F469607
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 617 | 311 | 1234 | 257 |
Family's Representative Sequence
| Representative Sequence | 3300003762|Ga0055542_1004132|Ga0055542_10041322 |
| Length | 302 |
| Sequence | MAERLFDKTGSSPLPRPTSRSRVILSGGWAGERAGTAPGKRSSVLSQTGSEAARKLDTIDVRPAFTQAEVDALNARFAGVETLPMLRALFADNILGETAVVSSFGTESAVLLDLISRVAPNTPVVFVDTLKMFPETLAYRDALLDRLGMHNRRTITPNSEVIAAKDATGLRWSYDPDGCCAIRKVEPIARAKQGLDSWFSGRKAFQSQTRANLPRFELEDGRLKVNPLGDWAKDDLDAYFAERDLPRHPLEAEGYLSIGCSPCTSKVMPGEDPRAGRWRGWDKVECGIHTPVDGPSEDDPIF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 65 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 101 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 174 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 192 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 193 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 194 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 195 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 196 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 197 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 198 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 199 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 200 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 201 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 202 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 203 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 239 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 240 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 241 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 242 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 243 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 244 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 245 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 246 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 247 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 248 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 249 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 250 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 251 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 254 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 255 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 256 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 257 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 260 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 261 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 262 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 263 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 264 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 265 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 266 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 268 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 269 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 270 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 271 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 272 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 273 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 274 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 275 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 276 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 277 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 278 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 279 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 280 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 281 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 282 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 283 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 284 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 285 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 286 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 287 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 288 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 289 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 290 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 291 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 292 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 293 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 294 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 295 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 296 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 297 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 298 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 299 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 300 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 301 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 302 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 303 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 304 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 305 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 306 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 307 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 308 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 309 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 310 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 311 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.92 |
| Metatranscriptomes | 0.32 |
| Isolates | 2.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.35 |
| Nodule | 0 |
| Rhizoplane | 1.78 |
| Rhizosphere | 77.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055542_1004132 | 3300003762 | Bacteria | 3650 |
| 2 | SwRhRL2b_contig_2794509 | 2162886007 | Bacteria | 1486 |
| 3 | JGI24741J21665_1005221 | 3300001915 | Bacteria | 2753 |
| 4 | JGI24752J21851_1001572 | 3300001976 | Bacteria | 3074 |
| 5 | JGI24740J21852_10001016 | 3300001979 | Bacteria | 12545 |
| 6 | JGI24740J21852_10012988 | 3300001979 | Bacteria | 3124 |
| 7 | JGI24739J22299_10001067 | 3300001989 | Bacteria | 10203 |
| 8 | JGI24739J22299_10003139 | 3300001989 | Bacteria | 6304 |
| 9 | JGI24739J22299_10012763 | 3300001989 | Bacteria | 3080 |
| 10 | JGI24739J22299_10038747 | 3300001989 | Bacteria | 1600 |
| 11 | JGI24737J22298_10004452 | 3300001990 | Bacteria | 4883 |
| 12 | JGI24737J22298_10005014 | 3300001990 | Bacteria | 4587 |
| 13 | JGI24737J22298_10050336 | 3300001990 | Bacteria | 1266 |
| 14 | JGI24735J21928_10004189 | 3300002067 | Bacteria | 4871 |
| 15 | JGI24735J21928_10004916 | 3300002067 | Bacteria | 4455 |
| 16 | JGI24735J21928_10007068 | 3300002067 | Bacteria | 3667 |
| 17 | JGI24735J21928_10019301 | 3300002067 | Bacteria | 2096 |
| 18 | JGI24750J21931_1010742 | 3300002070 | Bacteria | 1197 |
| 19 | JGI24738J21930_10000464 | 3300002075 | Bacteria | 11506 |
| 20 | JGI24738J21930_10002688 | 3300002075 | Bacteria | 4585 |
| 21 | JGI24751J29686_10007032 | 3300002459 | Bacteria | 2299 |
| 22 | JGI25150J39212_1000213 | 3300002774 | Bacteria | 31530 |
| 23 | JGI25165J46597_1000112 | 3300003214 | Bacteria | 147097 |
| 24 | JGI25153J46596_10000036 | 3300003215 | Bacteria | 182205 |
| 25 | rootH1_10111877 | 3300003316 | Bacteria | 1296 |
| 26 | rootL2_10227911 | 3300003322 | Bacteria | 1674 |
| 27 | Ga0055526_1000948 | 3300003771 | Bacteria | 21478 |
| 28 | Ga0055526_1040803 | 3300003771 | Bacteria | 1165 |
| 29 | Ga0055536_1013054 | 3300003781 | Bacteria | 3028 |
| 30 | Ga0055540_1001281 | 3300003792 | Bacteria | 15301 |
| 31 | JGI25405J52794_10003443 | 3300003911 | Bacteria | 2773 |
| 32 | Ga0065165_1077603 | 3300005262 | Bacteria | 869 |
| 33 | Ga0065704_10072077 | 3300005289 | Bacteria | 9198 |
| 34 | Ga0070658_10000896 | 3300005327 | Bacteria | 25520 |
| 35 | Ga0070658_10005034 | 3300005327 | Bacteria | 10754 |
| 36 | Ga0070658_10006492 | 3300005327 | Bacteria | 9479 |
| 37 | Ga0070658_10081915 | 3300005327 | Bacteria | 2651 |
