 Ga0373942_0011236 3300035207 Bacteria 2121
266 Ga0316574_0010382 3300035398 Bacteria 5261
267 Ga0316574_0027656 3300035398 Bacteria 3416
268 Ga0373931_0112821 3300035691 Bacteria 1544
269 Ga0373935_0006397 3300035692 Bacteria 7027
270 Ga0373927_0061533 3300035695 Bacteria 2429
271 Ga0373947_0008879 3300035725 Bacteria 5784
272 Ga0373947_0011302 3300035725 Bacteria 5124
273 Ga0373947_0013827 3300035725 Bacteria 4626
274 Ga0373937_0284949 3300036401 Bacteria 1561
275 Ga0316582_0000334 3300036647 Bacteria 16584
276 Ga0316582_0002449 3300036647 Bacteria 8732
277 Ga0316582_0005503 3300036647 Bacteria 6532
278 Ga0316584_0003448 3300036712 Bacteria 10268
279 Ga0316584_0009770 3300036712 Bacteria 6675
280 Ga0316584_0019779 3300036712 Bacteria 4870
281 Ga0316584_0065635 3300036712 Bacteria 2719
282 Ga0316584_0092323 3300036712 Bacteria 2266
283 Ga0373925_0031780 3300037068 Bacteria 3882
284 Ga0373925_0034382 3300037068 Bacteria 3735
285 Ga0373925_0105618 3300037068 Bacteria 2170
286 Ga0395899_0006431 3300037312 Bacteria 9102
287 Ga0395899_0009381 3300037312 Bacteria 7513
288 Ga0395899_0029509 3300037312 Bacteria 4126
289 Ga0395899_0091749 3300037312 Bacteria 2200
290 Ga0395900_0004838 3300037418 Bacteria 14183
291 Ga0395900_0011127 3300037418 Bacteria 9196
292 Ga0395900_0038346 3300037418 Bacteria 4938
293 Ga0395900_0044598 3300037418 Bacteria 4568
294 Ga0395900_0137354 3300037418 Bacteria 2505
295 Ga0395898_0004055 3300037466 Bacteria 16082
296 Ga0395898_0019664 3300037466 Bacteria 6869
297 Ga0395898_0027474 3300037466 Bacteria 5711
298 Ga0395898_0035156 3300037466 Bacteria 4986
299 Ga0395898_0053622 3300037466 Bacteria 3938
300 Ga0395905_0001523 3300037471 Bacteria 27714
301 Ga0395905_0005666 3300037471 Bacteria 12703
302 Ga0395905_0011931 3300037471 Bacteria 8377
303 Ga0316581_0043509 3300037588 Bacteria 1371
304 Ga0395901_0003369 3300038443 Bacteria 16101
305 Ga0395901_0006823 3300038443 Bacteria 11530
306 Ga0395901_0007841 3300038443 Bacteria 10777
307 Ga0395901_0022002 3300038443 Bacteria 6535
308 Ga0395901_0093969 3300038443 Bacteria 3140
309 Ga0395901_0199788 3300038443 Bacteria 2096
310 Ga0400484_30791 3300038725 Bacteria 2272
311 Ga0242420_006368 3300038996 Bacteria 1863
312 Ga0400489_35584 3300039093 Bacteria 1596
313 Ga0400489_71342 3300039093 Bacteria 1062
314 Ga0400489_73553 3300039093 Bacteria 5220
315 Ga0436365_0259823 3300039437 Bacteria 4135
316 Ga0436363_0465515 3300039450 Bacteria 25938
317 Ga0451789_0513312 3300041443 Bacteria 1168
318 Ga0451853_0678818 3300041512 Bacteria 2137
319 Ga0451853_1663579 3300041512 Bacteria 1438
320 Ga0451577_0521270 3300042876 Bacteria 1079
321 Ga0466963_0057499 3300044694 Bacteria 2590
322 Ga0466964_0017447 3300044706 Bacteria 2747
323 Ga0453684_0101721 3300044712 Bacteria 3515
324 Ga0466968_0076666 3300044735 Bacteria 1464
325 Ga0466957_0011489 3300044842 Bacteria 5111
326 Ga0466960_0012322 3300044901 Bacteria 3605
327 Ga0466960_0023590 3300044901 Bacteria 2764
328 Ga0466960_0034617 3300044901 Bacteria 2355
329 Ga0466967_0007538 3300045976 Bacteria 7859
330 Ga0466967_0011977 3300045976 Bacteria 6608
331 Ga0466967_0013624 3300045976 Bacteria 6293
332 Ga0466967_0072022 3300045976 Bacteria 3096
333 Ga0466967_0092833 3300045976 Bacteria 2746
334 Ga0466967_0190876 3300045976 Bacteria 1936
335 Ga0466967_0310634 3300045976 Bacteria 1518
336 Ga0466967_0353532 3300045976 Bacteria 1423
337 Ga0495603_0001071 3300046455 Bacteria 15878
338 Ga0495603_0060496 3300046455 Bacteria 2238
339 Ga0495629_0351788 3300046459 Bacteria 1005
340 Ga0495641_0013624 3300046461 Bacteria 4454
341 Ga0495580_0051653 3300046472 Bacteria 2906
342 Ga0495594_0003190 3300046499 Bacteria 8486
343 Ga0495620_0020473 3300046515 Bacteria 3230
344 Ga0495630_0024229 3300046517 Bacteria 4488
345 Ga0495637_0017421 3300046520 Bacteria 3348
346 Ga0495644_0041484 3300046523 Bacteria 1733
