F469601

General Info

Members Datasets Scaffolds Average Seq Length
617 303 1234 278

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10009686|JGI24739J22299_100096862
Length 304
Sequence VKRLIVTADDFGASLAVNEAVEQAHREGILTCASLMVAGEAAADAVARARAMPKLGVGLHLVLVDGRPMLPPESVPDLVEDDGRFRDDMARAGVHFFFRPAVRRQLEAEIAAQFAGFTATGLPLDHVNAHKHFHLHPTIASLILKIGRRHGMRAARAPIEPRTTLRKIEPVGGFDVALPWAKLVRRRLRRAGLAVPDQVFGLAWSGALNTDRLCGLLKHLPEGLTEVYAHPATAPYPGSAPGYAYADELAALTDPLARDLIKRERVALGRSLILSRPSQHEYQQPLAQFRQPRRTAIRSDQRSL

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
107 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
166 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
171 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
200 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
201 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
219 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
224 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
225 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
241 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
281 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
282 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
283 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
284 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
285 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
286 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
287 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
288 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
289 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
290 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
291 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
292 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
293 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
294 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
295 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
296 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
297 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
298 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
299 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
300 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
303 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.62
Nodule 0
Rhizoplane 4.05
Rhizosphere 81.04
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10009686 3300001989 Bacteria 3586
2 JGI24752J21851_1000027 3300001976 Bacteria 17325
3 JGI24740J21852_10003653 3300001979 Bacteria 6700
4 JGI24739J22299_10027493 3300001989 Bacteria 1988
5 JGI24737J22298_10001928 3300001990 Bacteria 7416
6 JGI24737J22298_10007699 3300001990 Bacteria 3628
7 JGI24735J21928_10017849 3300002067 Bacteria 2192
8 JGI24735J21928_10021680 3300002067 Bacteria 1960
9 JGI24750J21931_1000041 3300002070 Bacteria 17174
10 JGI24748J21848_1000096 3300002074 Bacteria 23684
11 JGI24738J21930_10016388 3300002075 Bacteria 1566
12 JGI24034J26672_10000028 3300002239 Bacteria 105058
13 JGI24742J22300_10001008 3300002244 Bacteria 4339
14 JGI25165J46597_1000008 3300003214 Bacteria 478603
15 JGI25165J46597_1000297 3300003214 Bacteria 62745
16 JGI25165J46597_1000489 3300003214 Bacteria 38233
17 JGI25153J46596_10000113 3300003215 Bacteria 92345
18 JGI25153J46596_10000672 3300003215 Bacteria 20919
19 rootH2_10222705 3300003320 Bacteria 1045
20 rootL2_10023548 3300003322 Bacteria 1894
21 rootL2_10069639 3300003322 Bacteria 1414
22 Ga0055525_1000051 3300003759 Bacteria 240942
23 Ga0055542_1000677 3300003762 Bacteria 27414
24 Ga0055529_1000016 3300003763 Bacteria 364775
25 Ga0065165_1005029 3300005262 Bacteria 7727
26 Ga0065707_10081714 3300005295 Bacteria 75872
27 Ga0070658_10000116 3300005327 Bacteria 71744
28 Ga0070658_10025975 3300005327 Bacteria 4699
29 Ga0070658_10127650 3300005327 Bacteria 2118
30 Ga0070658_10458427 3300005327 Bacteria 1099
31 Ga0070690_100000003 3300005330 Bacteria 144748
32 Ga0070690_100024373 3300005330 Bacteria 3720
33 Ga0070666_10000006 3300005335 Bacteria 319173
34 Ga0070666_10213530 3300005335 Bacteria 1359
35 Ga0070680_100000408 3300005336 Bacteria 29300
36 Ga0070680_100056465 3300005336 Bacteria 3209
37 Ga0068868_100136708 3300005338 Bacteria 2009
38 Ga0068868_100187331 3300005338 Bacteria 1720
39 Ga0070660_100003168 3300005339 Bacteria 11299
40 Ga0070660_100229896 3300005339 Bacteria 1509
41 Ga0070660_100473033 3300005339 Bacteria 1041
42 Ga0070689_100034895 3300005340 Bacteria 3839
43 Ga0070691_10001140 3300005341 Bacteria 11052
44 Ga0070687_100281311 3300005343 Bacteria 1047
45 Ga0070661_100014295 3300005344 Bacteria 5592
46 Ga0070668_100132675 3300005347 Bacteria 2000
47 Ga0070669_100000014 3300005353 Bacteria 206875
48 Ga0070671_100035911 3300005355 Bacteria 4107
49 Ga0070674_100000746 3300005356 Bacteria 16681
50 Ga0070688_100062352 3300005365 Bacteria 2360
51 Ga0070659_100078879 3300005366 Bacteria 2628
52 Ga0070659_100165823 3300005366 Bacteria 1807
53 Ga0070667_100099545 3300005367 Bacteria 2510
54 Ga0070667_100104308 3300005367 Bacteria 2452
55 Ga0070709_10007492 3300005434 Bacteria 5985
56 Ga0070713_100000007 3300005436 Bacteria 186402
57 Ga0070713_100041897 3300005436 Bacteria 3733
58 Ga0070713_100089919 3300005436 Bacteria 2639
59 Ga0070710_10082945 3300005437 Bacteria 1875
60 Ga0070711_100003889 3300005439 Bacteria 8771
61 Ga0070711_100012918 3300005439 Bacteria 5232
62 Ga0070711_100035230 3300005439 Bacteria 3345
63 Ga0070705_100196551 3300005440 Bacteria 1379
64 Ga0070678_100000585 3300005456 Bacteria 17909
65 Ga0070662_100008234 3300005457 Bacteria 6789
66 Ga0070662_100026287 3300005457 Bacteria 4029
67 Ga0070662_100105339 3300005457 Bacteria 2141
68 Ga0070662_100141031 3300005457 Bacteria 1868
69 Ga0070662_100167817 3300005457 Bacteria 1721
70 Ga0070662_100455243 3300005457 Bacteria 1063
71 Ga0070681_10000003 3300005458 Bacteria 252785
72 Ga0070681_10212565 3300005458 Bacteria 1850
73 Ga0070685_10000072 3300005466 Bacteria 59953
74 Ga0070706_100049759 3300005467 Bacteria 3867
75 Ga0070699_100304718 3300005518 Bacteria 1429