| 38 | Ga0070676_10000257 | 3300005328 | Bacteria | 23128 |
| 39 | Ga0070670_100042123 | 3300005331 | Bacteria | 3924 |
| 40 | Ga0068869_100004094 | 3300005334 | Bacteria | 9028 |
| 41 | Ga0070666_10000063 | 3300005335 | Bacteria | 80378 |
| 42 | Ga0068868_100000023 | 3300005338 | Bacteria | 85334 |
| 43 | Ga0070660_100000395 | 3300005339 | Bacteria | 28996 |
| 44 | Ga0070660_100049125 | 3300005339 | Bacteria | 3242 |
| 45 | Ga0070660_100084076 | 3300005339 | Bacteria | 2501 |
| 46 | Ga0070660_100217734 | 3300005339 | Bacteria | 1551 |
| 47 | Ga0070661_100036450 | 3300005344 | Bacteria | 3575 |
| 48 | Ga0070661_100042406 | 3300005344 | Bacteria | 3321 |
| 49 | Ga0070661_100123609 | 3300005344 | Bacteria | 1940 |
| 50 | Ga0070668_100000739 | 3300005347 | Bacteria | 22344 |
| 51 | Ga0070668_100013413 | 3300005347 | Bacteria | 6116 |
| 52 | Ga0070668_100088273 | 3300005347 | Bacteria | 2441 |
| 53 | Ga0070669_100000042 | 3300005353 | Bacteria | 123396 |
| 54 | Ga0070671_100000002 | 3300005355 | Bacteria | 292733 |
| 55 | Ga0070671_100043899 | 3300005355 | Bacteria | 3715 |
| 56 | Ga0070671_100162503 | 3300005355 | Bacteria | 1888 |
| 57 | Ga0070671_100182742 | 3300005355 | Bacteria | 1776 |
| 58 | Ga0070674_100068398 | 3300005356 | Bacteria | 2502 |
| 59 | Ga0070673_100000001 | 3300005364 | Bacteria | 239842 |
| 60 | Ga0070673_100335412 | 3300005364 | Bacteria | 1339 |
| 61 | Ga0070659_100017522 | 3300005366 | Bacteria | 5394 |
| 62 | Ga0070659_100021216 | 3300005366 | Bacteria | 4942 |
| 63 | Ga0070659_100056093 | 3300005366 | Bacteria | 3106 |
| 64 | Ga0070659_100137208 | 3300005366 | Bacteria | 1989 |
| 65 | Ga0070667_100000016 | 3300005367 | Bacteria | 237028 |
| 66 | Ga0070667_100000162 | 3300005367 | Bacteria | 83150 |
| 67 | Ga0070667_100035266 | 3300005367 | Bacteria | 4190 |
| 68 | Ga0070714_100262029 | 3300005435 | Bacteria | 1601 |
| 69 | Ga0070663_100012272 | 3300005455 | Bacteria | 5413 |
| 70 | Ga0070663_100013894 | 3300005455 | Bacteria | 5150 |
| 71 | Ga0070662_100002436 | 3300005457 | Bacteria | 11448 |
| 72 | Ga0070662_100009003 | 3300005457 | Bacteria | 6513 |
| 73 | Ga0070662_100039173 | 3300005457 | Bacteria | 3371 |
| 74 | Ga0070662_100067495 | 3300005457 | Bacteria | 2626 |
| 75 | Ga0070662_100206618 | 3300005457 | Bacteria | 1561 |
| 76 | Ga0068867_100000387 | 3300005459 | Bacteria | 29397 |
| 77 | Ga0070679_100008282 | 3300005530 | Bacteria | 9782 |
| 78 | Ga0070679_100274033 | 3300005530 | Bacteria | 1641 |
| 79 | Ga0070684_100042855 | 3300005535 | Bacteria | 3908 |
| 80 | Ga0068853_100013579 | 3300005539 | Bacteria | 6655 |
| 81 | Ga0068853_100018932 | 3300005539 | Bacteria | 5702 |
| 82 | Ga0068853_100209603 | 3300005539 | Bacteria | 1776 |
| 83 | Ga0068853_100364157 | 3300005539 | Bacteria | 1347 |
| 84 | Ga0070672_100093513 | 3300005543 | Bacteria | 2429 |
| 85 | Ga0070686_100160416 | 3300005544 | Bacteria | 1583 |
| 86 | Ga0070665_100000186 | 3300005548 | Bacteria | 110750 |
| 87 | Ga0070665_100105320 | 3300005548 | Bacteria | 2822 |
| 88 | Ga0068855_100000092 | 3300005563 | Bacteria | 107195 |
| 89 | Ga0068855_100008444 | 3300005563 | Bacteria | 12453 |
| 90 | Ga0068855_100014816 | 3300005563 | Bacteria | 9389 |
| 91 | Ga0068855_100034440 | 3300005563 | Bacteria | 6040 |
| 92 | Ga0068855_100144960 | 3300005563 | Bacteria | 2704 |
| 93 | Ga0068855_100299424 | 3300005563 | Bacteria | 1781 |
| 94 | Ga0070664_100011340 | 3300005564 | Bacteria | 7233 |
| 95 | Ga0070664_100013946 | 3300005564 | Bacteria | 6552 |
| 96 | Ga0070664_100025320 | 3300005564 | Bacteria | 4917 |
| 97 | Ga0070664_100255870 | 3300005564 | Bacteria | 1575 |
| 98 | Ga0068857_100051510 | 3300005577 | Bacteria | 3653 |
| 99 | Ga0068857_100056170 | 3300005577 | Bacteria | 3494 |
| 100 | Ga0068857_100283789 | 3300005577 | Bacteria | 1523 |
| 101 | Ga0068857_100502939 | 3300005577 | Bacteria | 1137 |
| 102 | Ga0068854_100001764 | 3300005578 | Bacteria | 13172 |
| 103 | Ga0068854_100013863 | 3300005578 | Bacteria | 5301 |
| 104 | Ga0068854_100019275 | 3300005578 | Bacteria | 4595 |
| 105 | Ga0068854_100114825 | 3300005578 | Bacteria | 2036 |
| 106 | Ga0068856_100011968 | 3300005614 | Bacteria | 8401 |
| 107 | Ga0068856_100033420 | 3300005614 | Bacteria | 5036 |
| 108 | Ga0068856_100322377 | 3300005614 | Bacteria | 1562 |
| 109 | Ga0068852_100001030 | 3300005616 | Bacteria | 18351 |
| 110 | Ga0068852_100080343 | 3300005616 | Bacteria | 2890 |
| 111 | Ga0068852_100538086 | 3300005616 | Bacteria | 1167 |
| 112 | Ga0068852_100722711 | 3300005616 | Bacteria | 1007 |
| 113 | Ga0068859_100002597 | 3300005617 | Bacteria | 18383 |
| 114 | Ga0068864_100000731 | 3300005618 | Bacteria | 27480 |
| 115 | Ga0068864_100537051 | 3300005618 | Bacteria | 1129 |
| 116 | Ga0068866_10042187 | 3300005718 | Bacteria | 2269 |
| 117 | Ga0068861_100000148 | 3300005719 | Bacteria | 36127 |
| 118 | Ga0068851_10011304 | 3300005834 | Bacteria | 4185 |
| 119 | Ga0068851_10012072 | 3300005834 | Bacteria | 4067 |
| 120 | Ga0068863_100000047 | 3300005841 | Bacteria | 140249 |
| 121 | Ga0068863_100003767 | 3300005841 | Bacteria | 15004 |
| 122 | Ga0068863_100010486 | 3300005841 | Bacteria | 9007 |
| 123 | Ga0068863_100014281 | 3300005841 | Bacteria | 7649 |
| 124 | Ga0068858_100000588 | 3300005842 | Bacteria | 38216 |
| 125 | Ga0068858_100003492 | 3300005842 | Bacteria | 15587 |
| 126 | Ga0068860_100000196 | 3300005843 | Bacteria | 97096 |
| 127 | Ga0068860_100008267 | 3300005843 | Bacteria | 10356 |
| 128 | Ga0068860_100023270 | 3300005843 | Bacteria | 5987 |
| 129 | Ga0068860_100036289 | 3300005843 | Bacteria | 4724 |
| 130 | Ga0068862_100000063 | 3300005844 | Bacteria | 124662 |
| 131 | Ga0068862_100007384 | 3300005844 | Bacteria | 9116 |
| 132 | Ga0068862_100924121 | 3300005844 | Bacteria | 859 |
| 133 | Ga0081455_10002546 | 3300005937 | Bacteria | 21639 |
| 134 | Ga0075368_10000252 | 3300006042 | Bacteria | 15267 |
| 135 | Ga0075363_100052875 | 3300006048 | Bacteria | 2169 |
| 136 | Ga0075367_10000054 | 3300006178 | Bacteria | 27401 |
| 137 | Ga0097621_100031374 | 3300006237 | Bacteria | 4217 |
| 138 | Ga0097621_100190058 | 3300006237 | Bacteria | 1778 |
| 139 | Ga0075370_10006098 | 3300006353 | Bacteria | 6045 |
| 140 | Ga0075370_10037579 | 3300006353 | Bacteria | 2723 |
| 141 | Ga0068871_100185845 | 3300006358 | Bacteria | 1788 |
| 142 | Ga0068865_100000072 | 3300006881 | Bacteria | 53411 |
| 143 | Ga0068865_100279800 | 3300006881 | Bacteria | 1328 |
| 144 | Ga0097620_100002597 | 3300006931 | Bacteria | 18383 |
| 145 | Ga0097620_100011775 | 3300006931 | Bacteria | 8788 |
| 146 | Ga0105251_10015352 | 3300009011 | Bacteria | 4192 |
| 147 | Ga0105240_10000959 | 3300009093 | Bacteria | 51453 |
| 148 | Ga0105240_10004825 | 3300009093 | Bacteria | 20323 |
| 149 | Ga0105240_10043982 | 3300009093 | Bacteria | 5679 |
| 150 | Ga0105240_10055391 | 3300009093 | Bacteria | 4964 |
| 151 | Ga0105240_10056021 | 3300009093 | Bacteria | 4934 |
| 152 | Ga0105245_10000991 | 3300009098 | Bacteria | 25817 |
| 153 | Ga0105245_10001709 | 3300009098 | Bacteria | 20004 |
| 154 | Ga0105247_10001115 | 3300009101 | Bacteria | 20007 |
| 155 | Ga0105247_10063313 | 3300009101 | Bacteria | 2295 |
| 156 | Ga0105243_10000737 | 3300009148 | Bacteria | 31311 |
| 157 | Ga0105243_10047869 | 3300009148 | Bacteria | 3369 |
| 158 | Ga0105243_10129062 | 3300009148 | Bacteria | 2142 |
| 159 | Ga0105241_10002409 | 3300009174 | Bacteria | 14050 |
| 160 | Ga0105241_10030503 | 3300009174 | Bacteria | 4030 |
| 161 | Ga0105241_10446330 | 3300009174 | Bacteria | 1143 |
| 162 | Ga0105242_10000178 | 3300009176 | Bacteria | 48486 |
| 163 | Ga0105248_10019155 | 3300009177 | Bacteria | 7571 |
| 164 | Ga0105237_10001281 | 3300009545 | Bacteria | 33535 |
| 165 | Ga0105237_10007067 | 3300009545 | Bacteria | 12344 |
| 166 | Ga0105237_10016910 | 3300009545 | Bacteria | 7569 |
| 167 | Ga0105237_10104848 | 3300009545 | Bacteria | 2819 |
| 168 | Ga0105237_10233537 | 3300009545 | Bacteria | 1840 |