347 Ga0495654_0084910 3300046530 Bacteria 1478
348 Ga0495609_0066372 3300046538 Bacteria 1589
349 Ga0495656_0137985 3300046615 Bacteria 1167
350 Ga0495625_0076568 3300046660 Bacteria 2339
351 Ga0495661_0049351 3300046665 Bacteria 2553
352 Ga0495661_0149850 3300046665 Bacteria 1261
353 Ga0495588_0006804 3300046674 Bacteria 5174
354 Ga0495588_0016293 3300046674 Bacteria 3591
355 Ga0495647_0071190 3300046681 Bacteria 1392
356 Ga0495658_0007677 3300046683 Bacteria 5345
357 Ga0495624_0113970 3300046690 Bacteria 1662
358 Ga0495589_0099252 3300046794 Bacteria 1410
359 Ga0495660_0006149 3300046810 Bacteria 7127
360 Ga0495660_0086864 3300046810 Bacteria 1632
361 Ga0495581_0063674 3300047315 Bacteria 2131
362 Ga0495581_0070550 3300047315 Bacteria 2021
363 Ga0495676_0007447 3300047321 Bacteria 10042
364 Ga0495676_0011839 3300047321 Bacteria 7869
365 Ga0495676_0031836 3300047321 Bacteria 4456
366 Ga0495680_0194237 3300047322 Bacteria 1459
367 Ga0495681_0034111 3300047470 Bacteria 2539
368 Ga0495686_0000008 3300047472 Bacteria 727479
369 Ga0495686_0012287 3300047472 Bacteria 5995
370 Ga0496100_0006393 3300048903 Bacteria 6423
371 Ga0496101_0018305 3300048904 Bacteria 4761
372 Ga0496101_0150646 3300048904 Bacteria 1779
373 Ga0496102_0012577 3300048905 Bacteria 7330
374 Ga0496102_0019251 3300048905 Bacteria 6013
375 Ga0496102_0024486 3300048905 Bacteria 5367
376 Ga0496102_0122404 3300048905 Bacteria 2430
377 Ga0496102_0178186 3300048905 Bacteria 2002
378 Ga0496102_0257344 3300048905 Bacteria 1646
379 Ga0496104_0000290 3300048907 Bacteria 44239
380 Ga0496104_0015417 3300048907 Bacteria 6921
381 Ga0496105_0000515 3300048908 Bacteria 25512
382 Ga0496105_0000680 3300048908 Bacteria 22840
383 Ga0496105_0003449 3300048908 Bacteria 11702
384 Ga0496105_0011678 3300048908 Bacteria 6949
385 Ga0496106_0046549 3300048909 Bacteria 3261
386 Ga0496106_0146666 3300048909 Bacteria 1859
387 Ga0496107_0156360 3300048910 Bacteria 1688
388 Ga0496107_0255186 3300048910 Bacteria 1305
389 Ga0496108_0007063 3300048911 Bacteria 9094
390 Ga0496108_0008037 3300048911 Bacteria 8562
391 Ga0496108_0230244 3300048911 Bacteria 1611
392 Ga0496109_0006740 3300048912 Bacteria 9673
393 Ga0496109_0010250 3300048912 Bacteria 8002
394 Ga0496109_0080015 3300048912 Bacteria 3011
395 Ga0496109_0191875 3300048912 Bacteria 1920
396 Ga0496109_0266974 3300048912 Bacteria 1612
397 Ga0496110_0000127 3300048913 Bacteria 43261
398 Ga0496110_0008749 3300048913 Bacteria 8154
399 Ga0496110_0009333 3300048913 Bacteria 7938
400 Ga0496110_0023628 3300048913 Bacteria 5230
401 Ga0496110_0035047 3300048913 Bacteria 4351
402 Ga0496110_0368117 3300048913 Bacteria 1309
403 Ga0496111_0000056 3300048914 Bacteria 45048
404 Ga0496111_0006410 3300048914 Bacteria 7637
405 Ga0496111_0033270 3300048914 Bacteria 3676
406 Ga0496111_0044515 3300048914 Bacteria 3190
407 Ga0496112_0001755 3300048915 Bacteria 17002
408 Ga0496112_0005566 3300048915 Bacteria 10920
409 Ga0496112_0214561 3300048915 Bacteria 1881
410 Ga0496113_0000066 3300048916 Bacteria 45324
411 Ga0496113_0002849 3300048916 Bacteria 10173
412 Ga0496113_0003404 3300048916 Bacteria 9518
413 Ga0496113_0033702 3300048916 Bacteria 3732
414 Ga0496115_0004675 3300048918 Bacteria 9921
415 Ga0496115_0017430 3300048918 Bacteria 5492
416 Ga0496115_0162179 3300048918 Bacteria 1848
417 Ga0496116_0000557 3300048919 Bacteria 49954
418 Ga0496116_0022190 3300048919 Bacteria 4764
419 Ga0496118_0036427 3300048921 Bacteria 3977
420 Ga0496118_0171267 3300048921 Bacteria 1326
421 Ga0496119_0003008 3300048922 Bacteria 17854
422 Ga0496119_0010922 3300048922 Bacteria 7585
423 Ga0496120_0032146 3300048923 Bacteria 3167
424 Ga0496121_0059578 3300048924 Bacteria 3146
425 Ga0496121_0110680 3300048924 Bacteria 2095
426 Ga0496123_0034347 3300048926 Bacteria 3634
427 Ga0496124_0029283 3300048927 Bacteria 4910
428 Ga0496124_0290014 3300048927 Bacteria 1188