76 Ga0070699_100392392 3300005518 Bacteria 1254
77 Ga0070679_100004864 3300005530 Bacteria 12398
78 Ga0070679_100086956 3300005530 Bacteria 3113
79 Ga0070679_100239122 3300005530 Bacteria 1774
80 Ga0068853_100133456 3300005539 Bacteria 2224
81 Ga0068853_100152498 3300005539 Bacteria 2081
82 Ga0068853_100182113 3300005539 Bacteria 1906
83 Ga0068853_100219650 3300005539 Bacteria 1735
84 Ga0070686_100000022 3300005544 Bacteria 131168
85 Ga0070695_100307739 3300005545 Bacteria 1174
86 Ga0070696_100216173 3300005546 Unclassified 1436
87 Ga0070696_100299725 3300005546 Bacteria 1231
88 Ga0070665_100000019 3300005548 Bacteria 413972
89 Ga0070665_100003100 3300005548 Bacteria 17903
90 Ga0070665_100035688 3300005548 Bacteria 5000
91 Ga0070665_100465970 3300005548 Bacteria 1274
92 Ga0068855_100003607 3300005563 Bacteria 18908
93 Ga0068855_100032581 3300005563 Bacteria 6221
94 Ga0068855_100102241 3300005563 Bacteria 3298
95 Ga0068855_100137912 3300005563 Bacteria 2782
96 Ga0068855_100232129 3300005563 Bacteria 2065
97 Ga0068855_100261040 3300005563 Bacteria 1929
98 Ga0068855_100337507 3300005563 Bacteria 1662
99 Ga0068855_100746958 3300005563 Bacteria 1043
100 Ga0068855_100865826 3300005563 Bacteria 956
101 Ga0070664_100186202 3300005564 Bacteria 1848
102 Ga0070664_100275459 3300005564 Bacteria 1516
103 Ga0070664_100492982 3300005564 Bacteria 1129
104 Ga0068857_100000974 3300005577 Bacteria 21916
105 Ga0068857_100035743 3300005577 Bacteria 4401
106 Ga0068857_100082388 3300005577 Bacteria 2874
107 Ga0068857_100104347 3300005577 Bacteria 2545
108 Ga0068854_100134537 3300005578 Bacteria 1891
109 Ga0068854_100501215 3300005578 Bacteria 1022
110 Ga0068856_100000142 3300005614 Bacteria 72931
111 Ga0068856_100008980 3300005614 Bacteria 9725
112 Ga0068856_100011622 3300005614 Bacteria 8539
113 Ga0068856_100156852 3300005614 Bacteria 2286
114 Ga0068856_100184802 3300005614 Bacteria 2098
115 Ga0068856_100218587 3300005614 Bacteria 1921
116 Ga0068856_100224604 3300005614 Bacteria 1893
117 Ga0068852_100000043 3300005616 Bacteria 89867
118 Ga0068852_100022553 3300005616 Bacteria 5051
119 Ga0068852_100038836 3300005616 Bacteria 4004
120 Ga0068852_100108186 3300005616 Bacteria 2523
121 Ga0068852_100216282 3300005616 Bacteria 1820
122 Ga0068852_100420062 3300005616 Bacteria 1319
123 Ga0068859_100002673 3300005617 Bacteria 18104
124 Ga0068859_100051845 3300005617 Bacteria 4125
125 Ga0068864_100600699 3300005618 Bacteria 1068
126 Ga0068861_100000111 3300005719 Bacteria 41057
127 Ga0068861_100009814 3300005719 Bacteria 6620
128 Ga0068863_100000048 3300005841 Bacteria 135912
129 Ga0068858_100000254 3300005842 Bacteria 57050
130 Ga0068858_100003776 3300005842 Bacteria 14971
131 Ga0068860_100000014 3300005843 Bacteria 319437
132 Ga0068862_100000595 3300005844 Bacteria 37638
133 Ga0068862_100047755 3300005844 Bacteria 3654
134 Ga0081455_10000088 3300005937 Bacteria 98815
135 Ga0070717_10000364 3300006028 Bacteria 29183
136 Ga0070715_10022472 3300006163 Bacteria 2460
137 Ga0070715_10191807 3300006163 Bacteria 1032
138 Ga0070716_100012383 3300006173 Bacteria 4323
139 Ga0070712_100000015 3300006175 Bacteria 106593
140 Ga0070712_100001349 3300006175 Bacteria 14896
141 Ga0075366_10149083 3300006195 Bacteria 1416
142 Ga0097621_100000667 3300006237 Bacteria 24145
143 Ga0097621_100045788 3300006237 Bacteria 3535
144 Ga0068871_100006814 3300006358 Bacteria 8125
145 Ga0068871_100143328 3300006358 Bacteria 2033
146 Ga0075434_100019894 3300006871 Bacteria 6501
147 Ga0068865_100196448 3300006881 Bacteria 1563
148 Ga0075436_100000024 3300006914 Bacteria 115057
149 Ga0097620_100002673 3300006931 Bacteria 18104
150 Ga0097620_100051843 3300006931 Bacteria 4125
151 Ga0099795_10003949 3300007788 Bacteria 3754
152 Ga0105240_10020214 3300009093 Bacteria 8888
153 Ga0105240_10030193 3300009093 Bacteria 7049
154 Ga0105240_10034962 3300009093 Bacteria 6479
155 Ga0105240_10055977 3300009093 Bacteria 4936
156 Ga0105240_10069635 3300009093 Bacteria 4354
157 Ga0105240_10136077 3300009093 Bacteria 2942
158 Ga0105240_10286566 3300009093 Bacteria 1890
159 Ga0105240_10500175 3300009093 Bacteria 1352
160 Ga0105245_10001618 3300009098 Bacteria 20495
161 Ga0105245_10027313 3300009098 Bacteria 5028
162 Ga0105245_10037656 3300009098 Bacteria 4301
163 Ga0105247_10025691 3300009101 Bacteria 3554
164 Ga0105247_10047414 3300009101 Bacteria 2638
165 Ga0105243_10000782 3300009148 Bacteria 30522
166 Ga0105243_10347480 3300009148 Bacteria 1361
167 Ga0105241_10001365 3300009174 Bacteria 18600
168 Ga0105241_10007433 3300009174 Bacteria 8066
169 Ga0105241_10060855 3300009174 Bacteria 2906
170 Ga0105242_10026757 3300009176 Bacteria 4574
171 Ga0105242_10029836 3300009176 Bacteria 4353
172 Ga0105248_10000001 3300009177 Bacteria 1881304
173 Ga0105248_10002303 3300009177 Bacteria 21145
174 Ga0105248_10010326 3300009177 Bacteria 10277
175 Ga0105248_10029637 3300009177 Bacteria 6106
176 Ga0105248_10089852 3300009177 Bacteria 3458
177 Ga0105237_10002363 3300009545 Bacteria 23404
178 Ga0105237_10006932 3300009545 Bacteria 12489
179 Ga0105237_10143315 3300009545 Bacteria 2384
180 Ga0105237_10297111 3300009545 Bacteria 1618
181 Ga0105237_10301526 3300009545 Bacteria 1605
182 Ga0105238_10013158 3300009551 Bacteria 8349
183 Ga0105238_10022562 3300009551 Bacteria 6415
184 Ga0105238_10060392 3300009551 Bacteria 3795
185 Ga0105238_10118954 3300009551 Bacteria 2622
186 Ga0105238_10216109 3300009551 Bacteria 1893
187 Ga0105238_10238602 3300009551 Bacteria 1795
188 Ga0105238_10265492 3300009551 Bacteria 1696
189 Ga0105238_10376424 3300009551 Bacteria 1411
190 Ga0105238_10422559 3300009551 Bacteria 1328
191 Ga0105238_10596346 3300009551 Bacteria 1112
192 Ga0105249_10000104 3300009553 Bacteria 118213
193 Ga0105239_10010079 3300010375 Bacteria 10593
194 Ga0105239_10067661 3300010375 Bacteria 3924
195 Ga0105239_10075526 3300010375 Bacteria 3706
196 Ga0105239_10235748 3300010375 Bacteria 2054
197 Ga0105239_10492835 3300010375 Bacteria 1393
198 Ga0105239_10527391 3300010375 Bacteria 1344