| 169 | Ga0105238_10017266 | 3300009551 | Bacteria | 7330 |
| 170 | Ga0105238_10092272 | 3300009551 | Bacteria | 3016 |
| 171 | Ga0105238_10210877 | 3300009551 | Bacteria | 1918 |
| 172 | Ga0105249_10129922 | 3300009553 | Bacteria | 2403 |
| 173 | Ga0105249_10321312 | 3300009553 | Bacteria | 1559 |
| 174 | Ga0105239_10000156 | 3300010375 | Bacteria | 98400 |
| 175 | Ga0105239_10027427 | 3300010375 | Bacteria | 6270 |
| 176 | Ga0105246_10000632 | 3300011119 | Bacteria | 19638 |
| 177 | Ga0105246_10003219 | 3300011119 | Bacteria | 9909 |
| 178 | Ga0157373_10003358 | 3300013100 | Bacteria | 12096 |
| 179 | Ga0157373_10024990 | 3300013100 | Bacteria | 4324 |
| 180 | Ga0157373_10066548 | 3300013100 | Bacteria | 2549 |
| 181 | Ga0157373_10119605 | 3300013100 | Bacteria | 1851 |
| 182 | Ga0157371_10000030 | 3300013102 | Bacteria | 241585 |
| 183 | Ga0157371_10003665 | 3300013102 | Bacteria | 13817 |
| 184 | Ga0157371_10148248 | 3300013102 | Bacteria | 1673 |
| 185 | Ga0157370_10000213 | 3300013104 | Bacteria | 73863 |
| 186 | Ga0157370_10008634 | 3300013104 | Bacteria | 10966 |
| 187 | Ga0157370_10027202 | 3300013104 | Bacteria | 5639 |
| 188 | Ga0157370_10031556 | 3300013104 | Bacteria | 5180 |
| 189 | Ga0157369_10030780 | 3300013105 | Bacteria | 5917 |
| 190 | Ga0157369_10049579 | 3300013105 | Bacteria | 4552 |
| 191 | Ga0157369_10374014 | 3300013105 | Bacteria | 1479 |
| 192 | Ga0157369_10536632 | 3300013105 | Bacteria | 1210 |
| 193 | Ga0157374_10005847 | 3300013296 | Bacteria | 10390 |
| 194 | Ga0157374_10026073 | 3300013296 | Bacteria | 5255 |
| 195 | Ga0157374_10399118 | 3300013296 | Bacteria | 1372 |
| 196 | Ga0157378_10017190 | 3300013297 | Bacteria | 6340 |
| 197 | Ga0157378_10376366 | 3300013297 | Bacteria | 1393 |
| 198 | Ga0163162_10025996 | 3300013306 | Bacteria | 5785 |
| 199 | Ga0163162_10305216 | 3300013306 | Bacteria | 1724 |
| 200 | Ga0157372_10005904 | 3300013307 | Bacteria | 13033 |
| 201 | Ga0157372_10064731 | 3300013307 | Bacteria | 4102 |
| 202 | Ga0157372_10148749 | 3300013307 | Bacteria | 2702 |
| 203 | Ga0157372_10215277 | 3300013307 | Bacteria | 2226 |
| 204 | Ga0157372_10321430 | 3300013307 | Bacteria | 1802 |
| 205 | Ga0157372_10597749 | 3300013307 | Bacteria | 1286 |
| 206 | Ga0157375_10009597 | 3300013308 | Bacteria | 8502 |
| 207 | Ga0157375_10648450 | 3300013308 | Bacteria | 1212 |
| 208 | Ga0157380_10259177 | 3300014326 | Bacteria | 1578 |
| 209 | Ga0157377_10008193 | 3300014745 | Bacteria | 5086 |
| 210 | Ga0157376_10000287 | 3300014969 | Bacteria | 34078 |
| 211 | Ga0183363_1005 | 3300015690 | Bacteria | 403020 |
| 212 | Ga0163161_10033177 | 3300017792 | Bacteria | 3689 |
| 213 | Ga0206356_10706515 | 3300020070 | Bacteria | 975 |
| 214 | Ga0213875_10000229 | 3300021388 | Bacteria | 56654 |
| 215 | Ga0213875_10091761 | 3300021388 | Bacteria | 1417 |
| 216 | Ga0209147_100491 | 3300025229 | Bacteria | 23505 |
| 217 | Ga0209563_100047 | 3300025230 | Bacteria | 366620 |
| 218 | Ga0207425_1000037 | 3300025245 | Bacteria | 224645 |
| 219 | Ga0209148_1000133 | 3300025254 | Bacteria | 171351 |
| 220 | Ga0209148_1001220 | 3300025254 | Bacteria | 14537 |
| 221 | Ga0209129_1000363 | 3300025258 | Bacteria | 37614 |
| 222 | Ga0209233_1000078 | 3300025261 | Bacteria | 348118 |
| 223 | Ga0209565_1000427 | 3300025263 | Bacteria | 34040 |
| 224 | Ga0209455_1014725 | 3300025272 | Bacteria | 1755 |
| 225 | Ga0209676_1002287 | 3300025292 | Bacteria | 13986 |
| 226 | Ga0209676_1010356 | 3300025292 | Bacteria | 3899 |
| 227 | Ga0209025_1000117 | 3300025294 | Bacteria | 215073 |
| 228 | Ga0209564_1003622 | 3300025295 | Bacteria | 10279 |
| 229 | Ga0209564_1005290 | 3300025295 | Bacteria | 7438 |
| 230 | Ga0209758_1000103 | 3300025297 | Bacteria | 223968 |
| 231 | Ga0209758_1029405 | 3300025297 | Bacteria | 2299 |
| 232 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 233 | Ga0209050_1004951 | 3300025298 | Bacteria | 8681 |
| 234 | Ga0209050_1014423 | 3300025298 | Bacteria | 3404 |
| 235 | Ga0207426_1009119 | 3300025302 | Bacteria | 3945 |
| 236 | Ga0209051_1003509 | 3300025303 | Bacteria | 10253 |
| 237 | Ga0209257_1005036 | 3300025304 | Bacteria | 9613 |
| 238 | Ga0209257_1005111 | 3300025304 | Bacteria | 9510 |
| 239 | Ga0207697_10000130 | 3300025315 | Bacteria | 36265 |
| 240 | Ga0207656_10008971 | 3300025321 | Bacteria | 3704 |
| 241 | Ga0207642_10032946 | 3300025899 | Bacteria | 2187 |
| 242 | Ga0207710_10008193 | 3300025900 | Bacteria | 4411 |
| 243 | Ga0207710_10033001 | 3300025900 | Bacteria | 2269 |
| 244 | Ga0207688_10132857 | 3300025901 | Bacteria | 1460 |
| 245 | Ga0207680_10000033 | 3300025903 | Bacteria | 77177 |
| 246 | Ga0207647_10001366 | 3300025904 | Bacteria | 18757 |
| 247 | Ga0207647_10005723 | 3300025904 | Bacteria | 9077 |
| 248 | Ga0207647_10008063 | 3300025904 | Bacteria | 7573 |
| 249 | Ga0207647_10123078 | 3300025904 | Bacteria | 1528 |
| 250 | Ga0207645_10000520 | 3300025907 | Bacteria | 31954 |
| 251 | Ga0207645_10030776 | 3300025907 | Bacteria | 3459 |
| 252 | Ga0207705_10000018 | 3300025909 | Bacteria | 319792 |
| 253 | Ga0207705_10000163 | 3300025909 | Bacteria | 71674 |
| 254 | Ga0207705_10001877 | 3300025909 | Bacteria | 16493 |
| 255 | Ga0207705_10009458 | 3300025909 | Bacteria | 7088 |
| 256 | Ga0207705_10277494 | 3300025909 | Bacteria | 1282 |
| 257 | Ga0207654_10000852 | 3300025911 | Bacteria | 16833 |
| 258 | Ga0207707_10026421 | 3300025912 | Bacteria | 5074 |
| 259 | Ga0207707_10079378 | 3300025912 | Bacteria | 2866 |
| 260 | Ga0207695_10000521 | 3300025913 | Bacteria | 81496 |
| 261 | Ga0207695_10003499 | 3300025913 | Bacteria | 22030 |
| 262 | Ga0207695_10015077 | 3300025913 | Bacteria | 9118 |
| 263 | Ga0207695_10029492 | 3300025913 | Bacteria | 6059 |
| 264 | Ga0207695_10136608 | 3300025913 | Bacteria | 2405 |
| 265 | Ga0207671_10000607 | 3300025914 | Bacteria | 47542 |
| 266 | Ga0207671_10023761 | 3300025914 | Bacteria | 4619 |
| 267 | Ga0207671_10028062 | 3300025914 | Bacteria | 4207 |
| 268 | Ga0207660_10089146 | 3300025917 | Bacteria | 2283 |
| 269 | Ga0207657_10000408 | 3300025919 | Bacteria | 45400 |
| 270 | Ga0207657_10012810 | 3300025919 | Bacteria | 8253 |
| 271 | Ga0207657_10016065 | 3300025919 | Bacteria | 7226 |
| 272 | Ga0207657_10058219 | 3300025919 | Bacteria | 3326 |
| 273 | Ga0207657_10138453 | 3300025919 | Bacteria | 1990 |
| 274 | Ga0207657_10160254 | 3300025919 | Bacteria | 1828 |
| 275 | Ga0207657_10489385 | 3300025919 | Bacteria | 964 |
| 276 | Ga0207649_10000199 | 3300025920 | Bacteria | 49941 |
| 277 | Ga0207649_10005456 | 3300025920 | Bacteria | 6885 |
| 278 | Ga0207649_10112409 | 3300025920 | Bacteria | 1822 |
| 279 | Ga0207652_10251142 | 3300025921 | Bacteria | 1595 |
| 280 | Ga0207652_10328239 | 3300025921 | Bacteria | 1381 |
| 281 | Ga0207652_10342710 | 3300025921 | Bacteria | 1349 |
| 282 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 283 | Ga0207694_10004278 | 3300025924 | Bacteria | 11176 |
| 284 | Ga0207694_10057818 | 3300025924 | Bacteria | 3016 |
| 285 | Ga0207694_10153631 | 3300025924 | Bacteria | 1855 |
| 286 | Ga0207650_10097313 | 3300025925 | Bacteria | 2259 |
| 287 | Ga0207659_10297651 | 3300025926 | Bacteria | 1324 |
| 288 | Ga0207687_10002396 | 3300025927 | Bacteria | 12709 |
| 289 | Ga0207687_10009517 | 3300025927 | Bacteria | 6355 |
| 290 | Ga0207664_10284302 | 3300025929 | Bacteria | 1452 |
| 291 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 292 | Ga0207644_10031668 | 3300025931 | Bacteria | 3686 |
| 293 | Ga0207690_10003817 | 3300025932 | Bacteria | 8918 |
| 294 | Ga0207690_10013220 | 3300025932 | Bacteria | 4956 |
| 295 | Ga0207690_10049134 | 3300025932 | Bacteria | 2810 |
| 296 | Ga0207706_10004237 | 3300025933 | Bacteria | 13507 |
| 297 | Ga0207706_10005782 | 3300025933 | Bacteria | 11503 |
| 298 | Ga0207706_10016251 | 3300025933 | Bacteria | 6723 |
| 299 | Ga0207706_10017165 | 3300025933 | Bacteria | 6527 |