429 Ga0496125_0001486 3300048928 Bacteria 33683
430 Ga0496125_0016168 3300048928 Bacteria 7174
431 Ga0496126_0000357 3300048929 Bacteria 95595
432 Ga0496126_0018333 3300048929 Bacteria 6939
433 Ga0501345_00205 3300049134 Bacteria 1745
434 Ga0501031_0016141 3300049568 Bacteria 4850
435 Ga0501031_0034044 3300049568 Bacteria 3324
436 Ga0501032_0040188 3300049569 Bacteria 3180
437 Ga0501034_0294375 3300049571 Bacteria 1561
438 Ga0501036_0000365 3300049572 Bacteria 31800
439 Ga0501036_0175418 3300049572 Bacteria 1805
440 Ga0501038_0004824 3300049574 Bacteria 12525
441 Ga0501039_0007171 3300049575 Bacteria 8492
442 Ga0501039_0128433 3300049575 Bacteria 1989
443 Ga0501040_0001871 3300049576 Bacteria 13492
444 Ga0501040_0028917 3300049576 Bacteria 3738
445 Ga0501040_0049947 3300049576 Bacteria 2860
446 Ga0501040_0258918 3300049576 Bacteria 1242
447 Ga0501041_0000093 3300049577 Bacteria 35998
448 Ga0501041_0045288 3300049577 Bacteria 2674
449 Ga0501041_0047267 3300049577 Bacteria 2619
450 Ga0501042_0001362 3300049578 Bacteria 14329
451 Ga0501042_0024570 3300049578 Bacteria 4227
452 Ga0501042_0218988 3300049578 Bacteria 1373
453 Ga0501043_0099004 3300049579 Bacteria 2292
454 Ga0501046_0002098 3300049580 Bacteria 18889
455 Ga0501046_0004597 3300049580 Bacteria 12463
456 Ga0501046_0053701 3300049580 Bacteria 3172
457 Ga0501046_0240351 3300049580 Bacteria 1336
458 Ga0501047_0004982 3300049581 Bacteria 12465
459 Ga0501048_0000064 3300049582 Bacteria 53946
460 Ga0501048_0013984 3300049582 Bacteria 5949
461 Ga0501048_0289712 3300049582 Bacteria 1164
462 Ga0501068_0010872 3300049584 Bacteria 5122
463 Ga0501070_0015676 3300049586 Bacteria 6371
464 Ga0501070_0019615 3300049586 Bacteria 5669
465 Ga0501071_0000013 3300049587 Bacteria 61958
466 Ga0501071_0343590 3300049587 Bacteria 1135
467 Ga0501072_0000932 3300049588 Bacteria 21539
468 Ga0501072_0001317 3300049588 Bacteria 18620
469 Ga0501072_0058419 3300049588 Bacteria 3040
470 Ga0501073_0029825 3300049589 Bacteria 3897
471 Ga0501074_0116931 3300049590 Bacteria 1908
472 Ga0501074_0174371 3300049590 Bacteria 1535
473 Ga0501075_0000154 3300049591 Bacteria 34517
474 Ga0501075_0005574 3300049591 Bacteria 8612
475 Ga0501075_0018601 3300049591 Bacteria 5031
476 Ga0501075_0036893 3300049591 Bacteria 3649
477 Ga0501076_0000413 3300049592 Bacteria 26801
478 Ga0501076_0058540 3300049592 Bacteria 3063
479 Ga0501077_0003031 3300049593 Bacteria 10074
480 Ga0501257_005513 3300049686 Bacteria 2792
481 Ga0501079_0001509 3300049741 Bacteria 16484
482 Ga0501079_0085296 3300049741 Bacteria 2444
483 Ga0501080_0002408 3300049742 Bacteria 16329
484 Ga0501080_0003393 3300049742 Bacteria 14047
485 Ga0501080_0063862 3300049742 Bacteria 3426
486 Ga0501080_0084730 3300049742 Bacteria 2944
487 Ga0501080_0098883 3300049742 Bacteria 2708
488 Ga0501081_0000104 3300049743 Bacteria 35460
489 Ga0501081_0012332 3300049743 Bacteria 5613
490 Ga0501081_0031367 3300049743 Bacteria 3602
491 Ga0501081_0101819 3300049743 Bacteria 2031
492 Ga0501081_0177079 3300049743 Bacteria 1541
493 Ga0501083_0002393 3300049744 Bacteria 12855
494 Ga0501035_0007164 3300049822 Bacteria 10434
495 Ga0501044_0194733 3300049823 Bacteria 1988
496 Ga0501045_0000155 3300049824 Bacteria 36950
497 Ga0501045_0014588 3300049824 Bacteria 5571
498 Ga0501045_0036683 3300049824 Bacteria 3561
499 Ga0501045_0135694 3300049824 Bacteria 1829
500 nmdc:mga05p37_121679_c1 3300050507 Bacteria 3205
501 nmdc:mga05p37_196672_c1 3300050507 Bacteria 2444
502 nmdc:mga05p37_44860_c1 3300050507 Bacteria 5438
503 nmdc:mga05p37_53485_c1 3300050507 Bacteria 4965
504 nmdc:mga05p37_53921_c1 3300050507 Bacteria 4947
505 nmdc:mga05p37_60506_c1 3300050507 Bacteria 3639
506 nmdc:mga05p37_88092_c1 3300050507 Bacteria 3826
507 nmdc:mga09592_6097_c1 3300050508 Bacteria 9821
508 nmdc:mga0qj67_252667_c1 3300050509 Bacteria 1430
509 nmdc:mga0qj67_40159_c1 3300050509 Bacteria 3678