199 Ga0105239_10794204 3300010375 Bacteria 1084
200 Ga0157373_10000231 3300013100 Bacteria 45740
201 Ga0157373_10140171 3300013100 Bacteria 1700
202 Ga0157373_10145923 3300013100 Bacteria 1664
203 Ga0157371_10000146 3300013102 Bacteria 103290
204 Ga0157371_10210014 3300013102 Bacteria 1397
205 Ga0157370_10000503 3300013104 Bacteria 48827
206 Ga0157370_10002391 3300013104 Bacteria 22634
207 Ga0157370_10024422 3300013104 Bacteria 5986
208 Ga0157369_10038161 3300013105 Bacteria 5254
209 Ga0157369_10055615 3300013105 Bacteria 4271
210 Ga0157369_10109316 3300013105 Bacteria 2940
211 Ga0157369_10247964 3300013105 Bacteria 1859
212 Ga0157369_10322927 3300013105 Bacteria 1605
213 Ga0157369_10398191 3300013105 Bacteria 1428
214 Ga0157374_10039731 3300013296 Bacteria 4330
215 Ga0157374_10189625 3300013296 Bacteria 2011
216 Ga0157374_10340028 3300013296 Bacteria 1490
217 Ga0157378_10044499 3300013297 Bacteria 3942
218 Ga0157378_10082539 3300013297 Bacteria 2906
219 Ga0157378_10100182 3300013297 Bacteria 2644
220 Ga0163162_10318222 3300013306 Bacteria 1689
221 Ga0157372_10110327 3300013307 Bacteria 3151
222 Ga0157372_10311967 3300013307 Unclassified 1831
223 Ga0157372_10614659 3300013307 Bacteria 1267
224 Ga0163163_10145093 3300014325 Bacteria 2417
225 Ga0157380_10000181 3300014326 Bacteria 36496
226 Ga0157379_10010918 3300014968 Bacteria 7918
227 Ga0157379_10017171 3300014968 Bacteria 6375
228 Ga0157376_10624352 3300014969 Bacteria 1075
229 Ga0163161_10000020 3300017792 Bacteria 214642
230 Ga0163161_10032415 3300017792 Bacteria 3730
231 Ga0213874_10091799 3300021377 Bacteria 998
232 Ga0213875_10001890 3300021388 Bacteria 12952
233 Ga0213871_10027626 3300021441 Unclassified 1459
234 Ga0207672_1000329 3300025223 Bacteria 6329
235 Ga0209674_101931 3300025226 Bacteria 4859
236 Ga0209563_100019 3300025230 Bacteria 697828
237 Ga0207427_100640 3300025231 Bacteria 16950
238 Ga0209026_1003308 3300025250 Bacteria 5371
239 Ga0209026_1013370 3300025250 Bacteria 1400
240 Ga0209148_1000017 3300025254 Bacteria 787064
241 Ga0209148_1000061 3300025254 Bacteria 349575
242 Ga0209233_1000006 3300025261 Bacteria 1473685
243 Ga0209233_1000107 3300025261 Bacteria 267399
244 Ga0209233_1000382 3300025261 Bacteria 38319
245 Ga0209233_1009066 3300025261 Bacteria 3045
246 Ga0209455_1000005 3300025272 Bacteria 1416756
247 Ga0209455_1007242 3300025272 Bacteria 3158
248 Ga0209758_1000035 3300025297 Bacteria 448190
249 Ga0207680_10000011 3300025903 Bacteria 391225
250 Ga0207680_10259907 3300025903 Bacteria 1201
251 Ga0207647_10000527 3300025904 Bacteria 30498
252 Ga0207647_10001094 3300025904 Bacteria 20910
253 Ga0207647_10004311 3300025904 Bacteria 10549
254 Ga0207647_10089159 3300025904 Bacteria 1841
255 Ga0207699_10000660 3300025906 Bacteria 16579
256 Ga0207705_10001001 3300025909 Bacteria 23017
257 Ga0207705_10001461 3300025909 Bacteria 18836
258 Ga0207705_10054157 3300025909 Bacteria 2892
259 Ga0207654_10000650 3300025911 Bacteria 19636
260 Ga0207654_10002077 3300025911 Bacteria 10270
261 Ga0207654_10005642 3300025911 Bacteria 6325
262 Ga0207707_10000001 3300025912 Bacteria 1212482
263 Ga0207707_10238550 3300025912 Bacteria 1581
264 Ga0207695_10002853 3300025913 Bacteria 25128
265 Ga0207695_10005233 3300025913 Bacteria 17336
266 Ga0207695_10041673 3300025913 Bacteria 4913
267 Ga0207695_10047816 3300025913 Bacteria 4523
268 Ga0207695_10053645 3300025913 Bacteria 4215
269 Ga0207695_10055702 3300025913 Bacteria 4118
270 Ga0207695_10148350 3300025913 Bacteria 2287
271 Ga0207695_10256108 3300025913 Bacteria 1649
272 Ga0207671_10000545 3300025914 Bacteria 50856
273 Ga0207671_10001056 3300025914 Bacteria 33385
274 Ga0207671_10210472 3300025914 Bacteria 1521
275 Ga0207693_10000048 3300025915 Bacteria 100685
276 Ga0207693_10000560 3300025915 Bacteria 33567
277 Ga0207693_10001691 3300025915 Bacteria 19437
278 Ga0207663_10010584 3300025916 Bacteria 4917
279 Ga0207663_10034241 3300025916 Bacteria 3035
280 Ga0207663_10066666 3300025916 Bacteria 2305
281 Ga0207660_10001780 3300025917 Bacteria 14415
282 Ga0207662_10124308 3300025918 Bacteria 1621
283 Ga0207657_10000273 3300025919 Bacteria 54891
284 Ga0207657_10006527 3300025919 Bacteria 12082
285 Ga0207657_10073773 3300025919 Bacteria 2883
286 Ga0207657_10209954 3300025919 Bacteria 1563
287 Ga0207657_10478757 3300025919 Bacteria 976
288 Ga0207649_10000110 3300025920 Bacteria 69018
289 Ga0207649_10000114 3300025920 Bacteria 68080
290 Ga0207649_10000145 3300025920 Bacteria 59071
291 Ga0207649_10124257 3300025920 Bacteria 1744
292 Ga0207652_10074645 3300025921 Bacteria 2953
293 Ga0207652_10236154 3300025921 Bacteria 1648
294 Ga0207652_10373076 3300025921 Bacteria 1288
295 Ga0207681_10000045 3300025923 Bacteria 128454
296 Ga0207694_10006559 3300025924 Bacteria 8845
297 Ga0207694_10008396 3300025924 Bacteria 7798
298 Ga0207694_10036445 3300025924 Bacteria 3776
299 Ga0207694_10149736 3300025924 Bacteria 1879
300 Ga0207694_10328121 3300025924 Bacteria 1264
301 Ga0207687_10003650 3300025927 Bacteria 10372
302 Ga0207700_10000014 3300025928 Bacteria 229475
303 Ga0207664_10134524 3300025929 Bacteria 2085
304 Ga0207644_10000777 3300025931 Bacteria 20242
305 Ga0207706_10017873 3300025933 Bacteria 6385
306 Ga0207706_10036059 3300025933 Bacteria 4394
307 Ga0207706_10071443 3300025933 Bacteria 3052
308 Ga0207706_10102571 3300025933 Bacteria 2517
309 Ga0207706_10214981 3300025933 Bacteria 1684
310 Ga0207706_10254222 3300025933 Bacteria 1534
311 Ga0207709_10000031 3300025935 Bacteria 329046
312 Ga0207669_10000365 3300025937 Bacteria 20447
313 Ga0207704_10115317 3300025938 Bacteria 1825
314 Ga0207704_10526477 3300025938 Bacteria 957
315 Ga0207665_10018330 3300025939 Bacteria 4600
316 Ga0207691_10200199 3300025940 Bacteria 1738
317 Ga0207711_10000001 3300025941 Bacteria 1325674
318 Ga0207711_10000635 3300025941 Bacteria 35316
319 Ga0207711_10023431 3300025941 Bacteria 5168
320 Ga0207711_10146384 3300025941 Bacteria 2129
321 Ga0207661_10241817 3300025944 Bacteria 1602
322 Ga0207667_10001207 3300025949 Bacteria 32304