| 300 | Ga0207706_10029979 | 3300025933 | Bacteria | 4856 |
| 301 | Ga0207706_10036693 | 3300025933 | Bacteria | 4353 |
| 302 | Ga0207706_10055843 | 3300025933 | Bacteria | 3482 |
| 303 | Ga0207706_10060294 | 3300025933 | Bacteria | 3341 |
| 304 | Ga0207686_10001920 | 3300025934 | Bacteria | 11495 |
| 305 | Ga0207709_10000432 | 3300025935 | Bacteria | 40012 |
| 306 | Ga0207709_10096414 | 3300025935 | Bacteria | 1945 |
| 307 | Ga0207704_10000032 | 3300025938 | Bacteria | 108408 |
| 308 | Ga0207704_10179440 | 3300025938 | Bacteria | 1528 |
| 309 | Ga0207691_10073708 | 3300025940 | Bacteria | 3079 |
| 310 | Ga0207711_10029217 | 3300025941 | Bacteria | 4647 |
| 311 | Ga0207689_10008114 | 3300025942 | Bacteria | 9158 |
| 312 | Ga0207661_10120942 | 3300025944 | Bacteria | 2229 |
| 313 | Ga0207667_10000013 | 3300025949 | Bacteria | 435875 |
| 314 | Ga0207667_10007430 | 3300025949 | Bacteria | 13168 |
| 315 | Ga0207667_10047477 | 3300025949 | Bacteria | 4545 |
| 316 | Ga0207667_10088539 | 3300025949 | Bacteria | 3201 |
| 317 | Ga0207667_10266992 | 3300025949 | Bacteria | 1750 |
| 318 | Ga0207651_10000001 | 3300025960 | Bacteria | 516823 |
| 319 | Ga0207712_10000069 | 3300025961 | Bacteria | 127318 |
| 320 | Ga0207712_10001860 | 3300025961 | Bacteria | 13872 |
| 321 | Ga0207640_10000050 | 3300025981 | Bacteria | 96203 |
| 322 | Ga0207640_10084174 | 3300025981 | Bacteria | 2183 |
| 323 | Ga0207640_10109461 | 3300025981 | Bacteria | 1955 |
| 324 | Ga0207640_10192816 | 3300025981 | Bacteria | 1537 |
| 325 | Ga0207640_10278503 | 3300025981 | Bacteria | 1312 |
| 326 | Ga0207658_10000075 | 3300025986 | Bacteria | 109004 |
| 327 | Ga0207658_10017969 | 3300025986 | Bacteria | 4874 |
| 328 | Ga0207677_10001163 | 3300026023 | Bacteria | 14359 |
| 329 | Ga0207703_10001509 | 3300026035 | Bacteria | 21208 |
| 330 | Ga0207639_10000138 | 3300026041 | Bacteria | 54326 |
| 331 | Ga0207639_10003659 | 3300026041 | Bacteria | 10329 |
| 332 | Ga0207639_10005117 | 3300026041 | Bacteria | 8835 |
| 333 | Ga0207639_10038650 | 3300026041 | Bacteria | 3551 |
| 334 | Ga0207639_10205081 | 3300026041 | Bacteria | 1694 |
| 335 | Ga0207678_10002459 | 3300026067 | Bacteria | 16827 |
| 336 | Ga0207678_10003700 | 3300026067 | Bacteria | 13745 |
| 337 | Ga0207678_10021977 | 3300026067 | Bacteria | 5592 |
| 338 | Ga0207702_10010000 | 3300026078 | Bacteria | 7953 |
| 339 | Ga0207702_10010202 | 3300026078 | Bacteria | 7863 |
| 340 | Ga0207702_10012601 | 3300026078 | Bacteria | 7037 |
| 341 | Ga0207702_10022803 | 3300026078 | Bacteria | 5193 |
| 342 | Ga0207702_10114116 | 3300026078 | Bacteria | 2407 |
| 343 | Ga0207641_10000973 | 3300026088 | Bacteria | 29317 |
| 344 | Ga0207641_10001660 | 3300026088 | Bacteria | 21708 |
| 345 | Ga0207641_10019831 | 3300026088 | Bacteria | 5518 |
| 346 | Ga0207648_10001195 | 3300026089 | Bacteria | 29082 |
| 347 | Ga0207676_10000705 | 3300026095 | Bacteria | 26301 |
| 348 | Ga0207676_10653108 | 3300026095 | Bacteria | 1015 |
| 349 | Ga0207674_10003143 | 3300026116 | Bacteria | 20360 |
| 350 | Ga0207674_10006416 | 3300026116 | Bacteria | 13835 |
| 351 | Ga0207674_10018492 | 3300026116 | Bacteria | 7574 |
| 352 | Ga0207674_10059376 | 3300026116 | Bacteria | 3870 |
| 353 | Ga0207674_10063616 | 3300026116 | Bacteria | 3724 |
| 354 | Ga0207674_10088996 | 3300026116 | Bacteria | 3080 |
| 355 | Ga0207674_10732169 | 3300026116 | Bacteria | 954 |
| 356 | Ga0207675_100000355 | 3300026118 | Bacteria | 43840 |
| 357 | Ga0207683_10004967 | 3300026121 | Bacteria | 11438 |
| 358 | Ga0207683_10268557 | 3300026121 | Bacteria | 1558 |
| 359 | Ga0207698_10000551 | 3300026142 | Bacteria | 21787 |
| 360 | Ga0207698_10033092 | 3300026142 | Bacteria | 3753 |
| 361 | Ga0207698_10174385 | 3300026142 | Bacteria | 1897 |
| 362 | Ga0207698_10179648 | 3300026142 | Bacteria | 1873 |
| 363 | Ga0209813_10000063 | 3300027866 | Bacteria | 43741 |
| 364 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 365 | Ga0268265_10000055 | 3300028380 | Bacteria | 158947 |
| 366 | Ga0268265_10000361 | 3300028380 | Bacteria | 49182 |
| 367 | Ga0268265_10892249 | 3300028380 | Bacteria | 872 |
| 368 | Ga0268264_10000087 | 3300028381 | Bacteria | 236696 |
| 369 | Ga0268264_10000116 | 3300028381 | Bacteria | 198591 |
| 370 | Ga0268264_10000381 | 3300028381 | Bacteria | 64651 |
| 371 | Ga0307517_10019763 | 3300028786 | Bacteria | 8619 |
| 372 | Ga0307517_10082933 | 3300028786 | Bacteria | 2716 |
| 373 | Ga0307408_100024384 | 3300031548 | Bacteria | 4130 |
| 374 | Ga0307413_10033283 | 3300031824 | Bacteria | 2933 |
| 375 | Ga0307410_10093588 | 3300031852 | Bacteria | 2139 |
| 376 | Ga0307410_10125478 | 3300031852 | Bacteria | 1878 |
| 377 | Ga0307406_10101318 | 3300031901 | Bacteria | 1962 |
| 378 | Ga0307406_10179361 | 3300031901 | Bacteria | 1540 |
| 379 | Ga0307412_10000950 | 3300031911 | Bacteria | 16577 |
| 380 | Ga0307412_10023565 | 3300031911 | Bacteria | 3789 |
| 381 | Ga0307412_10086127 | 3300031911 | Bacteria | 2185 |
| 382 | Ga0307412_10186843 | 3300031911 | Bacteria | 1563 |
| 383 | Ga0307409_100135470 | 3300031995 | Bacteria | 2113 |
| 384 | Ga0307409_100412705 | 3300031995 | Bacteria | 1293 |
| 385 | Ga0307409_100736415 | 3300031995 | Bacteria | 988 |
| 386 | Ga0307416_100018666 | 3300032002 | Bacteria | 4894 |
| 387 | Ga0307414_10001891 | 3300032004 | Bacteria | 10819 |
| 388 | Ga0307414_10112675 | 3300032004 | Bacteria | 2074 |
| 389 | Ga0307414_10320199 | 3300032004 | Bacteria | 1319 |
| 390 | Ga0307411_10067422 | 3300032005 | Bacteria | 2408 |
| 391 | Ga0307411_10551386 | 3300032005 | Bacteria | 983 |
| 392 | Ga0373923_0046343 | 3300035111 | Bacteria | 1808 |
| 393 | Ga0316584_0116543 | 3300036712 | Bacteria | 1998 |
| 394 | Ga0395899_0002292 | 3300037312 | Bacteria | 15614 |
| 395 | Ga0395900_0021625 | 3300037418 | Bacteria | 6576 |
| 396 | Ga0395900_0179985 | 3300037418 | Bacteria | 2149 |
| 397 | Ga0395905_0016001 | 3300037471 | Bacteria | 7130 |
| 398 | Ga0395905_0030594 | 3300037471 | Bacteria | 5071 |
| 399 | Ga0395905_0148075 | 3300037471 | Bacteria | 2209 |
| 400 | Ga0395905_0584614 | 3300037471 | Bacteria | 1018 |
| 401 | Ga0395905_0726545 | 3300037471 | Bacteria | 895 |
| 402 | Ga0436364_0413697 | 3300037853 | Bacteria | 1944 |
| 403 | Ga0436364_0530420 | 3300037853 | Bacteria | 132998 |
| 404 | Ga0436365_1704067 | 3300039437 | Bacteria | 1313 |
| 405 | Ga0451793_1365563 | 3300041452 | Bacteria | 1797 |
| 406 | Ga0451802_1527592 | 3300041460 | Bacteria | 3233 |
| 407 | Ga0451806_292367 | 3300041462 | Bacteria | 1569 |
| 408 | Ga0451807_2051197 | 3300041486 | Bacteria | 1589 |
| 409 | Ga0439448_0022377 | 3300042005 | Bacteria | 1964 |
| 410 | Ga0439455_0000137 | 3300042012 | Bacteria | 7821 |
| 411 | Ga0439458_0000756 | 3300042157 | Bacteria | 8283 |
| 412 | Ga0439458_0012507 | 3300042157 | Bacteria | 1906 |
| 413 | Ga0439458_0037728 | 3300042157 | Bacteria | 1165 |
| 414 | Ga0466972_0010998 | 3300044658 | Bacteria | 4543 |
| 415 | Ga0466972_0019619 | 3300044658 | Bacteria | 3380 |
| 416 | Ga0466965_0069761 | 3300044683 | Bacteria | 1766 |
| 417 | Ga0466961_0002427 | 3300044693 | Bacteria | 11561 |
| 418 | Ga0466961_0151817 | 3300044693 | Bacteria | 1446 |
| 419 | Ga0466970_0010891 | 3300044765 | Bacteria | 4625 |
| 420 | Ga0466957_0086515 | 3300044842 | Bacteria | 1959 |
| 421 | Ga0466957_0131832 | 3300044842 | Bacteria | 1602 |
| 422 | Ga0466960_0002678 | 3300044901 | Bacteria | 6726 |
| 423 | Ga0466959_0000595 | 3300045049 | Bacteria | 21075 |
| 424 | Ga0466958_0090108 | 3300045836 | Bacteria | 1897 |
| 425 | Ga0466958_0095266 | 3300045836 | Bacteria | 1845 |
| 426 | Ga0495617_035157 | 3300046452 | Bacteria | 1683 |
| 427 | Ga0495627_000193 | 3300046453 | Bacteria | 67253 |
| 428 | Ga0495627_000478 | 3300046453 | Bacteria | 33914 |
| 429 | Ga0495638_0000011 | 3300046460 | Bacteria | 442453 |
| 430 | Ga0495650_0000373 | 3300046471 | Bacteria | 78223 |
| 431 | Ga0495650_0006527 | 3300046471 | Bacteria | 7250 |