510 nmdc:mga06r32_106967_c1 3300050510 Bacteria 2749
511 nmdc:mga06r32_43072_c1 3300050510 Bacteria 4294
512 nmdc:mga06r32_90416_c1 3300050510 Bacteria 2991
513 nmdc:mga08y16_180704_c1 3300050511 Bacteria 2191
514 nmdc:mga08y16_18815_c1 3300050511 Bacteria 7277
515 nmdc:mga0n895_263631_c1 3300050512 Bacteria 1748
516 nmdc:mga0n895_30012_c1 3300050512 Bacteria 5192
517 nmdc:mga0rr50_61631_c1 3300050513 Bacteria 2827
518 nmdc:mga08x19_50417_c1 3300050514 Bacteria 2671
519 nmdc:mga0a205_47495_c1 3300050515 Bacteria 4143
520 Ga0500595_011176 3300053119 Bacteria 3528
521 Ga0501084_0001282 3300054114 Bacteria 19798
522 Ga0501084_0067176 3300054114 Bacteria 3001
523 Ga0501084_0097023 3300054114 Bacteria 2475
524 Ga0501082_0001820 3300060353 Bacteria 18784
525 Ga0501082_0353803 3300060353 Bacteria 1281
526 Ga0530510_0001906 3300061734 Bacteria 14264
527 Ga0530510_0009352 3300061734 Bacteria 6873
528 Ga0530510_0042523 3300061734 Bacteria 3283
529 Ga0530510_0090967 3300061734 Bacteria 2226
530 3006978645 3006978542 Bacteria 5328100
531 2511179321 2510917027 Bacteria 5287437
532 2512640539 2512564013 Bacteria 6286191
533 2526060685 2524614857 Bacteria 4146328
534 2537898712 2537561592 Bacteria 4348607
535 2555470366 2554235283 Bacteria 3683090
536 2556066150 2554235469 Bacteria 3590176
537 2571533645 2571042143 Bacteria 6986194
538 2573041449 2571042588 Bacteria 5045676
539 2578335517 2576861424 Bacteria 5270569
540 2621273744 2619619294 Bacteria 5575484
541 2643737104 2643221543 Bacteria 6628015
542 2644740326 2643221735 Bacteria 3676263
543 2686996080 2684623153 Bacteria 3878815
544 2687497325 2687453109 Bacteria 3860091
545 2712198583 2711768088 Bacteria 3195027
546 2723602691 2721755693 Bacteria 6126117
547 2728531793 2728368933 Bacteria 7044283
548 2730138666 2728369359 Bacteria 5621728
549 2738840886 2738541299 Bacteria 4020721
550 2740062153 2739367875 Bacteria 4157290
551 2753809396 2751185905 Bacteria 6142767
552 2802438983 2802428803 Bacteria 5806948
553 2808867999 2808606364 Bacteria 4465927
554 2810365244 2808606700 Bacteria 3482157
555 2812315200 2811994870 Bacteria 3776934
556 2817479012 2816332295 Bacteria 4352468
557 2817617640 2816332336 Bacteria 5207640
558 2819725370 2818991468 Bacteria 3723169
559 2821115701 2821111986 Bacteria 6894338
560 2823527173 2823526263 Bacteria 3765752
561 2842776858 2842775625 Bacteria 5587290
562 2852677198 2852673933 Bacteria 3347676
563 2857462814 2857460504 Bacteria 5194327
564 2857464779 2857460504 Bacteria 5194327
565 2864738632 2864733723 Bacteria 6770668
566 2881638216 2881636855 Bacteria 5205297
567 2885531241 2885526491 Bacteria 7164189
568 2889043807 2889042446 Bacteria 7618936
569 2889278648 2889276214 Bacteria 5979355
570 2904166494 2904162308 Bacteria 7086713
571 2904494999 2904490793 Bacteria 7046938
572 2904598750 2904595352 Bacteria 6124848
573 2905928546 2905926851 Bacteria 4423176
574 2908669227 2908665501 Bacteria 3678115
575 2915600617 2915597211 Bacteria 6475886
576 2915607940 2915606848 Bacteria 6032732
577 2915608236 2915606848 Bacteria 6032732
578 2916973361 2916971899 Bacteria 4250608
579 2919096986 2919093281 Bacteria 3660974
580 2919163780 2919160200 Bacteria 6929020
581 2919415727 2919414237 Bacteria 5429133
582 2919730455 2919726948 Bacteria 3696050
583 2928511027 2928510474 Bacteria 4815308
584 2928515100 2928510474 Bacteria 4815308
585 2929185755 2929183550 Bacteria 6377511
586 2931387270 2931384279 Bacteria 7299545
587 2936364508 2936361878 Bacteria 5632809
588 2938654367 2938649242 Bacteria 7118381
589 2939596363 2939593269 Bacteria 4798695
590 2939683526 2939679117 Bacteria 6921672
591 2939703863 2939702853 Bacteria 5139229
592 2945994152 2945991243 Bacteria 7008369
593 2946003501 2946003308 Bacteria 3857229
594 2946056912 2946053406 Bacteria 6978655
595 2954775328 2954773129 Bacteria 3741715
596 2968561512 2968558590 Bacteria 6956864