323 Ga0207667_10003961 3300025949 Bacteria 18221
324 Ga0207667_10018758 3300025949 Bacteria 7747
325 Ga0207667_10027048 3300025949 Bacteria 6254
326 Ga0207667_10063465 3300025949 Bacteria 3859
327 Ga0207667_10113477 3300025949 Bacteria 2794
328 Ga0207667_10233478 3300025949 Bacteria 1883
329 Ga0207651_10062172 3300025960 Bacteria 2601
330 Ga0207712_10000013 3300025961 Bacteria 391208
331 Ga0207712_10370223 3300025961 Bacteria 1196
332 Ga0207668_10010144 3300025972 Bacteria 5678
333 Ga0207640_10011721 3300025981 Bacteria 4970
334 Ga0207640_10117014 3300025981 Bacteria 1901
335 Ga0207640_10164151 3300025981 Bacteria 1647
336 Ga0207640_10194202 3300025981 Bacteria 1532
337 Ga0207658_10016863 3300025986 Bacteria 5026
338 Ga0207658_10136404 3300025986 Bacteria 1979
339 Ga0207677_10241928 3300026023 Bacteria 1460
340 Ga0207703_10000255 3300026035 Bacteria 60030
341 Ga0207703_10003947 3300026035 Bacteria 12293
342 Ga0207639_10000516 3300026041 Bacteria 26647
343 Ga0207639_10004447 3300026041 Bacteria 9459
344 Ga0207639_10012841 3300026041 Bacteria 5844
345 Ga0207639_10033923 3300026041 Bacteria 3769
346 Ga0207639_10128180 3300026041 Bacteria 2096
347 Ga0207678_10005571 3300026067 Bacteria 11258
348 Ga0207702_10000066 3300026078 Bacteria 117825
349 Ga0207702_10003508 3300026078 Bacteria 14298
350 Ga0207702_10003870 3300026078 Bacteria 13488
351 Ga0207702_10006982 3300026078 Bacteria 9664
352 Ga0207702_10010628 3300026078 Bacteria 7692
353 Ga0207702_10051283 3300026078 Bacteria 3486
354 Ga0207702_10081224 3300026078 Bacteria 2815
355 Ga0207702_10131957 3300026078 Bacteria 2249
356 Ga0207702_10298117 3300026078 Bacteria 1529
357 Ga0207641_10000143 3300026088 Bacteria 102398
358 Ga0207676_10008620 3300026095 Bacteria 7247
359 Ga0207676_10271218 3300026095 Bacteria 1537
360 Ga0207674_10000004 3300026116 Bacteria 241430
361 Ga0207674_10017008 3300026116 Bacteria 7939
362 Ga0207674_10078266 3300026116 Bacteria 3311
363 Ga0207674_10158955 3300026116 Bacteria 2215
364 Ga0207675_100000019 3300026118 Bacteria 122642
365 Ga0207675_100007046 3300026118 Bacteria 10621
366 Ga0207683_10001302 3300026121 Bacteria 22554
367 Ga0207683_10031662 3300026121 Bacteria 4590
368 Ga0207683_10246344 3300026121 Bacteria 1630
369 Ga0207698_10000449 3300026142 Bacteria 23772
370 Ga0207698_10152499 3300026142 Bacteria 2008
371 Ga0207698_10190213 3300026142 Bacteria 1827
372 Ga0207698_10228450 3300026142 Bacteria 1687
373 Ga0207698_10232294 3300026142 Bacteria 1675
374 Ga0207698_10284560 3300026142 Bacteria 1531
375 Ga0268266_10000025 3300028379 Bacteria 477143
376 Ga0268266_10007080 3300028379 Bacteria 10183
377 Ga0268266_10572217 3300028379 Bacteria 1084
378 Ga0268266_10773254 3300028379 Bacteria 927
379 Ga0268265_10000546 3300028380 Bacteria 38362
380 Ga0268265_10147826 3300028380 Bacteria 1977
381 Ga0268264_10000037 3300028381 Bacteria 391116
382 Ga0265334_10003064 3300028573 Bacteria 7631
383 Ga0265318_10000107 3300028577 Bacteria 77965
384 Ga0265318_10007340 3300028577 Bacteria 4990
385 Ga0265338_10000006 3300028800 Bacteria 570804
386 Ga0265338_10034715 3300028800 Bacteria 4867
387 Ga0265320_10000097 3300031240 Bacteria 74341
388 Ga0265325_10000003 3300031241 Bacteria 370490
389 Ga0265325_10027841 3300031241 Bacteria 3052
390 Ga0265325_10043686 3300031241 Bacteria 2337
391 Ga0265339_10001397 3300031249 Bacteria 17979
392 Ga0265339_10018467 3300031249 Bacteria 4109
393 Ga0265339_10104995 3300031249 Bacteria 1467
394 Ga0265331_10063800 3300031250 Bacteria 1735
395 Ga0265327_10028880 3300031251 Bacteria 3163
396 Ga0307513_10012412 3300031456 Bacteria 10517
397 Ga0265313_10001646 3300031595 Bacteria 20705
398 Ga0265313_10001888 3300031595 Bacteria 19036
399 Ga0265313_10002257 3300031595 Bacteria 16935
400 Ga0307508_10004809 3300031616 Bacteria 13025
401 Ga0265314_10001042 3300031711 Bacteria 32320
402 Ga0265314_10013481 3300031711 Bacteria 6598
403 Ga0265314_10053336 3300031711 Bacteria 2805
404 Ga0265342_10045387 3300031712 Bacteria 2645
405 Ga0307516_10052680 3300031730 Bacteria 3982
406 Ga0307405_10005275 3300031731 Bacteria 6214
407 Ga0307411_10499299 3300032005 Bacteria 1028
408 Ga0307510_10099455 3300033180 Bacteria 2707
409 Ga0373954_0045878 3300035118 Bacteria 2042
410 Ga0373954_0076432 3300035118 Bacteria 1596
411 Ga0373943_0040052 3300035170 Bacteria 2261
412 Ga0373955_0014928 3300035172 Bacteria 3792
413 Ga0373931_0007877 3300035691 Bacteria 5038
414 Ga0373927_0022373 3300035695 Bacteria 4142
415 Ga0373927_0038201 3300035695 Bacteria 3118
416 Ga0373933_0019397 3300035724 Bacteria 3841
417 Ga0373933_0040495 3300035724 Bacteria 2746
418 Ga0373947_0078746 3300035725 Bacteria 2035
419 Ga0373947_0261071 3300035725 Bacteria 1148
420 Ga0373937_0006777 3300036401 Bacteria 9890
421 Ga0373937_0059160 3300036401 Bacteria 3521
422 Ga0373937_0128278 3300036401 Bacteria 2367
423 Ga0373937_0165500 3300036401 Bacteria 2074
424 Ga0373925_0055837 3300037068 Bacteria 2957
425 Ga0373925_0198929 3300037068 Bacteria 1593
426 Ga0395899_0000026 3300037312 Bacteria 345291
427 Ga0395899_0022292 3300037312 Bacteria 4803
428 Ga0395900_0010154 3300037418 Bacteria 9633
429 Ga0395900_0128485 3300037418 Bacteria 2598
430 Ga0395898_0051126 3300037466 Bacteria 4042
431 Ga0395905_0130979 3300037471 Bacteria 2359
432 Ga0395905_0158482 3300037471 Bacteria 2128
433 Ga0395905_0170579 3300037471 Bacteria 2044
434 Ga0395905_0202976 3300037471 Bacteria 1858
435 Ga0436364_0822555 3300037853 Bacteria 215682
436 Ga0395901_0194772 3300038443 Bacteria 2125
437 Ga0436360_0712973 3300039438 Bacteria 2129
438 Ga0436363_0048291 3300039450 Bacteria 1643
439 Ga0436363_0912428 3300039450 Bacteria 2041
440 Ga0436363_1140458 3300039450 Bacteria 3642
441 Ga0439448_0002617 3300042005 Bacteria 4908
442 Ga0439448_0042685 3300042005 Bacteria 1470
443 Ga0439455_0021114 3300042012 Bacteria 1549
444 Ga0439458_0000258 3300042157 Bacteria 12892
445 Ga0439458_0001938 3300042157 Bacteria 5132
446 Ga0466972_0044939 3300044658 Bacteria 2141
447 Ga0466965_0048167 3300044683 Bacteria 2111