| 432 | Ga0495650_0049726 | 3300046471 | Bacteria | 1739 |
| 433 | Ga0495584_0074512 | 3300046491 | Bacteria | 1706 |
| 434 | Ga0495583_0000305 | 3300046506 | Bacteria | 78306 |
| 435 | Ga0495583_0002224 | 3300046506 | Bacteria | 17153 |
| 436 | Ga0495583_0011527 | 3300046506 | Bacteria | 5070 |
| 437 | Ga0495583_0063366 | 3300046506 | Bacteria | 1643 |
| 438 | Ga0495606_0000591 | 3300046507 | Bacteria | 57426 |
| 439 | Ga0495606_0008930 | 3300046507 | Bacteria | 8581 |
| 440 | Ga0495606_0149671 | 3300046507 | Bacteria | 1371 |
| 441 | Ga0495610_0001092 | 3300046512 | Bacteria | 24761 |
| 442 | Ga0495616_0000018 | 3300046513 | Bacteria | 167281 |
| 443 | Ga0495631_0026785 | 3300046518 | Bacteria | 2643 |
| 444 | Ga0495632_0000042 | 3300046519 | Bacteria | 145186 |
| 445 | Ga0495632_0000538 | 3300046519 | Bacteria | 35631 |
| 446 | Ga0495637_0000626 | 3300046520 | Bacteria | 24967 |
| 447 | Ga0495637_0019775 | 3300046520 | Bacteria | 3109 |
| 448 | Ga0495637_0020613 | 3300046520 | Bacteria | 3031 |
| 449 | Ga0495643_0000005 | 3300046522 | Bacteria | 443135 |
| 450 | Ga0495648_0000023 | 3300046524 | Bacteria | 240174 |
| 451 | Ga0495648_0000115 | 3300046524 | Bacteria | 98656 |
| 452 | Ga0495648_0009282 | 3300046524 | Bacteria | 7645 |
| 453 | Ga0495663_0000015 | 3300046525 | Bacteria | 145185 |
| 454 | Ga0495663_0004526 | 3300046525 | Bacteria | 3899 |
| 455 | Ga0495587_0195933 | 3300046536 | Bacteria | 1143 |
| 456 | Ga0495622_0006174 | 3300046557 | Bacteria | 5565 |
| 457 | Ga0495633_0000197 | 3300046558 | Bacteria | 76903 |
| 458 | Ga0495633_0000262 | 3300046558 | Bacteria | 62524 |
| 459 | Ga0495633_0002581 | 3300046558 | Bacteria | 12683 |
| 460 | Ga0495633_0011568 | 3300046558 | Bacteria | 4749 |
| 461 | Ga0495633_0038543 | 3300046558 | Bacteria | 2282 |
| 462 | Ga0495633_0044808 | 3300046558 | Bacteria | 2096 |
| 463 | Ga0495668_0014245 | 3300046616 | Bacteria | 4668 |
| 464 | Ga0495668_0173497 | 3300046616 | Bacteria | 1181 |
| 465 | Ga0495611_0044505 | 3300046648 | Bacteria | 1986 |
| 466 | Ga0495611_0111175 | 3300046648 | Bacteria | 1275 |
| 467 | Ga0495625_0000959 | 3300046660 | Bacteria | 38428 |
| 468 | Ga0495625_0003788 | 3300046660 | Bacteria | 14662 |
| 469 | Ga0495625_0133328 | 3300046660 | Bacteria | 1681 |
| 470 | Ga0495625_0165586 | 3300046660 | Bacteria | 1478 |
| 471 | Ga0495661_0101759 | 3300046665 | Bacteria | 1616 |
| 472 | Ga0495669_0000268 | 3300046684 | Bacteria | 29882 |
| 473 | Ga0495671_0000007 | 3300046692 | Bacteria | 443069 |
| 474 | Ga0495671_0000012 | 3300046692 | Bacteria | 358632 |
| 475 | Ga0495671_0007760 | 3300046692 | Bacteria | 6080 |
| 476 | Ga0495600_0015371 | 3300046809 | Bacteria | 4839 |
| 477 | Ga0495660_0071088 | 3300046810 | Bacteria | 1846 |
| 478 | Ga0495672_0227828 | 3300047320 | Bacteria | 916 |
| 479 | Ga0495683_0131357 | 3300047323 | Bacteria | 1181 |
| 480 | Ga0495677_0045964 | 3300047445 | Bacteria | 1602 |
| 481 | Ga0495673_0000029 | 3300047469 | Bacteria | 471019 |
| 482 | Ga0495681_0000032 | 3300047470 | Bacteria | 127415 |
| 483 | Ga0495686_0000149 | 3300047472 | Bacteria | 135332 |
| 484 | Ga0495686_0008181 | 3300047472 | Bacteria | 7718 |
| 485 | Ga0495686_0008478 | 3300047472 | Bacteria | 7539 |
| 486 | Ga0495686_0009317 | 3300047472 | Bacteria | 7085 |
| 487 | Ga0495686_0022254 | 3300047472 | Bacteria | 4195 |
| 488 | Ga0495686_0093226 | 3300047472 | Bacteria | 1826 |
| 489 | Ga0495686_0098955 | 3300047472 | Bacteria | 1761 |
| 490 | Ga0495686_0246744 | 3300047472 | Bacteria | 1005 |
| 491 | Ga0496102_0000049 | 3300048905 | Bacteria | 179480 |
| 492 | Ga0496102_0123199 | 3300048905 | Bacteria | 2422 |
| 493 | Ga0496103_0000037 | 3300048906 | Bacteria | 179474 |
| 494 | Ga0496108_0018131 | 3300048911 | Bacteria | 5759 |
| 495 | Ga0496110_0069636 | 3300048913 | Bacteria | 3116 |
| 496 | Ga0496115_0019493 | 3300048918 | Bacteria | 5220 |
| 497 | Ga0496116_0000664 | 3300048919 | Bacteria | 44805 |
| 498 | Ga0496116_0059042 | 3300048919 | Bacteria | 2497 |
| 499 | Ga0496117_0000115 | 3300048920 | Bacteria | 179488 |
| 500 | Ga0496117_0048676 | 3300048920 | Bacteria | 3024 |
| 501 | Ga0496117_0066120 | 3300048920 | Bacteria | 2454 |
| 502 | Ga0496117_0084565 | 3300048920 | Bacteria | 2069 |
| 503 | Ga0496117_0111413 | 3300048920 | Bacteria | 1704 |
| 504 | Ga0496118_0000086 | 3300048921 | Bacteria | 179488 |
| 505 | Ga0496118_0024617 | 3300048921 | Bacteria | 5191 |
| 506 | Ga0496118_0038779 | 3300048921 | Bacteria | 3813 |
| 507 | Ga0496118_0067935 | 3300048921 | Bacteria | 2591 |
| 508 | Ga0496118_0117603 | 3300048921 | Bacteria | 1743 |
| 509 | Ga0496119_0026037 | 3300048922 | Bacteria | 4067 |
| 510 | Ga0496120_0043762 | 3300048923 | Bacteria | 2606 |
| 511 | Ga0496120_0056749 | 3300048923 | Bacteria | 2208 |
| 512 | Ga0496121_0000208 | 3300048924 | Bacteria | 129753 |
| 513 | Ga0496121_0000237 | 3300048924 | Bacteria | 118615 |
| 514 | Ga0496121_0006256 | 3300048924 | Bacteria | 14903 |
| 515 | Ga0496121_0010863 | 3300048924 | Bacteria | 10179 |
| 516 | Ga0496121_0021861 | 3300048924 | Bacteria | 6245 |
| 517 | Ga0496121_0356664 | 3300048924 | Bacteria | 972 |
| 518 | Ga0496122_0000970 | 3300048925 | Bacteria | 51487 |
| 519 | Ga0496122_0009733 | 3300048925 | Bacteria | 10045 |
| 520 | Ga0496122_0010014 | 3300048925 | Bacteria | 9863 |
| 521 | Ga0496122_0046575 | 3300048925 | Bacteria | 3357 |
| 522 | Ga0496122_0049081 | 3300048925 | Bacteria | 3238 |
| 523 | Ga0496123_0000286 | 3300048926 | Bacteria | 98752 |
| 524 | Ga0496123_0004476 | 3300048926 | Bacteria | 14656 |
| 525 | Ga0496123_0010752 | 3300048926 | Bacteria | 8036 |
| 526 | Ga0496123_0014617 | 3300048926 | Bacteria | 6490 |
| 527 | Ga0496123_0015139 | 3300048926 | Bacteria | 6347 |
| 528 | Ga0496124_0000102 | 3300048927 | Bacteria | 179488 |
| 529 | Ga0496124_0000510 | 3300048927 | Bacteria | 66863 |
| 530 | Ga0496124_0002035 | 3300048927 | Bacteria | 27471 |
| 531 | Ga0496124_0002045 | 3300048927 | Bacteria | 27415 |
| 532 | Ga0496124_0009343 | 3300048927 | Bacteria | 10103 |
| 533 | Ga0496124_0027789 | 3300048927 | Bacteria | 5069 |
| 534 | Ga0496124_0054093 | 3300048927 | Bacteria | 3399 |
| 535 | Ga0496124_0070937 | 3300048927 | Bacteria | 2889 |
| 536 | Ga0496124_0090087 | 3300048927 | Bacteria | 2503 |
| 537 | Ga0496124_0154889 | 3300048927 | Bacteria | 1793 |
| 538 | Ga0496125_0022011 | 3300048928 | Bacteria | 5928 |
| 539 | Ga0496125_0128582 | 3300048928 | Bacteria | 1789 |
| 540 | Ga0496126_0047987 | 3300048929 | Bacteria | 3907 |
| 541 | Ga0496126_0317127 | 3300048929 | Bacteria | 1282 |
| 542 | Ga0495678_029037 | 3300049459 | Bacteria | 2327 |
| 543 | Ga0495682_0052089 | 3300049460 | Bacteria | 1488 |
| 544 | Ga0501290_001795 | 3300049513 | Bacteria | 2851 |
| 545 | Ga0501290_005576 | 3300049513 | Bacteria | 1570 |
| 546 | Ga0501292_000008 | 3300049515 | Bacteria | 83748 |
| 547 | Ga0501294_001311 | 3300049517 | Bacteria | 2546 |
| 548 | Ga0501300_000363 | 3300049523 | Bacteria | 6905 |
| 549 | Ga0501335_000124 | 3300049551 | Bacteria | 3760 |
| 550 | Ga0501036_0612885 | 3300049572 | Bacteria | 902 |
| 551 | Ga0501223_000368 | 3300049663 | Bacteria | 11106 |
| 552 | Ga0501233_004089 | 3300049668 | Bacteria | 2655 |
| 553 | Ga0501235_000385 | 3300049669 | Bacteria | 8468 |
| 554 | Ga0501235_001136 | 3300049669 | Bacteria | 5577 |
| 555 | Ga0501236_021268 | 3300049670 | Bacteria | 960 |
| 556 | Ga0501257_001545 | 3300049686 | Bacteria | 4799 |
| 557 | Ga0501257_007205 | 3300049686 | Bacteria | 2483 |
| 558 | Ga0501259_000518 | 3300049688 | Bacteria | 6179 |
| 559 | Ga0501261_000020 | 3300049690 | Bacteria | 37889 |
| 560 | Ga0501225_0000786 | 3300049705 | Bacteria | 9925 |
| 561 | Ga0501279_000002 | 3300049775 | Bacteria | 205937 |
| 562 | Ga0501280_000010 | 3300049776 | Bacteria | 63153 |
| 563 | Ga0501280_004171 | 3300049776 | Bacteria | 2145 |
| 564 | Ga0501282_000295 | 3300049778 | Bacteria | 6018 |
| 565 | Ga0501283_001354 | 3300049779 | Bacteria | 3202 |