597 2971513204 2971511577 Bacteria 5404012
598 2977258986 2977254563 Bacteria 4828420
599 2980178592 2980176882 Bacteria 5397533
600 2990280011 2990275345 Bacteria 4887158
601 2996633187 2996632988 Bacteria 6921523
602 3001270214 3001267043 Bacteria 4823521
603 3001895463 3001892409 Bacteria 6328293
604 3006859328 3006858327 Bacteria 4317835
605 3006975502 3006973921 Bacteria 4423788
606 648169036 648028048 Bacteria 5394884
607 8022953750 8022948649 Bacteria 5366783
608 8054282668 8054280661 Bacteria 4232245
609 8054466372 8054465665 Bacteria 7323556
610 JGI24743J22301_10000399
611 JGI24743J22301_10004566
612 JGI25151J46595_10000103
613 Ga0006562J51391_1004806
614 JGI25404J52841_10003241
615 Ga0055538_1000145
616 Ga0055536_1025782
617 Ga0070666_10020555
618 Ga0070680_100077822
619 Ga0070682_100091514
620 Ga0070682_100169652
621 Ga0068868_100043413
622 Ga0068868_100050915
623 Ga0068868_100286325
624 Ga0068868_100286452
625 Ga0070660_100054884
626 Ga0070660_100079064
627 Ga0070691_10016123
628 Ga0070691_10034562
629 Ga0070691_10100260
630 Ga0070687_100187552
631 Ga0070668_100012251
632 Ga0070659_100029616
633 Ga0070659_100220983
634 Ga0070709_10053311
635 Ga0070714_100009735
636 Ga0070714_100053613
637 Ga0070713_100181225
638 Ga0070710_10132572
639 Ga0070705_100003304
640 Ga0070705_100006575
641 Ga0070705_100029973
642 Ga0070694_100020211
643 Ga0070708_100467605
644 Ga0070663_100006489
645 Ga0070678_100012254
646 Ga0070662_100008646
647 Ga0070662_100011226
648 Ga0070662_100121741
649 Ga0070681_10053329
650 Ga0070706_100005655
651 Ga0070706_100435278
652 Ga0070707_100017208
653 Ga0070698_100320873
654 Ga0070698_100441516
655 Ga0070699_100290147
656 Ga0070679_100027902
657 Ga0070679_100051193
658 Ga0070684_100204153
659 Ga0070697_100067881
660 Ga0070697_100303948
661 Ga0068853_100029960
662 Ga0068853_100277354
663 Ga0070672_100106138
664 Ga0070686_100004292
665 Ga0070686_100040015
666 Ga0070686_100069152
667 Ga0070695_100065000
668 Ga0070695_100244680
669 Ga0070693_100007061
670 Ga0070665_100102330
671 Ga0070665_100341557
672 Ga0068855_100052063
673 Ga0068855_100062032
674 Ga0068857_100124682
675 Ga0068854_100020589
676 Ga0068856_100113843
677 Ga0068856_100250638
678 Ga0070702_100059638
679 Ga0068859_100576609
680 Ga0068864_100081656
681 Ga0068864_100193565
682 Ga0068861_100003660
683 Ga0068861_100102633
684 Ga0081455_10061667
685 Ga0081538_10015247
686 Ga0081540_1008192
687 Ga0081540_1013419
688 Ga0070717_10007665
689 Ga0070717_10011845
690 Ga0070717_10448938
691 Ga0075363_100007735
692 Ga0070716_100050783
693 Ga0097621_100326257
694 Ga0075370_10057657
695 Ga0068871_100051642
696 Ga0075428_100043818
697 Ga0075428_100166589
698 Ga0075428_100390429
699 Ga0075430_100125056
700 Ga0075431_100408324
701 Ga0075433_10102626
702 Ga0075433_10215010
703 Ga0075434_100076407
704 Ga0075429_100027327
705 Ga0075429_100075664
706 Ga0075429_100186645
707 Ga0075436_100223650
708 Ga0097620_100576539
709 Ga0079104_1002396
710 Ga0075435_100066087
711 Ga0075435_100104453
712 Ga0075435_100390468
713 Ga0105244_10007307
714 Ga0105240_10021891
715 Ga0111539_10013355
716 Ga0111539_10142316
717 Ga0111539_10323561
718 Ga0105245_10016372
719 Ga0105245_10028267
720 Ga0105245_10043749
721 Ga0105245_10072283
722 Ga0105245_10200570
723 Ga0114129_10011990
724 Ga0114129_10014967
725 Ga0114129_10016367
726 Ga0114129_10029547
727 Ga0114129_10042097
728 Ga0114129_10065449
729 Ga0114129_10201854
730 Ga0114129_10313028
731 Ga0114129_10350859
732 Ga0114129_10510959
733 Ga0105241_10038852
734 Ga0105242_10090652
735 Ga0105242_10143914
736 Ga0105248_10124601
737 Ga0105237_10004487
738 Ga0105238_10010543
739 Ga0105238_10383106
740 Ga0105249_10012136
741 Ga0105249_10095999
742 Ga0105239_10007362
743 Ga0105239_10009499
744 Ga0105239_10024120
745 Ga0105239_10025482
746 Ga0105239_10064707
747 Ga0105239_10354255
748 Ga0105246_10001172