448 Ga0466961_0058182 3300044693 Bacteria 2459
449 Ga0466963_0156343 3300044694 Bacteria 1585
450 Ga0453684_0054445 3300044712 Bacteria 5211
451 Ga0466971_0033161 3300044719 Bacteria 2314
452 Ga0466970_0093902 3300044765 Bacteria 1630
453 Ga0466959_0022270 3300045049 Bacteria 4682
454 Ga0451576_0561608 3300045051 Bacteria 1199
455 Ga0466958_0158027 3300045836 Bacteria 1431
456 Ga0466958_0174013 3300045836 Bacteria 1364
457 Ga0466967_0522056 3300045976 Bacteria 1167
458 Ga0495638_0000332 3300046460 Bacteria 59517
459 Ga0495638_0043928 3300046460 Bacteria 2817
460 Ga0495638_0191842 3300046460 Bacteria 1159
461 Ga0495650_0090374 3300046471 Bacteria 1166
462 Ga0495580_0002566 3300046472 Bacteria 15799
463 Ga0495580_0020603 3300046472 Bacteria 4878
464 Ga0495585_0011857 3300046492 Bacteria 5149
465 Ga0495596_0033794 3300046500 Bacteria 2035
466 Ga0495607_0138230 3300046501 Bacteria 1260
467 Ga0495583_0000030 3300046506 Bacteria 254970
468 Ga0495583_0060764 3300046506 Bacteria 1688
469 Ga0495606_0000359 3300046507 Bacteria 77863
470 Ga0495606_0000515 3300046507 Bacteria 62746
471 Ga0495606_0043569 3300046507 Bacteria 2991
472 Ga0495606_0073441 3300046507 Bacteria 2146
473 Ga0495628_0121424 3300046516 Bacteria 2004
474 Ga0495631_0006089 3300046518 Bacteria 6260
475 Ga0495643_0000991 3300046522 Bacteria 29043
476 Ga0495643_0009000 3300046522 Bacteria 6270
477 Ga0495643_0045487 3300046522 Bacteria 2382
478 Ga0495643_0077081 3300046522 Bacteria 1742
479 Ga0495643_0147046 3300046522 Bacteria 1170
480 Ga0495648_0000750 3300046524 Bacteria 34697
481 Ga0495622_0013093 3300046557 Bacteria 3849
482 Ga0495633_0001042 3300046558 Bacteria 22695
483 Ga0495668_0000007 3300046616 Bacteria 552902
484 Ga0495668_0038789 3300046616 Bacteria 2661
485 Ga0495668_0137346 3300046616 Bacteria 1338
486 Ga0495611_0024527 3300046648 Bacteria 2624
487 Ga0495625_0000264 3300046660 Bacteria 81625
488 Ga0495625_0001310 3300046660 Bacteria 31060
489 Ga0495625_0017790 3300046660 Bacteria 5556
490 Ga0495625_0045678 3300046660 Bacteria 3164
491 Ga0495625_0048251 3300046660 Bacteria 3067
492 Ga0495625_0091036 3300046660 Bacteria 2109
493 Ga0495625_0254304 3300046660 Bacteria 1139
494 Ga0495661_0086496 3300046665 Bacteria 1794
495 Ga0495623_0025306 3300046679 Bacteria 3823
496 Ga0495669_0000197 3300046684 Bacteria 37314
497 Ga0495670_0055554 3300046691 Bacteria 1985
498 Ga0495649_0021106 3300046694 Bacteria 3651
499 Ga0495660_0060138 3300046810 Bacteria 2042
500 Ga0495604_0167416 3300047317 Bacteria 1549
501 Ga0495674_0107278 3300047319 Bacteria 2371
502 Ga0495683_0029587 3300047323 Bacteria 2798
503 Ga0495683_0175004 3300047323 Bacteria 984
504 Ga0495687_000178 3300047443 Bacteria 93234
505 Ga0495687_000511 3300047443 Bacteria 46733
506 Ga0495677_0029450 3300047445 Bacteria 1996
507 Ga0495681_0005817 3300047470 Bacteria 8192
508 Ga0495681_0038732 3300047470 Bacteria 2334
509 Ga0495686_0000063 3300047472 Bacteria 228575
510 Ga0495602_0060792 3300048088 Bacteria 3290
511 Ga0495602_0147119 3300048088 Bacteria 1857
512 Ga0496101_0149570 3300048904 Bacteria 1785
513 Ga0496102_0000049 3300048905 Bacteria 179480
514 Ga0496102_0001107 3300048905 Bacteria 24730
515 Ga0496102_0039292 3300048905 Bacteria 4275
516 Ga0496102_0129181 3300048905 Bacteria 2364
517 Ga0496102_0157251 3300048905 Bacteria 2137
518 Ga0496103_0000037 3300048906 Bacteria 179474
519 Ga0496103_0000647 3300048906 Bacteria 26335
520 Ga0496103_0002748 3300048906 Bacteria 10979
521 Ga0496104_0013359 3300048907 Bacteria 7399
522 Ga0496104_0013871 3300048907 Bacteria 7270
523 Ga0496104_0453738 3300048907 Bacteria 1194
524 Ga0496104_0617814 3300048907 Bacteria 993
525 Ga0496105_0000715 3300048908 Bacteria 22456
526 Ga0496105_0005509 3300048908 Bacteria 9605
527 Ga0496105_0022188 3300048908 Bacteria 5141
528 Ga0496107_0048229 3300048910 Bacteria 3068
529 Ga0496107_0102449 3300048910 Bacteria 2099
530 Ga0496108_0048246 3300048911 Bacteria 3560
531 Ga0496110_0027666 3300048913 Bacteria 4862
532 Ga0496110_0060818 3300048913 Bacteria 3332
533 Ga0496111_0041359 3300048914 Bacteria 3307
534 Ga0496114_0074614 3300048917 Bacteria 2855
535 Ga0496115_0000416 3300048918 Bacteria 34725
536 Ga0496115_0319977 3300048918 Bacteria 1269
537 Ga0496116_0003410 3300048919 Bacteria 15719
538 Ga0496116_0006677 3300048919 Bacteria 10410
539 Ga0496116_0023524 3300048919 Bacteria 4586
540 Ga0496117_0000115 3300048920 Bacteria 179488
541 Ga0496117_0001241 3300048920 Bacteria 38164
542 Ga0496117_0030080 3300048920 Bacteria 4174
543 Ga0496117_0030507 3300048920 Bacteria 4136
544 Ga0496117_0063425 3300048920 Bacteria 2526
545 Ga0496118_0000086 3300048921 Bacteria 179488
546 Ga0496118_0000580 3300048921 Bacteria 60421
547 Ga0496118_0011692 3300048921 Bacteria 8531
548 Ga0496118_0017141 3300048921 Bacteria 6609
549 Ga0496118_0125052 3300048921 Bacteria 1666
550 Ga0496120_0010570 3300048923 Bacteria 6424
551 Ga0496120_0150521 3300048923 Bacteria 1170
552 Ga0496121_0003691 3300048924 Bacteria 21490
553 Ga0496121_0016641 3300048924 Bacteria 7573
554 Ga0496121_0146855 3300048924 Bacteria 1741
555 Ga0496121_0168332 3300048924 Bacteria 1595
556 Ga0496122_0009815 3300048925 Bacteria 9998
557 Ga0496122_0011384 3300048925 Bacteria 9017
558 Ga0496123_0034728 3300048926 Bacteria 3606
559 Ga0496124_0000102 3300048927 Bacteria 179488
560 Ga0496124_0000626 3300048927 Bacteria 58823
561 Ga0496124_0414989 3300048927 Bacteria 930
562 Ga0496125_0001330 3300048928 Bacteria 36490
563 Ga0496125_0103807 3300048928 Bacteria 2084
564 Ga0496125_0214420 3300048928 Bacteria 1247
565 Ga0496126_0000752 3300048929 Bacteria 58828
566 Ga0496126_0103993 3300048929 Bacteria 2481
567 Ga0495682_0033230 3300049460 Bacteria 1904
568 Ga0501033_0023417 3300049570 Bacteria 4657
569 Ga0501033_0042925 3300049570 Bacteria 3370
570 Ga0501033_0049626 3300049570 Bacteria 3115
571 Ga0501033_0192750 3300049570 Bacteria 1458
572 Ga0501034_0247891 3300049571 Bacteria 1726
573 Ga0501034_0291139 3300049571 Bacteria 1571
574 Ga0501037_0051177 3300049573 Bacteria 3021
575 Ga0501038_0063742 3300049574 Bacteria 3145