| 566 | nmdc:mga03n38_46054_c1 | 3300050490 | Bacteria | 1923 |
| 567 | nmdc:mga06z11_27_c1 | 3300050494 | Bacteria | 64010 |
| 568 | nmdc:mga04h51_147_c1 | 3300050495 | Bacteria | 20575 |
| 569 | nmdc:mga07m45_138208_c1 | 3300050496 | Bacteria | 1411 |
| 570 | nmdc:mga07m45_18564_c1 | 3300050496 | Bacteria | 3757 |
| 571 | Ga0500643_000081 | 3300053087 | Bacteria | 101681 |
| 572 | Ga0500643_000306 | 3300053087 | Bacteria | 40712 |
| 573 | Ga0500643_011202 | 3300053087 | Bacteria | 3285 |
| 574 | Ga0500643_024242 | 3300053087 | Bacteria | 1928 |
| 575 | Ga0500555_000444 | 3300053103 | Bacteria | 17141 |
| 576 | Ga0500556_0000074 | 3300053104 | Bacteria | 98799 |
| 577 | Ga0500562_024231 | 3300053108 | Bacteria | 1586 |
| 578 | Ga0500594_0024835 | 3300053118 | Bacteria | 1530 |
| 579 | Ga0500595_004504 | 3300053119 | Bacteria | 6234 |
| 580 | Ga0500597_018671 | 3300053120 | Bacteria | 2693 |
| 581 | Ga0500608_007974 | 3300053122 | Bacteria | 4419 |
| 582 | Ga0500608_026077 | 3300053122 | Bacteria | 2742 |
| 583 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 584 | Ga0500642_0000116 | 3300053130 | Bacteria | 37194 |
| 585 | Ga0500559_0068599 | 3300053136 | Bacteria | 1593 |
| 586 | Ga0500573_0000046 | 3300053140 | Bacteria | 98723 |
| 587 | Ga0500573_0245911 | 3300053140 | Bacteria | 925 |
| 588 | Ga0500616_0007580 | 3300053153 | Bacteria | 6865 |
| 589 | Ga0500624_000044 | 3300053157 | Bacteria | 90094 |
| 590 | Ga0500624_000053 | 3300053157 | Bacteria | 74086 |
| 591 | Ga0500627_0002055 | 3300053158 | Bacteria | 5826 |
| 592 | Ga0500636_0028474 | 3300053177 | Bacteria | 3299 |
| 593 | Ga0500637_0000008 | 3300053178 | Bacteria | 89244 |
| 594 | Ga0500645_000009 | 3300053730 | Bacteria | 206177 |
| 595 | Ga0500645_000439 | 3300053730 | Bacteria | 28425 |
| 596 | Ga0500596_002809 | 3300053735 | Bacteria | 3401 |
| 597 | Ga0500661_000082 | 3300055283 | Bacteria | 14988 |
| 598 | Ga0466962_0008633 | 3300061719 | Bacteria | 4885 |
| 599 | Ga0466962_0158351 | 3300061719 | Bacteria | 1100 |
| 600 | Ga0466962_0182140 | 3300061719 | Bacteria | 1024 |
| 601 | 2512644701 | 2512564014 | Bacteria | 4639632 |
| 602 | 2600226338 | 2599185359 | Bacteria | 4772316 |
| 603 | 2643950309 | 2643221588 | Bacteria | 3692460 |
| 604 | 2778123872 | 2775507255 | Bacteria | 3945731 |
| 605 | 2809062205 | 2808606401 | Bacteria | 4586670 |
| 606 | 2809078455 | 2808606404 | Bacteria | 4652788 |
| 607 | 2809082594 | 2808606405 | Bacteria | 4586632 |
| 608 | 2819712418 | 2818991466 | Bacteria | 4748179 |
| 609 | 2830077902 | 2830075706 | Bacteria | 3855215 |
| 610 | 2848299367 | 2848297114 | Bacteria | 3608511 |
| 611 | 2880518988 | 2880518877 | Bacteria | 5012590 |
| 612 | 2896186827 | 2896184354 | Bacteria | 3258548 |
| 613 | 2896254590 | 2896253425 | Bacteria | 3418029 |
| 614 | 2919711732 | 2919709256 | Bacteria | 4318106 |
| 615 | 2928526928 | 2928526807 | Bacteria | 4760224 |
| 616 | 2928969467 | 2928968154 | Bacteria | 4633371 |
| 617 | 8057101752 | 8057101203 | Bacteria | 5034064 |
| 618 | Ga0055542_1004132 | |||
| 619 | SwRhRL2b_contig_2794509 | |||
| 620 | JGI24741J21665_1005221 | |||
| 621 | JGI24752J21851_1001572 | |||
| 622 | JGI24740J21852_10001016 | |||
| 623 | JGI24740J21852_10012988 | |||
| 624 | JGI24739J22299_10001067 | |||
| 625 | JGI24739J22299_10003139 | |||
| 626 | JGI24739J22299_10012763 | |||
| 627 | JGI24739J22299_10038747 | |||
| 628 | JGI24737J22298_10004452 | |||
| 629 | JGI24737J22298_10005014 | |||
| 630 | JGI24737J22298_10050336 | |||
| 631 | JGI24735J21928_10004189 | |||
| 632 | JGI24735J21928_10004916 | |||
| 633 | JGI24735J21928_10007068 | |||
| 634 | JGI24735J21928_10019301 | |||
| 635 | JGI24750J21931_1010742 | |||
| 636 | JGI24738J21930_10000464 | |||
| 637 | JGI24738J21930_10002688 | |||
| 638 | JGI24751J29686_10007032 | |||
| 639 | JGI25150J39212_1000213 | |||
| 640 | JGI25165J46597_1000112 | |||
| 641 | JGI25153J46596_10000036 | |||
| 642 | rootH1_10111877 | |||
| 643 | rootL2_10227911 | |||
| 644 | Ga0055526_1000948 | |||
| 645 | Ga0055526_1040803 | |||
| 646 | Ga0055536_1013054 | |||
| 647 | Ga0055540_1001281 | |||
| 648 | JGI25405J52794_10003443 | |||
| 649 | Ga0065165_1077603 | |||
| 650 | Ga0065704_10072077 | |||
| 651 | Ga0070658_10000896 | |||
| 652 | Ga0070658_10005034 | |||
| 653 | Ga0070658_10006492 | |||
| 654 | Ga0070658_10081915 | |||
| 655 | Ga0070676_10000257 | |||
| 656 | Ga0070670_100042123 | |||
| 657 | Ga0068869_100004094 | |||
| 658 | Ga0070666_10000063 | |||
| 659 | Ga0068868_100000023 | |||
| 660 | Ga0070660_100000395 | |||
| 661 | Ga0070660_100049125 | |||
| 662 | Ga0070660_100084076 | |||
| 663 | Ga0070660_100217734 | |||
| 664 | Ga0070661_100036450 | |||
| 665 | Ga0070661_100042406 | |||
| 666 | Ga0070661_100123609 | |||
| 667 | Ga0070668_100000739 | |||
| 668 | Ga0070668_100013413 | |||
| 669 | Ga0070668_100088273 | |||
| 670 | Ga0070669_100000042 | |||
| 671 | Ga0070671_100000002 | |||
| 672 | Ga0070671_100043899 | |||
| 673 | Ga0070671_100162503 | |||
| 674 | Ga0070671_100182742 | |||
| 675 | Ga0070674_100068398 | |||
| 676 | Ga0070673_100000001 | |||
| 677 | Ga0070673_100335412 | |||
| 678 | Ga0070659_100017522 | |||
| 679 | Ga0070659_100021216 | |||
| 680 | Ga0070659_100056093 | |||
| 681 | Ga0070659_100137208 | |||
| 682 | Ga0070667_100000016 | |||
| 683 | Ga0070667_100000162 | |||
| 684 | Ga0070667_100035266 | |||
| 685 | Ga0070714_100262029 | |||
| 686 | Ga0070663_100012272 | |||
| 687 | Ga0070663_100013894 | |||
| 688 | Ga0070662_100002436 | |||
| 689 | Ga0070662_100009003 | |||
| 690 | Ga0070662_100039173 | |||
| 691 | Ga0070662_100067495 | |||
| 692 | Ga0070662_100206618 | |||
| 693 | Ga0068867_100000387 | |||
| 694 | Ga0070679_100008282 | |||
| 695 | Ga0070679_100274033 | |||
| 696 | Ga0070684_100042855 | |||
| 697 | Ga0068853_100013579 | |||
| 698 | Ga0068853_100018932 | |||
| 699 | Ga0068853_100209603 | |||
| 700 | Ga0068853_100364157 | |||
| 701 | Ga0070672_100093513 | |||
| 702 | Ga0070686_100160416 | |||
| 703 | Ga0070665_100000186 | |||
| 704 | Ga0070665_100105320 | |||
| 705 | Ga0068855_100000092 | |||
| 706 | Ga0068855_100008444 | |||
| 707 | Ga0068855_100014816 | |||
| 708 | Ga0068855_100034440 | |||
| 709 | Ga0068855_100144960 | |||
| 710 | Ga0068855_100299424 | |||
| 711 | Ga0070664_100011340 | |||
| 712 | Ga0070664_100013946 | |||
| 713 | Ga0070664_100025320 | |||
| 714 | Ga0070664_100255870 | |||
| 715 | Ga0068857_100051510 | |||
| 716 | Ga0068857_100056170 | |||
| 717 | Ga0068857_100283789 | |||
| 718 | Ga0068857_100502939 | |||
| 719 | Ga0068854_100001764 | |||
| 720 | Ga0068854_100013863 | |||
| 721 | Ga0068854_100019275 | |||
| 722 | Ga0068854_100114825 | |||
| 723 | Ga0068856_100011968 | |||
| 724 | Ga0068856_100033420 | |||
| 725 | Ga0068856_100322377 | |||
| 726 | Ga0068852_100001030 | |||
| 727 | Ga0068852_100080343 | |||
| 728 | Ga0068852_100538086 | |||
| 729 | Ga0068852_100722711 | |||
| 730 | Ga0068859_100002597 | |||
| 731 | Ga0068864_100000731 | |||
| 732 | Ga0068864_100537051 | |||
| 733 | Ga0068866_10042187 | |||
| 734 | Ga0068861_100000148 | |||
| 735 | Ga0068851_10011304 | |||
| 736 | Ga0068851_10012072 | |||
| 737 | Ga0068863_100000047 | |||
| 738 | Ga0068863_100003767 | |||
| 739 | Ga0068863_100010486 | |||
| 740 | Ga0068863_100014281 | |||
| 741 | Ga0068858_100000588 | |||
| 742 | Ga0068858_100003492 | |||
| 743 | Ga0068860_100000196 | |||
| 744 | Ga0068860_100008267 | |||
| 745 | Ga0068860_100023270 | |||
| 746 | Ga0068860_100036289 | |||
| 747 | Ga0068862_100000063 | |||
| 748 | Ga0068862_100007384 | |||
| 749 | Ga0068862_100924121 | |||
| 750 | Ga0081455_10002546 | |||
| 751 | Ga0075368_10000252 | |||
| 752 | Ga0075363_100052875 | |||
| 753 | Ga0075367_10000054 | |||
| 754 | Ga0097621_100031374 | |||
| 755 | Ga0097621_100190058 | |||
| 756 | Ga0075370_10006098 | |||
| 757 | Ga0075370_10037579 | |||
| 758 | Ga0068871_100185845 | |||
| 759 | Ga0068865_100000072 | |||