749 Ga0157316_1000916
750 Ga0157373_10013686
751 Ga0157371_10002178
752 Ga0157371_10014071
753 Ga0157369_10545110
754 Ga0157372_10005383
755 Ga0157375_10016940
756 Ga0157375_10145375
757 Ga0157375_10260956
758 Ga0157375_10416161
759 Ga0163163_10044949
760 Ga0163163_10081748
761 Ga0157379_10025195
762 Ga0206350_10180134
763 Ga0209784_100230
764 Ga0209147_100068
765 Ga0209437_100516
766 Ga0209676_1002223
767 Ga0209025_1004212
768 Ga0209025_1004842
769 Ga0207655_1009289
770 Ga0207692_10000002
771 Ga0207692_10027447
772 Ga0207680_10038914
773 Ga0207699_10178347
774 Ga0207684_10021703
775 Ga0207684_10283769
776 Ga0207654_10009521
777 Ga0207654_10096883
778 Ga0207695_10099780
779 Ga0207671_10002832
780 Ga0207693_10014720
781 Ga0207693_10025237
782 Ga0207693_10096915
783 Ga0207663_10001302
784 Ga0207660_10034146
785 Ga0207652_10033665
786 Ga0207652_10184016
787 Ga0207646_10040711
788 Ga0207646_10108403
789 Ga0207681_10054951
790 Ga0207694_10213814
791 Ga0207687_10011970
792 Ga0207687_10061234
793 Ga0207687_10061577
794 Ga0207700_10302099
795 Ga0207700_10303419
796 Ga0207700_10326152
797 Ga0207700_10329833
798 Ga0207664_10016386
799 Ga0207664_10023928
800 Ga0207644_10154604
801 Ga0207706_10012501
802 Ga0207706_10015392
803 Ga0207706_10021836
804 Ga0207665_10001598
805 Ga0207689_10077234
806 Ga0207661_10298495
807 Ga0207661_10346680
808 Ga0207667_10084398
809 Ga0207712_10033599
810 Ga0207668_10032376
811 Ga0207639_10146257
812 Ga0207678_10020634
813 Ga0207702_10105736
814 Ga0207702_10182288
815 Ga0207648_10031155
816 Ga0207676_10020291
817 Ga0207676_10181537
818 Ga0207674_10022244
819 Ga0207674_10128303
820 Ga0207675_100004730
821 Ga0207675_100050616
822 Ga0207675_100072576
823 Ga0207683_10002488
824 Ga0209281_1000705
825 Ga0207428_10005836
826 Ga0268266_10022598
827 Ga0268265_10447531
828 Ga0268264_10428471
829 Ga0265334_10021137
830 Ga0265322_10015627
831 Ga0307515_10163155
832 Ga0265338_10002932
833 Ga0265339_10097350
834 Ga0265327_10046310
835 Ga0265327_10129453
836 Ga0265316_10004110
837 Ga0307408_100009124
838 Ga0265313_10010463
839 Ga0307514_10003388
840 Ga0316579_10001673
841 Ga0316579_10003913
842 Ga0316579_10016425
843 Ga0265314_10004174
844 Ga0265342_10072576
845 Ga0316576_10008526
846 Ga0316576_10021301
847 Ga0316578_10004401
848 Ga0316577_10002076
849 Ga0316577_10004822
850 Ga0316577_10009407
851 Ga0316577_10010974
852 Ga0316577_10020065
853 Ga0316577_10057472
854 Ga0307413_10043867
855 Ga0307412_10103427
856 Ga0307416_100002337
857 Ga0316583_10005944
858 Ga0316583_10016540
859 Ga0316585_10021589
860 Ga0316580_10001198
861 Ga0316588_1002595
862 Ga0316596_1001952
863 Ga0373944_0018256
864 Ga0373951_0006008
865 Ga0373932_0024579
866 Ga0373939_0018084
867 Ga0373941_0006172
868 Ga0373945_0006113
869 Ga0373960_0042159
870 Ga0373943_0003130
871 Ga0373943_0008985
872 Ga0373943_0018874
873 Ga0373946_0008892
874 Ga0373942_0011236
875 Ga0316574_0010382
876 Ga0316574_0027656
877 Ga0373931_0112821
878 Ga0373935_0006397
879 Ga0373927_0061533
880 Ga0373947_0008879
881 Ga0373947_0011302
882 Ga0373947_0013827
883 Ga0373937_0284949
884 Ga0316582_0000334
885 Ga0316582_0002449
886 Ga0316582_0005503
887 Ga0316584_0003448
888 Ga0316584_0009770
889 Ga0316584_0019779
890 Ga0316584_0065635
891 Ga0316584_0092323
892 Ga0373925_0031780
893 Ga0373925_0034382
894 Ga0373925_0105618
895 Ga0395899_0006431
896 Ga0395899_0009381
897 Ga0395899_0029509
898 Ga0395899_0091749
899 Ga0395900_0004838
900 Ga0395900_0011127
901 Ga0395900_0038346
902 Ga0395900_0044598
903 Ga0395900_0137354
904 Ga0395898_0004055
905 Ga0395898_0019664
906 Ga0395898_0027474
907 Ga0395898_0035156
908 Ga0395898_0053622
909 Ga0395905_0001523
910 Ga0395905_0005666
911 Ga0395905_0011931
912 Ga0316581_0043509
913 Ga0395901_0003369
914 Ga0395901_0006823
915 Ga0395901_0007841
916 Ga0395901_0022002
917 Ga0395901_0093969
918 Ga0395901_0199788
919 Ga0400484_30791