576 Ga0501047_0180831 3300049581 Bacteria 1975
577 Ga0501047_0258648 3300049581 Bacteria 1589
578 Ga0501070_0070778 3300049586 Bacteria 2888
579 Ga0501080_0046758 3300049742 Bacteria 4028
580 Ga0501035_0016905 3300049822 Bacteria 6725
581 Ga0501035_0092603 3300049822 Bacteria 2659
582 Ga0501035_0247024 3300049822 Bacteria 1516
583 Ga0501044_0002118 3300049823 Bacteria 22796
584 Ga0501044_0241626 3300049823 Bacteria 1749
585 Ga0501044_0318124 3300049823 Bacteria 1481
586 nmdc:mga0k408_181064_c1 3300050493 Bacteria 1257
587 nmdc:mga07m45_19362_c1 3300050496 Bacteria 3687
588 nmdc:mga0n895_56636_c1 3300050512 Bacteria 3862
589 nmdc:mga0rr50_131712_c1 3300050513 Bacteria 2003
590 nmdc:mga08x19_2527_c1 3300050514 Bacteria 11115
591 nmdc:mga08x19_52_c1 3300050514 Bacteria 123790
592 Ga0500610_0014586 3300053079 Bacteria 3691
593 Ga0500578_0013883 3300053086 Bacteria 5185
594 Ga0500643_001558 3300053087 Bacteria 12980
595 Ga0500647_0033808 3300053091 Bacteria 2440
596 Ga0500555_016098 3300053103 Bacteria 2155
597 Ga0500592_000884 3300053116 Bacteria 4888
598 Ga0500618_015940 3300053125 Bacteria 1888
599 Ga0500642_0127646 3300053130 Bacteria 1191
600 Ga0500655_000030 3300053133 Bacteria 39615
601 Ga0500658_0010303 3300053134 Bacteria 3446
602 Ga0500559_0054714 3300053136 Bacteria 1768
603 Ga0500585_077607 3300053144 Bacteria 1200
604 Ga0500590_004627 3300053148 Bacteria 6520
605 Ga0500590_010304 3300053148 Bacteria 4719
606 Ga0500616_0076088 3300053153 Bacteria 1698
607 Ga0500619_042598 3300053154 Bacteria 1440
608 Ga0500622_0097554 3300053156 Bacteria 1451
609 Ga0500639_088654 3300053163 Bacteria 1545
610 Ga0500570_057388 3300053724 Bacteria 1909
611 Ga0500576_067971 3300053725 Bacteria 1539
612 Ga0500645_000011 3300053730 Bacteria 169616
613 Ga0500645_019588 3300053730 Bacteria 2104
614 Ga0500596_008703 3300053735 Bacteria 1611
615 Ga0501084_0000347 3300054114 Bacteria 35283
616 2585262517 2582581305 Bacteria 4895574
617 8057102984 8057101203 Bacteria 5034064
618 JGI24739J22299_10009686
619 JGI24752J21851_1000027
620 JGI24740J21852_10003653
621 JGI24739J22299_10027493
622 JGI24737J22298_10001928
623 JGI24737J22298_10007699
624 JGI24735J21928_10017849
625 JGI24735J21928_10021680
626 JGI24750J21931_1000041
627 JGI24748J21848_1000096
628 JGI24738J21930_10016388
629 JGI24034J26672_10000028
630 JGI24742J22300_10001008
631 JGI25165J46597_1000008
632 JGI25165J46597_1000297
633 JGI25165J46597_1000489
634 JGI25153J46596_10000113
635 JGI25153J46596_10000672
636 rootH2_10222705
637 rootL2_10023548
638 rootL2_10069639
639 Ga0055525_1000051
640 Ga0055542_1000677
641 Ga0055529_1000016
642 Ga0065165_1005029
643 Ga0065707_10081714
644 Ga0070658_10000116
645 Ga0070658_10025975
646 Ga0070658_10127650
647 Ga0070658_10458427
648 Ga0070690_100000003
649 Ga0070690_100024373
650 Ga0070666_10000006
651 Ga0070666_10213530
652 Ga0070680_100000408
653 Ga0070680_100056465
654 Ga0068868_100136708
655 Ga0068868_100187331
656 Ga0070660_100003168
657 Ga0070660_100229896
658 Ga0070660_100473033
659 Ga0070689_100034895
660 Ga0070691_10001140
661 Ga0070687_100281311
662 Ga0070661_100014295
663 Ga0070668_100132675
664 Ga0070669_100000014
665 Ga0070671_100035911
666 Ga0070674_100000746
667 Ga0070688_100062352
668 Ga0070659_100078879
669 Ga0070659_100165823
670 Ga0070667_100099545
671 Ga0070667_100104308
672 Ga0070709_10007492
673 Ga0070713_100000007
674 Ga0070713_100041897
675 Ga0070713_100089919
676 Ga0070710_10082945
677 Ga0070711_100003889
678 Ga0070711_100012918
679 Ga0070711_100035230
680 Ga0070705_100196551
681 Ga0070678_100000585
682 Ga0070662_100008234
683 Ga0070662_100026287
684 Ga0070662_100105339
685 Ga0070662_100141031
686 Ga0070662_100167817
687 Ga0070662_100455243
688 Ga0070681_10000003
689 Ga0070681_10212565
690 Ga0070685_10000072
691 Ga0070706_100049759
692 Ga0070699_100304718
693 Ga0070699_100392392
694 Ga0070679_100004864
695 Ga0070679_100086956
696 Ga0070679_100239122
697 Ga0068853_100133456
698 Ga0068853_100152498
699 Ga0068853_100182113
700 Ga0068853_100219650
701 Ga0070686_100000022
702 Ga0070695_100307739
703 Ga0070696_100216173
704 Ga0070696_100299725
705 Ga0070665_100000019
706 Ga0070665_100003100
707 Ga0070665_100035688
708 Ga0070665_100465970
709 Ga0068855_100003607
710 Ga0068855_100032581
711 Ga0068855_100102241
712 Ga0068855_100137912
713 Ga0068855_100232129
714 Ga0068855_100261040
715 Ga0068855_100337507
716 Ga0068855_100746958
717 Ga0068855_100865826
718 Ga0070664_100186202
719 Ga0070664_100275459
720 Ga0070664_100492982
721 Ga0068857_100000974
722 Ga0068857_100035743
723 Ga0068857_100082388
724 Ga0068857_100104347
725 Ga0068854_100134537
726 Ga0068854_100501215
727 Ga0068856_100000142
728 Ga0068856_100008980
729 Ga0068856_100011622
730 Ga0068856_100156852
731 Ga0068856_100184802
732 Ga0068856_100218587
733 Ga0068856_100224604
734 Ga0068852_100000043
735 Ga0068852_100022553
736 Ga0068852_100038836
737 Ga0068852_100108186
738 Ga0068852_100216282
739 Ga0068852_100420062
740 Ga0068859_100002673
741 Ga0068859_100051845
742 Ga0068864_100600699
743 Ga0068861_100000111
744 Ga0068861_100009814
745 Ga0068863_100000048
746 Ga0068858_100000254
747 Ga0068858_100003776
748 Ga0068860_100000014
749 Ga0068862_100000595
750 Ga0068862_100047755
751 Ga0081455_10000088
752 Ga0070717_10000364
753 Ga0070715_10022472
754 Ga0070715_10191807
755 Ga0070716_100012383
756 Ga0070712_100000015
757 Ga0070712_100001349
758 Ga0075366_10149083
759 Ga0097621_100000667
760 Ga0097621_100045788
761 Ga0068871_100006814
762 Ga0068871_100143328
763 Ga0075434_100019894
764 Ga0068865_100196448
765 Ga0075436_100000024
766 Ga0097620_100002673
767 Ga0097620_100051843
768 Ga0099795_10003949
769 Ga0105240_10020214
770 Ga0105240_10030193
771 Ga0105240_10034962
772 Ga0105240_10055977
773 Ga0105240_10069635
774 Ga0105240_10136077
775 Ga0105240_10286566
776 Ga0105240_10500175
777 Ga0105245_10001618
778 Ga0105245_10027313
779 Ga0105245_10037656
780 Ga0105247_10025691
781 Ga0105247_10047414
782 Ga0105243_10000782
783 Ga0105243_10347480
784 Ga0105241_10001365