| 760 | Ga0068865_100279800 | |||
| 761 | Ga0097620_100002597 | |||
| 762 | Ga0097620_100011775 | |||
| 763 | Ga0105251_10015352 | |||
| 764 | Ga0105240_10000959 | |||
| 765 | Ga0105240_10004825 | |||
| 766 | Ga0105240_10043982 | |||
| 767 | Ga0105240_10055391 | |||
| 768 | Ga0105240_10056021 | |||
| 769 | Ga0105245_10000991 | |||
| 770 | Ga0105245_10001709 | |||
| 771 | Ga0105247_10001115 | |||
| 772 | Ga0105247_10063313 | |||
| 773 | Ga0105243_10000737 | |||
| 774 | Ga0105243_10047869 | |||
| 775 | Ga0105243_10129062 | |||
| 776 | Ga0105241_10002409 | |||
| 777 | Ga0105241_10030503 | |||
| 778 | Ga0105241_10446330 | |||
| 779 | Ga0105242_10000178 | |||
| 780 | Ga0105248_10019155 | |||
| 781 | Ga0105237_10001281 | |||
| 782 | Ga0105237_10007067 | |||
| 783 | Ga0105237_10016910 | |||
| 784 | Ga0105237_10104848 | |||
| 785 | Ga0105237_10233537 | |||
| 786 | Ga0105238_10017266 | |||
| 787 | Ga0105238_10092272 | |||
| 788 | Ga0105238_10210877 | |||
| 789 | Ga0105249_10129922 | |||
| 790 | Ga0105249_10321312 | |||
| 791 | Ga0105239_10000156 | |||
| 792 | Ga0105239_10027427 | |||
| 793 | Ga0105246_10000632 | |||
| 794 | Ga0105246_10003219 | |||
| 795 | Ga0157373_10003358 | |||
| 796 | Ga0157373_10024990 | |||
| 797 | Ga0157373_10066548 | |||
| 798 | Ga0157373_10119605 | |||
| 799 | Ga0157371_10000030 | |||
| 800 | Ga0157371_10003665 | |||
| 801 | Ga0157371_10148248 | |||
| 802 | Ga0157370_10000213 | |||
| 803 | Ga0157370_10008634 | |||
| 804 | Ga0157370_10027202 | |||
| 805 | Ga0157370_10031556 | |||
| 806 | Ga0157369_10030780 | |||
| 807 | Ga0157369_10049579 | |||
| 808 | Ga0157369_10374014 | |||
| 809 | Ga0157369_10536632 | |||
| 810 | Ga0157374_10005847 | |||
| 811 | Ga0157374_10026073 | |||
| 812 | Ga0157374_10399118 | |||
| 813 | Ga0157378_10017190 | |||
| 814 | Ga0157378_10376366 | |||
| 815 | Ga0163162_10025996 | |||
| 816 | Ga0163162_10305216 | |||
| 817 | Ga0157372_10005904 | |||
| 818 | Ga0157372_10064731 | |||
| 819 | Ga0157372_10148749 | |||
| 820 | Ga0157372_10215277 | |||
| 821 | Ga0157372_10321430 | |||
| 822 | Ga0157372_10597749 | |||
| 823 | Ga0157375_10009597 | |||
| 824 | Ga0157375_10648450 | |||
| 825 | Ga0157380_10259177 | |||
| 826 | Ga0157377_10008193 | |||
| 827 | Ga0157376_10000287 | |||
| 828 | Ga0183363_1005 | |||
| 829 | Ga0163161_10033177 | |||
| 830 | Ga0206356_10706515 | |||
| 831 | Ga0213875_10000229 | |||
| 832 | Ga0213875_10091761 | |||
| 833 | Ga0209147_100491 | |||
| 834 | Ga0209563_100047 | |||
| 835 | Ga0207425_1000037 | |||
| 836 | Ga0209148_1000133 | |||
| 837 | Ga0209148_1001220 | |||
| 838 | Ga0209129_1000363 | |||
| 839 | Ga0209233_1000078 | |||
| 840 | Ga0209565_1000427 | |||
| 841 | Ga0209455_1014725 | |||
| 842 | Ga0209676_1002287 | |||
| 843 | Ga0209676_1010356 | |||
| 844 | Ga0209025_1000117 | |||
| 845 | Ga0209564_1003622 | |||
| 846 | Ga0209564_1005290 | |||
| 847 | Ga0209758_1000103 | |||
| 848 | Ga0209758_1029405 | |||
| 849 | Ga0209050_1000001 | |||
| 850 | Ga0209050_1004951 | |||
| 851 | Ga0209050_1014423 | |||
| 852 | Ga0207426_1009119 | |||
| 853 | Ga0209051_1003509 | |||
| 854 | Ga0209257_1005036 | |||
| 855 | Ga0209257_1005111 | |||
| 856 | Ga0207697_10000130 | |||
| 857 | Ga0207656_10008971 | |||
| 858 | Ga0207642_10032946 | |||
| 859 | Ga0207710_10008193 | |||
| 860 | Ga0207710_10033001 | |||
| 861 | Ga0207688_10132857 | |||
| 862 | Ga0207680_10000033 | |||
| 863 | Ga0207647_10001366 | |||
| 864 | Ga0207647_10005723 | |||
| 865 | Ga0207647_10008063 | |||
| 866 | Ga0207647_10123078 | |||
| 867 | Ga0207645_10000520 | |||
| 868 | Ga0207645_10030776 | |||
| 869 | Ga0207705_10000018 | |||
| 870 | Ga0207705_10000163 | |||
| 871 | Ga0207705_10001877 | |||
| 872 | Ga0207705_10009458 | |||
| 873 | Ga0207705_10277494 | |||
| 874 | Ga0207654_10000852 | |||
| 875 | Ga0207707_10026421 | |||
| 876 | Ga0207707_10079378 | |||
| 877 | Ga0207695_10000521 | |||
| 878 | Ga0207695_10003499 | |||
| 879 | Ga0207695_10015077 | |||
| 880 | Ga0207695_10029492 | |||
| 881 | Ga0207695_10136608 | |||
| 882 | Ga0207671_10000607 | |||
| 883 | Ga0207671_10023761 | |||
| 884 | Ga0207671_10028062 | |||
| 885 | Ga0207660_10089146 | |||
| 886 | Ga0207657_10000408 | |||
| 887 | Ga0207657_10012810 | |||
| 888 | Ga0207657_10016065 | |||
| 889 | Ga0207657_10058219 | |||
| 890 | Ga0207657_10138453 | |||
| 891 | Ga0207657_10160254 | |||
| 892 | Ga0207657_10489385 | |||
| 893 | Ga0207649_10000199 | |||
| 894 | Ga0207649_10005456 | |||
| 895 | Ga0207649_10112409 | |||
| 896 | Ga0207652_10251142 | |||
| 897 | Ga0207652_10328239 | |||
| 898 | Ga0207652_10342710 | |||
| 899 | Ga0207681_10000002 | |||
| 900 | Ga0207694_10004278 | |||
| 901 | Ga0207694_10057818 | |||
| 902 | Ga0207694_10153631 | |||
| 903 | Ga0207650_10097313 | |||
| 904 | Ga0207659_10297651 | |||
| 905 | Ga0207687_10002396 | |||
| 906 | Ga0207687_10009517 | |||
| 907 | Ga0207664_10284302 | |||
| 908 | Ga0207644_10000002 | |||
| 909 | Ga0207644_10031668 | |||
| 910 | Ga0207690_10003817 | |||
| 911 | Ga0207690_10013220 | |||
| 912 | Ga0207690_10049134 | |||
| 913 | Ga0207706_10004237 | |||
| 914 | Ga0207706_10005782 | |||
| 915 | Ga0207706_10016251 | |||
| 916 | Ga0207706_10017165 | |||
| 917 | Ga0207706_10029979 | |||
| 918 | Ga0207706_10036693 | |||
| 919 | Ga0207706_10055843 | |||
| 920 | Ga0207706_10060294 | |||
| 921 | Ga0207686_10001920 | |||
| 922 | Ga0207709_10000432 | |||
| 923 | Ga0207709_10096414 | |||
| 924 | Ga0207704_10000032 | |||
| 925 | Ga0207704_10179440 | |||
| 926 | Ga0207691_10073708 | |||
| 927 | Ga0207711_10029217 | |||
| 928 | Ga0207689_10008114 | |||
| 929 | Ga0207661_10120942 | |||
| 930 | Ga0207667_10000013 | |||
| 931 | Ga0207667_10007430 | |||
| 932 | Ga0207667_10047477 | |||
| 933 | Ga0207667_10088539 | |||
| 934 | Ga0207667_10266992 | |||
| 935 | Ga0207651_10000001 | |||
| 936 | Ga0207712_10000069 | |||
| 937 | Ga0207712_10001860 | |||
| 938 | Ga0207640_10000050 | |||
| 939 | Ga0207640_10084174 | |||
| 940 | Ga0207640_10109461 | |||
| 941 | Ga0207640_10192816 | |||
| 942 | Ga0207640_10278503 | |||
| 943 | Ga0207658_10000075 | |||
| 944 | Ga0207658_10017969 | |||
| 945 | Ga0207677_10001163 | |||
| 946 | Ga0207703_10001509 | |||
| 947 | Ga0207639_10000138 | |||
| 948 | Ga0207639_10003659 | |||
| 949 | Ga0207639_10005117 | |||
| 950 | Ga0207639_10038650 | |||
| 951 | Ga0207639_10205081 | |||
| 952 | Ga0207678_10002459 | |||
| 953 | Ga0207678_10003700 | |||
| 954 | Ga0207678_10021977 | |||
| 955 | Ga0207702_10010000 | |||
| 956 | Ga0207702_10010202 | |||
| 957 | Ga0207702_10012601 | |||
| 958 | Ga0207702_10022803 | |||
| 959 | Ga0207702_10114116 | |||
| 960 | Ga0207641_10000973 | |||
| 961 | Ga0207641_10001660 | |||
| 962 | Ga0207641_10019831 | |||
| 963 | Ga0207648_10001195 | |||
| 964 | Ga0207676_10000705 | |||
| 965 | Ga0207676_10653108 | |||
| 966 | Ga0207674_10003143 | |||
| 967 | Ga0207674_10006416 | |||
| 968 | Ga0207674_10018492 | |||
| 969 | Ga0207674_10059376 | |||
| 970 | Ga0207674_10063616 | |||
| 971 | Ga0207674_10088996 | |||
| 972 | Ga0207674_10732169 | |||
| 973 | Ga0207675_100000355 | |||
| 974 | Ga0207683_10004967 | |||
| 975 | Ga0207683_10268557 | |||
| 976 | Ga0207698_10000551 | |||
| 977 | Ga0207698_10033092 | |||
| 978 | Ga0207698_10174385 | |||
| 979 | Ga0207698_10179648 | |||
| 980 | Ga0209813_10000063 | |||
| 981 | Ga0268266_10000002 | |||
| 982 | Ga0268265_10000055 | |||
| 983 | Ga0268265_10000361 | |||
| 984 | Ga0268265_10892249 | |||
| 985 | Ga0268264_10000087 | |||
| 986 | Ga0268264_10000116 | |||
| 987 | Ga0268264_10000381 | |||
| 988 | Ga0307517_10019763 | |||
| 989 | Ga0307517_10082933 | |||
| 990 | Ga0307408_100024384 | |||
| 991 | Ga0307413_10033283 | |||
| 992 | Ga0307410_10093588 | |||
| 993 | Ga0307410_10125478 | |||
| 994 | Ga0307406_10101318 | |||
| 995 | Ga0307406_10179361 | |||
| 996 | Ga0307412_10000950 | |||
| 997 | Ga0307412_10023565 | |||
| 998 | Ga0307412_10086127 | |||
| 999 | Ga0307412_10186843 | |||