920 Ga0242420_006368
921 Ga0400489_35584
922 Ga0400489_71342
923 Ga0400489_73553
924 Ga0436365_0259823
925 Ga0436363_0465515
926 Ga0451789_0513312
927 Ga0451853_0678818
928 Ga0451853_1663579
929 Ga0451577_0521270
930 Ga0466963_0057499
931 Ga0466964_0017447
932 Ga0453684_0101721
933 Ga0466968_0076666
934 Ga0466957_0011489
935 Ga0466960_0012322
936 Ga0466960_0023590
937 Ga0466960_0034617
938 Ga0466967_0007538
939 Ga0466967_0011977
940 Ga0466967_0013624
941 Ga0466967_0072022
942 Ga0466967_0092833
943 Ga0466967_0190876
944 Ga0466967_0310634
945 Ga0466967_0353532
946 Ga0495603_0001071
947 Ga0495603_0060496
948 Ga0495629_0351788
949 Ga0495641_0013624
950 Ga0495580_0051653
951 Ga0495594_0003190
952 Ga0495620_0020473
953 Ga0495630_0024229
954 Ga0495637_0017421
955 Ga0495644_0041484
956 Ga0495654_0084910
957 Ga0495609_0066372
958 Ga0495656_0137985
959 Ga0495625_0076568
960 Ga0495661_0049351
961 Ga0495661_0149850
962 Ga0495588_0006804
963 Ga0495588_0016293
964 Ga0495647_0071190
965 Ga0495658_0007677
966 Ga0495624_0113970
967 Ga0495589_0099252
968 Ga0495660_0006149
969 Ga0495660_0086864
970 Ga0495581_0063674
971 Ga0495581_0070550
972 Ga0495676_0007447
973 Ga0495676_0011839
974 Ga0495676_0031836
975 Ga0495680_0194237
976 Ga0495681_0034111
977 Ga0495686_0000008
978 Ga0495686_0012287
979 Ga0496100_0006393
980 Ga0496101_0018305
981 Ga0496101_0150646
982 Ga0496102_0012577
983 Ga0496102_0019251
984 Ga0496102_0024486
985 Ga0496102_0122404
986 Ga0496102_0178186
987 Ga0496102_0257344
988 Ga0496104_0000290
989 Ga0496104_0015417
990 Ga0496105_0000515
991 Ga0496105_0000680
992 Ga0496105_0003449
993 Ga0496105_0011678
994 Ga0496106_0046549
995 Ga0496106_0146666
996 Ga0496107_0156360
997 Ga0496107_0255186
998 Ga0496108_0007063
999 Ga0496108_0008037
1000 Ga0496108_0230244
1001 Ga0496109_0006740
1002 Ga0496109_0010250
1003 Ga0496109_0080015
1004 Ga0496109_0191875
1005 Ga0496109_0266974
1006 Ga0496110_0000127
1007 Ga0496110_0008749
1008 Ga0496110_0009333
1009 Ga0496110_0023628
1010 Ga0496110_0035047
1011 Ga0496110_0368117
1012 Ga0496111_0000056
1013 Ga0496111_0006410
1014 Ga0496111_0033270
1015 Ga0496111_0044515
1016 Ga0496112_0001755
1017 Ga0496112_0005566
1018 Ga0496112_0214561
1019 Ga0496113_0000066
1020 Ga0496113_0002849
1021 Ga0496113_0003404
1022 Ga0496113_0033702
1023 Ga0496115_0004675
1024 Ga0496115_0017430
1025 Ga0496115_0162179
1026 Ga0496116_0000557
1027 Ga0496116_0022190
1028 Ga0496118_0036427
1029 Ga0496118_0171267
1030 Ga0496119_0003008
1031 Ga0496119_0010922
1032 Ga0496120_0032146
1033 Ga0496121_0059578
1034 Ga0496121_0110680
1035 Ga0496123_0034347
1036 Ga0496124_0029283
1037 Ga0496124_0290014
1038 Ga0496125_0001486
1039 Ga0496125_0016168
1040 Ga0496126_0000357
1041 Ga0496126_0018333
1042 Ga0501345_00205
1043 Ga0501031_0016141
1044 Ga0501031_0034044
1045 Ga0501032_0040188
1046 Ga0501034_0294375
1047 Ga0501036_0000365
1048 Ga0501036_0175418
1049 Ga0501038_0004824
1050 Ga0501039_0007171
1051 Ga0501039_0128433
1052 Ga0501040_0001871
1053 Ga0501040_0028917
1054 Ga0501040_0049947
1055 Ga0501040_0258918
1056 Ga0501041_0000093
1057 Ga0501041_0045288
1058 Ga0501041_0047267
1059 Ga0501042_0001362
1060 Ga0501042_0024570
1061 Ga0501042_0218988
1062 Ga0501043_0099004
1063 Ga0501046_0002098
1064 Ga0501046_0004597
1065 Ga0501046_0053701
1066 Ga0501046_0240351
1067 Ga0501047_0004982
1068 Ga0501048_0000064
1069 Ga0501048_0013984
1070 Ga0501048_0289712
1071 Ga0501068_0010872
1072 Ga0501070_0015676
1073 Ga0501070_0019615
1074 Ga0501071_0000013
1075 Ga0501071_0343590
1076 Ga0501072_0000932
1077 Ga0501072_0001317
1078 Ga0501072_0058419
1079 Ga0501073_0029825
1080 Ga0501074_0116931
1081 Ga0501074_0174371
1082 Ga0501075_0000154
1083 Ga0501075_0005574
1084 Ga0501075_0018601
1085 Ga0501075_0036893
1086 Ga0501076_0000413
1087 Ga0501076_0058540
1088 Ga0501077_0003031
1089 Ga0501257_005513
1090 Ga0501079_0001509
1091 Ga0501079_0085296