785 Ga0105241_10007433
786 Ga0105241_10060855
787 Ga0105242_10026757
788 Ga0105242_10029836
789 Ga0105248_10000001
790 Ga0105248_10002303
791 Ga0105248_10010326
792 Ga0105248_10029637
793 Ga0105248_10089852
794 Ga0105237_10002363
795 Ga0105237_10006932
796 Ga0105237_10143315
797 Ga0105237_10297111
798 Ga0105237_10301526
799 Ga0105238_10013158
800 Ga0105238_10022562
801 Ga0105238_10060392
802 Ga0105238_10118954
803 Ga0105238_10216109
804 Ga0105238_10238602
805 Ga0105238_10265492
806 Ga0105238_10376424
807 Ga0105238_10422559
808 Ga0105238_10596346
809 Ga0105249_10000104
810 Ga0105239_10010079
811 Ga0105239_10067661
812 Ga0105239_10075526
813 Ga0105239_10235748
814 Ga0105239_10492835
815 Ga0105239_10527391
816 Ga0105239_10794204
817 Ga0157373_10000231
818 Ga0157373_10140171
819 Ga0157373_10145923
820 Ga0157371_10000146
821 Ga0157371_10210014
822 Ga0157370_10000503
823 Ga0157370_10002391
824 Ga0157370_10024422
825 Ga0157369_10038161
826 Ga0157369_10055615
827 Ga0157369_10109316
828 Ga0157369_10247964
829 Ga0157369_10322927
830 Ga0157369_10398191
831 Ga0157374_10039731
832 Ga0157374_10189625
833 Ga0157374_10340028
834 Ga0157378_10044499
835 Ga0157378_10082539
836 Ga0157378_10100182
837 Ga0163162_10318222
838 Ga0157372_10110327
839 Ga0157372_10311967
840 Ga0157372_10614659
841 Ga0163163_10145093
842 Ga0157380_10000181
843 Ga0157379_10010918
844 Ga0157379_10017171
845 Ga0157376_10624352
846 Ga0163161_10000020
847 Ga0163161_10032415
848 Ga0213874_10091799
849 Ga0213875_10001890
850 Ga0213871_10027626
851 Ga0207672_1000329
852 Ga0209674_101931
853 Ga0209563_100019
854 Ga0207427_100640
855 Ga0209026_1003308
856 Ga0209026_1013370
857 Ga0209148_1000017
858 Ga0209148_1000061
859 Ga0209233_1000006
860 Ga0209233_1000107
861 Ga0209233_1000382
862 Ga0209233_1009066
863 Ga0209455_1000005
864 Ga0209455_1007242
865 Ga0209758_1000035
866 Ga0207680_10000011
867 Ga0207680_10259907
868 Ga0207647_10000527
869 Ga0207647_10001094
870 Ga0207647_10004311
871 Ga0207647_10089159
872 Ga0207699_10000660
873 Ga0207705_10001001
874 Ga0207705_10001461
875 Ga0207705_10054157
876 Ga0207654_10000650
877 Ga0207654_10002077
878 Ga0207654_10005642
879 Ga0207707_10000001
880 Ga0207707_10238550
881 Ga0207695_10002853
882 Ga0207695_10005233
883 Ga0207695_10041673
884 Ga0207695_10047816
885 Ga0207695_10053645
886 Ga0207695_10055702
887 Ga0207695_10148350
888 Ga0207695_10256108
889 Ga0207671_10000545
890 Ga0207671_10001056
891 Ga0207671_10210472
892 Ga0207693_10000048
893 Ga0207693_10000560
894 Ga0207693_10001691
895 Ga0207663_10010584
896 Ga0207663_10034241
897 Ga0207663_10066666
898 Ga0207660_10001780
899 Ga0207662_10124308
900 Ga0207657_10000273
901 Ga0207657_10006527
902 Ga0207657_10073773
903 Ga0207657_10209954
904 Ga0207657_10478757
905 Ga0207649_10000110
906 Ga0207649_10000114
907 Ga0207649_10000145
908 Ga0207649_10124257
909 Ga0207652_10074645
910 Ga0207652_10236154
911 Ga0207652_10373076
912 Ga0207681_10000045
913 Ga0207694_10006559
914 Ga0207694_10008396
915 Ga0207694_10036445
916 Ga0207694_10149736
917 Ga0207694_10328121
918 Ga0207687_10003650
919 Ga0207700_10000014
920 Ga0207664_10134524
921 Ga0207644_10000777
922 Ga0207706_10017873
923 Ga0207706_10036059
924 Ga0207706_10071443
925 Ga0207706_10102571
926 Ga0207706_10214981
927 Ga0207706_10254222
928 Ga0207709_10000031
929 Ga0207669_10000365
930 Ga0207704_10115317
931 Ga0207704_10526477
932 Ga0207665_10018330
933 Ga0207691_10200199
934 Ga0207711_10000001
935 Ga0207711_10000635
936 Ga0207711_10023431
937 Ga0207711_10146384
938 Ga0207661_10241817
939 Ga0207667_10001207
940 Ga0207667_10003961
941 Ga0207667_10018758
942 Ga0207667_10027048
943 Ga0207667_10063465
944 Ga0207667_10113477
945 Ga0207667_10233478
946 Ga0207651_10062172
947 Ga0207712_10000013
948 Ga0207712_10370223
949 Ga0207668_10010144
950 Ga0207640_10011721
951 Ga0207640_10117014
952 Ga0207640_10164151
953 Ga0207640_10194202
954 Ga0207658_10016863
955 Ga0207658_10136404
956 Ga0207677_10241928
957 Ga0207703_10000255
958 Ga0207703_10003947
959 Ga0207639_10000516
960 Ga0207639_10004447
961 Ga0207639_10012841
962 Ga0207639_10033923
963 Ga0207639_10128180
964 Ga0207678_10005571
965 Ga0207702_10000066
966 Ga0207702_10003508
967 Ga0207702_10003870
968 Ga0207702_10006982
969 Ga0207702_10010628
970 Ga0207702_10051283
971 Ga0207702_10081224
972 Ga0207702_10131957
973 Ga0207702_10298117
974 Ga0207641_10000143
975 Ga0207676_10008620
976 Ga0207676_10271218
977 Ga0207674_10000004
978 Ga0207674_10017008
979 Ga0207674_10078266
980 Ga0207674_10158955
981 Ga0207675_100000019
982 Ga0207675_100007046
983 Ga0207683_10001302
984 Ga0207683_10031662
985 Ga0207683_10246344
986 Ga0207698_10000449
987 Ga0207698_10152499
988 Ga0207698_10190213
989 Ga0207698_10228450
990 Ga0207698_10232294
991 Ga0207698_10284560
992 Ga0268266_10000025
993 Ga0268266_10007080
994 Ga0268266_10572217
995 Ga0268266_10773254
996 Ga0268265_10000546
997 Ga0268265_10147826
998 Ga0268264_10000037
999 Ga0265334_10003064
1000 Ga0265318_10000107
1001 Ga0265318_10007340
1002 Ga0265338_10000006
1003 Ga0265338_10034715
1004 Ga0265320_10000097
1005 Ga0265325_10000003
1006 Ga0265325_10027841
1007 Ga0265325_10043686
1008 Ga0265339_10001397
1009 Ga0265339_10018467
1010 Ga0265339_10104995
1011 Ga0265331_10063800
1012 Ga0265327_10028880
1013 Ga0307513_10012412
1014 Ga0265313_10001646
1015 Ga0265313_10001888
1016 Ga0265313_10002257
1017 Ga0307508_10004809
1018 Ga0265314_10001042
1019 Ga0265314_10013481
1020 Ga0265314_10053336
1021 Ga0265342_10045387
1022 Ga0307516_10052680
1023 Ga0307405_10005275
1024 Ga0307411_10499299
1025 Ga0307510_10099455
1026 Ga0373954_0045878
1027 Ga0373954_0076432
1028 Ga0373943_0040052
1029 Ga0373955_0014928
1030 Ga0373931_0007877
1031 Ga0373927_0022373
1032 Ga0373927_0038201
1033 Ga0373933_0019397
1034 Ga0373933_0040495
1035 Ga0373947_0078746
1036 Ga0373947_0261071
1037 Ga0373937_0006777
1038 Ga0373937_0059160
1039 Ga0373937_0128278
1040 Ga0373937_0165500
1041 Ga0373925_0055837
1042 Ga0373925_0198929
1043 Ga0395899_0000026
1044 Ga0395899_0022292
1045 Ga0395900_0010154
1046 Ga0395900_0128485
1047 Ga0395898_0051126
1048 Ga0395905_0130979
1049 Ga0395905_0158482
1050 Ga0395905_0170579
1051 Ga0395905_0202976
1052 Ga0436364_0822555
1053 Ga0395901_0194772
1054 Ga0436360_0712973
1055 Ga0436363_0048291
1056 Ga0436363_0912428
1057 Ga0436363_1140458
1058 Ga0439448_0002617
1059 Ga0439448_0042685
1060 Ga0439455_0021114
1061 Ga0439458_0000258
1062 Ga0439458_0001938
1063 Ga0466972_0044939
1064 Ga0466965_0048167
1065 Ga0466961_0058182
1066 Ga0466963_0156343
1067 Ga0453684_0054445
1068 Ga0466971_0033161
1069 Ga0466970_0093902
1070 Ga0466959_0022270
1071 Ga0451576_0561608
1072 Ga0466958_0158027
1073 Ga0466958_0174013
1074 Ga0466967_0522056
1075 Ga0495638_0000332
1076 Ga0495638_0043928
1077 Ga0495638_0191842
1078 Ga0495650_0090374
1079 Ga0495580_0002566
1080 Ga0495580_0020603
1081 Ga0495585_0011857
1082 Ga0495596_0033794
1083 Ga0495607_0138230
1084 Ga0495583_0000030
1085 Ga0495583_0060764
1086 Ga0495606_0000359
1087 Ga0495606_0000515
1088 Ga0495606_0043569
1089 Ga0495606_0073441
1090 Ga0495628_0121424
1091 Ga0495631_0006089
1092 Ga0495643_0000991
1093 Ga0495643_0009000
1094 Ga0495643_0045487
1095 Ga0495643_0077081
1096 Ga0495643_0147046
1097 Ga0495648_0000750
1098 Ga0495622_0013093
1099 Ga0495633_0001042
1100 Ga0495668_0000007
1101 Ga0495668_0038789
1102 Ga0495668_0137346
1103 Ga0495611_0024527
1104 Ga0495625_0000264
1105 Ga0495625_0001310
1106 Ga0495625_0017790
1107 Ga0495625_0045678
1108 Ga0495625_0048251
1109 Ga0495625_0091036
1110 Ga0495625_0254304
1111 Ga0495661_0086496
1112 Ga0495623_0025306
1113 Ga0495669_0000197
1114 Ga0495670_0055554
1115 Ga0495649_0021106
1116 Ga0495660_0060138
1117 Ga0495604_0167416
1118 Ga0495674_0107278
1119 Ga0495683_0029587
1120 Ga0495683_0175004
1121 Ga0495687_000178
1122 Ga0495687_000511
1123 Ga0495677_0029450
1124 Ga0495681_0005817
1125 Ga0495681_0038732
1126 Ga0495686_0000063
1127 Ga0495602_0060792
1128 Ga0495602_0147119
1129 Ga0496101_0149570
1130 Ga0496102_0000049
1131 Ga0496102_0001107
1132 Ga0496102_0039292
1133 Ga0496102_0129181
1134 Ga0496102_0157251
1135 Ga0496103_0000037
1136 Ga0496103_0000647
1137 Ga0496103_0002748
1138 Ga0496104_0013359
1139 Ga0496104_0013871
1140 Ga0496104_0453738
1141 Ga0496104_0617814
1142 Ga0496105_0000715
1143 Ga0496105_0005509
1144 Ga0496105_0022188
1145 Ga0496107_0048229
1146 Ga0496107_0102449
1147 Ga0496108_0048246
1148 Ga0496110_0027666
1149 Ga0496110_0060818
1150 Ga0496111_0041359
1151 Ga0496114_0074614
1152 Ga0496115_0000416
1153 Ga0496115_0319977
1154 Ga0496116_0003410
1155 Ga0496116_0006677
1156 Ga0496116_0023524
1157 Ga0496117_0000115
1158 Ga0496117_0001241
1159 Ga0496117_0030080
1160 Ga0496117_0030507
1161 Ga0496117_0063425
1162 Ga0496118_0000086
1163 Ga0496118_0000580
1164 Ga0496118_0011692
1165 Ga0496118_0017141
1166 Ga0496118_0125052
1167 Ga0496120_0010570
1168 Ga0496120_0150521
1169 Ga0496121_0003691
1170 Ga0496121_0016641
1171 Ga0496121_0146855
1172 Ga0496121_0168332
1173 Ga0496122_0009815
1174 Ga0496122_0011384
1175 Ga0496123_0034728
1176 Ga0496124_0000102
1177 Ga0496124_0000626
1178 Ga0496124_0414989
1179 Ga0496125_0001330
1180 Ga0496125_0103807
1181 Ga0496125_0214420
1182 Ga0496126_0000752
1183 Ga0496126_0103993
1184 Ga0495682_0033230
1185 Ga0501033_0023417
1186 Ga0501033_0042925
1187 Ga0501033_0049626
1188 Ga0501033_0192750
1189 Ga0501034_0247891
1190 Ga0501034_0291139
1191 Ga0501037_0051177
1192 Ga0501038_0063742
1193 Ga0501047_0180831
1194 Ga0501047_0258648
1195 Ga0501070_0070778
1196 Ga0501080_0046758
1197 Ga0501035_0016905
1198 Ga0501035_0092603
1199 Ga0501035_0247024
1200 Ga0501044_0002118
1201 Ga0501044_0241626
1202 Ga0501044_0318124
1203 nmdc:mga0k408_181064_c1
1204 nmdc:mga07m45_19362_c1
1205 nmdc:mga0n895_56636_c1
1206 nmdc:mga0rr50_131712_c1
1207 nmdc:mga08x19_2527_c1
1208 nmdc:mga08x19_52_c1
1209 Ga0500610_0014586
1210 Ga0500578_0013883
1211 Ga0500643_001558
1212 Ga0500647_0033808
1213 Ga0500555_016098
1214 Ga0500592_000884
1215 Ga0500618_015940
1216 Ga0500642_0127646
1217 Ga0500655_000030
1218 Ga0500658_0010303
1219 Ga0500559_0054714
1220 Ga0500585_077607
1221 Ga0500590_004627
1222 Ga0500590_010304
1223 Ga0500616_0076088
1224 Ga0500619_042598
1225 Ga0500622_0097554
1226 Ga0500639_088654
1227 Ga0500570_057388
1228 Ga0500576_067971
1229 Ga0500645_000011
1230 Ga0500645_019588
1231 Ga0500596_008703
1232 Ga0501084_0000347
1233 2585262517
1234 8057102984

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04794

YdjC

YdjC-like protein

3

263

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i5i-assembly1.cif.gz_A crystal structure of a putative cellobiose-phosphate cleavage protein (ef3048) from enterococcus faecalis v583 at 1.70 a resolution 0.8361 2 274
2i5i-assembly1.cif.gz_A crystal structure of a putative cellobiose-phosphate cleavage protein (ef3048) from enterococcus faecalis v583 at 1.70 a resolution 0.8211 2 274
7vi8-assembly1.cif.gz_A crystal structure of chbg 0.8071 1 273
7vi8-assembly1.cif.gz_A crystal structure of chbg 0.8013 1 273
2e67-assembly3.cif.gz_F crystal structure of the hypothetical protein tthb029 from thermus thermophilus hb8 0.7377 2 279
ID Description Score Start End Superfamily
2i5iB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.84 2 274 3.20.20.370
af_P37794_1_249_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8383 1 273 3.20.20.370
af_A2BIR6_5_313_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8331 3 274 3.20.20.370
af_P37794_1_249_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.832 1 273 3.20.20.370
2i5iB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8277 2 274 3.20.20.370
ID Description Score Start End GO Terms
AF-M4S514-F1-model_v4 Hopanoid biosynthesis associated protein HpnK 0.9891 2 276 GO:0005975
GO:0019213
GO:0046872
AF-A0A0Q5B6I0-F1-model_v4 deleted 0.988 1 275
AF-A0A2U8HW20-F1-model_v4 deleted 0.9862 1 275
AF-A0A4Q6XZW6-F1-model_v4 ChbG/HpnK family deacetylase 0.9837 1 273 GO:0005975
GO:0019213
GO:0046872
AF-A0A534BJ00-F1-model_v4 ChbG/HpnK family deacetylase 0.9829 1 163 GO:0005975
GO:0019213
GO:0046872

Map