1092 Ga0501080_0002408
1093 Ga0501080_0003393
1094 Ga0501080_0063862
1095 Ga0501080_0084730
1096 Ga0501080_0098883
1097 Ga0501081_0000104
1098 Ga0501081_0012332
1099 Ga0501081_0031367
1100 Ga0501081_0101819
1101 Ga0501081_0177079
1102 Ga0501083_0002393
1103 Ga0501035_0007164
1104 Ga0501044_0194733
1105 Ga0501045_0000155
1106 Ga0501045_0014588
1107 Ga0501045_0036683
1108 Ga0501045_0135694
1109 nmdc:mga05p37_121679_c1
1110 nmdc:mga05p37_196672_c1
1111 nmdc:mga05p37_44860_c1
1112 nmdc:mga05p37_53485_c1
1113 nmdc:mga05p37_53921_c1
1114 nmdc:mga05p37_60506_c1
1115 nmdc:mga05p37_88092_c1
1116 nmdc:mga09592_6097_c1
1117 nmdc:mga0qj67_252667_c1
1118 nmdc:mga0qj67_40159_c1
1119 nmdc:mga06r32_106967_c1
1120 nmdc:mga06r32_43072_c1
1121 nmdc:mga06r32_90416_c1
1122 nmdc:mga08y16_180704_c1
1123 nmdc:mga08y16_18815_c1
1124 nmdc:mga0n895_263631_c1
1125 nmdc:mga0n895_30012_c1
1126 nmdc:mga0rr50_61631_c1
1127 nmdc:mga08x19_50417_c1
1128 nmdc:mga0a205_47495_c1
1129 Ga0500595_011176
1130 Ga0501084_0001282
1131 Ga0501084_0067176
1132 Ga0501084_0097023
1133 Ga0501082_0001820
1134 Ga0501082_0353803
1135 Ga0530510_0001906
1136 Ga0530510_0009352
1137 Ga0530510_0042523
1138 Ga0530510_0090967
1139 3006978645
1140 2511179321
1141 2512640539
1142 2526060685
1143 2537898712
1144 2555470366
1145 2556066150
1146 2571533645
1147 2573041449
1148 2578335517
1149 2621273744
1150 2643737104
1151 2644740326
1152 2686996080
1153 2687497325
1154 2712198583
1155 2723602691
1156 2728531793
1157 2730138666
1158 2738840886
1159 2740062153
1160 2753809396
1161 2802438983
1162 2808867999
1163 2810365244
1164 2812315200
1165 2817479012
1166 2817617640
1167 2819725370
1168 2821115701
1169 2823527173
1170 2842776858
1171 2852677198
1172 2857462814
1173 2857464779
1174 2864738632
1175 2881638216
1176 2885531241
1177 2889043807
1178 2889278648
1179 2904166494
1180 2904494999
1181 2904598750
1182 2905928546
1183 2908669227
1184 2915600617
1185 2915607940
1186 2915608236
1187 2916973361
1188 2919096986
1189 2919163780
1190 2919415727
1191 2919730455
1192 2928511027
1193 2928515100
1194 2929185755
1195 2931387270
1196 2936364508
1197 2938654367
1198 2939596363
1199 2939683526
1200 2939703863
1201 2945994152
1202 2946003501
1203 2946056912
1204 2954775328
1205 2968561512
1206 2971513204
1207 2977258986
1208 2980178592
1209 2990280011
1210 2996633187
1211 3001270214
1212 3001895463
1213 3006859328
1214 3006975502
1215 648169036
1216 8022953750
1217 8054282668
1218 8054466372

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

161

381

0.99

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

49

150

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.8223 89 309
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7826 89 309
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7756 89 309
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7572 89 309
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.7428 67 305
ID Description Score Start End Superfamily
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9638 88 309 1.10.3720.10
af_Q2G1F7_265_478_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9559 87 306 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9551 88 309 1.10.3720.10
af_Q2FZR7_83_297_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9523 85 307 1.10.3720.10
af_P75798_87_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.948 89 309 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7W0HB20-F1-model_v4 ABC transporter permease 0.9846 1 315 GO:0005886
GO:0055085
AF-A0A7W0HB20-F1-model_v4 ABC transporter permease 0.9784 1 315 GO:0005886
GO:0055085
AF-X1DG11-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9769 92 287 GO:0005886
GO:0055085
AF-A0A538J0C1-F1-model_v4 ABC transporter permease 0.9675 70 313 GO:0005886
GO:0055085
AF-X6DHC1-F1-model_v4 Peptide ABC transporter 0.9624 84 311 GO:0005886
GO:0071916

Map