| 1000 | Ga0307409_100135470 | |||
| 1001 | Ga0307409_100412705 | |||
| 1002 | Ga0307409_100736415 | |||
| 1003 | Ga0307416_100018666 | |||
| 1004 | Ga0307414_10001891 | |||
| 1005 | Ga0307414_10112675 | |||
| 1006 | Ga0307414_10320199 | |||
| 1007 | Ga0307411_10067422 | |||
| 1008 | Ga0307411_10551386 | |||
| 1009 | Ga0373923_0046343 | |||
| 1010 | Ga0316584_0116543 | |||
| 1011 | Ga0395899_0002292 | |||
| 1012 | Ga0395900_0021625 | |||
| 1013 | Ga0395900_0179985 | |||
| 1014 | Ga0395905_0016001 | |||
| 1015 | Ga0395905_0030594 | |||
| 1016 | Ga0395905_0148075 | |||
| 1017 | Ga0395905_0584614 | |||
| 1018 | Ga0395905_0726545 | |||
| 1019 | Ga0436364_0413697 | |||
| 1020 | Ga0436364_0530420 | |||
| 1021 | Ga0436365_1704067 | |||
| 1022 | Ga0451793_1365563 | |||
| 1023 | Ga0451802_1527592 | |||
| 1024 | Ga0451806_292367 | |||
| 1025 | Ga0451807_2051197 | |||
| 1026 | Ga0439448_0022377 | |||
| 1027 | Ga0439455_0000137 | |||
| 1028 | Ga0439458_0000756 | |||
| 1029 | Ga0439458_0012507 | |||
| 1030 | Ga0439458_0037728 | |||
| 1031 | Ga0466972_0010998 | |||
| 1032 | Ga0466972_0019619 | |||
| 1033 | Ga0466965_0069761 | |||
| 1034 | Ga0466961_0002427 | |||
| 1035 | Ga0466961_0151817 | |||
| 1036 | Ga0466970_0010891 | |||
| 1037 | Ga0466957_0086515 | |||
| 1038 | Ga0466957_0131832 | |||
| 1039 | Ga0466960_0002678 | |||
| 1040 | Ga0466959_0000595 | |||
| 1041 | Ga0466958_0090108 | |||
| 1042 | Ga0466958_0095266 | |||
| 1043 | Ga0495617_035157 | |||
| 1044 | Ga0495627_000193 | |||
| 1045 | Ga0495627_000478 | |||
| 1046 | Ga0495638_0000011 | |||
| 1047 | Ga0495650_0000373 | |||
| 1048 | Ga0495650_0006527 | |||
| 1049 | Ga0495650_0049726 | |||
| 1050 | Ga0495584_0074512 | |||
| 1051 | Ga0495583_0000305 | |||
| 1052 | Ga0495583_0002224 | |||
| 1053 | Ga0495583_0011527 | |||
| 1054 | Ga0495583_0063366 | |||
| 1055 | Ga0495606_0000591 | |||
| 1056 | Ga0495606_0008930 | |||
| 1057 | Ga0495606_0149671 | |||
| 1058 | Ga0495610_0001092 | |||
| 1059 | Ga0495616_0000018 | |||
| 1060 | Ga0495631_0026785 | |||
| 1061 | Ga0495632_0000042 | |||
| 1062 | Ga0495632_0000538 | |||
| 1063 | Ga0495637_0000626 | |||
| 1064 | Ga0495637_0019775 | |||
| 1065 | Ga0495637_0020613 | |||
| 1066 | Ga0495643_0000005 | |||
| 1067 | Ga0495648_0000023 | |||
| 1068 | Ga0495648_0000115 | |||
| 1069 | Ga0495648_0009282 | |||
| 1070 | Ga0495663_0000015 | |||
| 1071 | Ga0495663_0004526 | |||
| 1072 | Ga0495587_0195933 | |||
| 1073 | Ga0495622_0006174 | |||
| 1074 | Ga0495633_0000197 | |||
| 1075 | Ga0495633_0000262 | |||
| 1076 | Ga0495633_0002581 | |||
| 1077 | Ga0495633_0011568 | |||
| 1078 | Ga0495633_0038543 | |||
| 1079 | Ga0495633_0044808 | |||
| 1080 | Ga0495668_0014245 | |||
| 1081 | Ga0495668_0173497 | |||
| 1082 | Ga0495611_0044505 | |||
| 1083 | Ga0495611_0111175 | |||
| 1084 | Ga0495625_0000959 | |||
| 1085 | Ga0495625_0003788 | |||
| 1086 | Ga0495625_0133328 | |||
| 1087 | Ga0495625_0165586 | |||
| 1088 | Ga0495661_0101759 | |||
| 1089 | Ga0495669_0000268 | |||
| 1090 | Ga0495671_0000007 | |||
| 1091 | Ga0495671_0000012 | |||
| 1092 | Ga0495671_0007760 | |||
| 1093 | Ga0495600_0015371 | |||
| 1094 | Ga0495660_0071088 | |||
| 1095 | Ga0495672_0227828 | |||
| 1096 | Ga0495683_0131357 | |||
| 1097 | Ga0495677_0045964 | |||
| 1098 | Ga0495673_0000029 | |||
| 1099 | Ga0495681_0000032 | |||
| 1100 | Ga0495686_0000149 | |||
| 1101 | Ga0495686_0008181 | |||
| 1102 | Ga0495686_0008478 | |||
| 1103 | Ga0495686_0009317 | |||
| 1104 | Ga0495686_0022254 | |||
| 1105 | Ga0495686_0093226 | |||
| 1106 | Ga0495686_0098955 | |||
| 1107 | Ga0495686_0246744 | |||
| 1108 | Ga0496102_0000049 | |||
| 1109 | Ga0496102_0123199 | |||
| 1110 | Ga0496103_0000037 | |||
| 1111 | Ga0496108_0018131 | |||
| 1112 | Ga0496110_0069636 | |||
| 1113 | Ga0496115_0019493 | |||
| 1114 | Ga0496116_0000664 | |||
| 1115 | Ga0496116_0059042 | |||
| 1116 | Ga0496117_0000115 | |||
| 1117 | Ga0496117_0048676 | |||
| 1118 | Ga0496117_0066120 | |||
| 1119 | Ga0496117_0084565 | |||
| 1120 | Ga0496117_0111413 | |||
| 1121 | Ga0496118_0000086 | |||
| 1122 | Ga0496118_0024617 | |||
| 1123 | Ga0496118_0038779 | |||
| 1124 | Ga0496118_0067935 | |||
| 1125 | Ga0496118_0117603 | |||
| 1126 | Ga0496119_0026037 | |||
| 1127 | Ga0496120_0043762 | |||
| 1128 | Ga0496120_0056749 | |||
| 1129 | Ga0496121_0000208 | |||
| 1130 | Ga0496121_0000237 | |||
| 1131 | Ga0496121_0006256 | |||
| 1132 | Ga0496121_0010863 | |||
| 1133 | Ga0496121_0021861 | |||
| 1134 | Ga0496121_0356664 | |||
| 1135 | Ga0496122_0000970 | |||
| 1136 | Ga0496122_0009733 | |||
| 1137 | Ga0496122_0010014 | |||
| 1138 | Ga0496122_0046575 | |||
| 1139 | Ga0496122_0049081 | |||
| 1140 | Ga0496123_0000286 | |||
| 1141 | Ga0496123_0004476 | |||
| 1142 | Ga0496123_0010752 | |||
| 1143 | Ga0496123_0014617 | |||
| 1144 | Ga0496123_0015139 | |||
| 1145 | Ga0496124_0000102 | |||
| 1146 | Ga0496124_0000510 | |||
| 1147 | Ga0496124_0002035 | |||
| 1148 | Ga0496124_0002045 | |||
| 1149 | Ga0496124_0009343 | |||
| 1150 | Ga0496124_0027789 | |||
| 1151 | Ga0496124_0054093 | |||
| 1152 | Ga0496124_0070937 | |||
| 1153 | Ga0496124_0090087 | |||
| 1154 | Ga0496124_0154889 | |||
| 1155 | Ga0496125_0022011 | |||
| 1156 | Ga0496125_0128582 | |||
| 1157 | Ga0496126_0047987 | |||
| 1158 | Ga0496126_0317127 | |||
| 1159 | Ga0495678_029037 | |||
| 1160 | Ga0495682_0052089 | |||
| 1161 | Ga0501290_001795 | |||
| 1162 | Ga0501290_005576 | |||
| 1163 | Ga0501292_000008 | |||
| 1164 | Ga0501294_001311 | |||
| 1165 | Ga0501300_000363 | |||
| 1166 | Ga0501335_000124 | |||
| 1167 | Ga0501036_0612885 | |||
| 1168 | Ga0501223_000368 | |||
| 1169 | Ga0501233_004089 | |||
| 1170 | Ga0501235_000385 | |||
| 1171 | Ga0501235_001136 | |||
| 1172 | Ga0501236_021268 | |||
| 1173 | Ga0501257_001545 | |||
| 1174 | Ga0501257_007205 | |||
| 1175 | Ga0501259_000518 | |||
| 1176 | Ga0501261_000020 | |||
| 1177 | Ga0501225_0000786 | |||
| 1178 | Ga0501279_000002 | |||
| 1179 | Ga0501280_000010 | |||
| 1180 | Ga0501280_004171 | |||
| 1181 | Ga0501282_000295 | |||
| 1182 | Ga0501283_001354 | |||
| 1183 | nmdc:mga03n38_46054_c1 | |||
| 1184 | nmdc:mga06z11_27_c1 | |||
| 1185 | nmdc:mga04h51_147_c1 | |||
| 1186 | nmdc:mga07m45_138208_c1 | |||
| 1187 | nmdc:mga07m45_18564_c1 | |||
| 1188 | Ga0500643_000081 | |||
| 1189 | Ga0500643_000306 | |||
| 1190 | Ga0500643_011202 | |||
| 1191 | Ga0500643_024242 | |||
| 1192 | Ga0500555_000444 | |||
| 1193 | Ga0500556_0000074 | |||
| 1194 | Ga0500562_024231 | |||
| 1195 | Ga0500594_0024835 | |||
| 1196 | Ga0500595_004504 | |||
| 1197 | Ga0500597_018671 | |||
| 1198 | Ga0500608_007974 | |||
| 1199 | Ga0500608_026077 | |||
| 1200 | Ga0500642_0000002 | |||
| 1201 | Ga0500642_0000116 | |||
| 1202 | Ga0500559_0068599 | |||
| 1203 | Ga0500573_0000046 | |||
| 1204 | Ga0500573_0245911 | |||
| 1205 | Ga0500616_0007580 | |||
| 1206 | Ga0500624_000044 | |||
| 1207 | Ga0500624_000053 | |||
| 1208 | Ga0500627_0002055 | |||
| 1209 | Ga0500636_0028474 | |||
| 1210 | Ga0500637_0000008 | |||
| 1211 | Ga0500645_000009 | |||
| 1212 | Ga0500645_000439 | |||
| 1213 | Ga0500596_002809 | |||
| 1214 | Ga0500661_000082 | |||
| 1215 | Ga0466962_0008633 | |||
| 1216 | Ga0466962_0158351 | |||
| 1217 | Ga0466962_0182140 | |||
| 1218 | 2512644701 | |||
| 1219 | 2600226338 | |||
| 1220 | 2643950309 | |||
| 1221 | 2778123872 | |||
| 1222 | 2809062205 | |||
| 1223 | 2809078455 | |||
| 1224 | 2809082594 | |||
| 1225 | 2819712418 | |||
| 1226 | 2830077902 | |||
| 1227 | 2848299367 | |||
| 1228 | 2880518988 | |||
| 1229 | 2896186827 | |||
| 1230 | 2896254590 | |||
| 1231 | 2919711732 | |||
| 1232 | 2928526928 | |||
| 1233 | 2928969467 | |||
| 1234 | 8057101752 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lhs-assembly2.cif.gz_B | crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps | 0.8819 | 19 | 220 |
| 7lhu-assembly1.cif.gz_A | crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp | 0.8752 | 19 | 218 |
| 2goy-assembly2.cif.gz_E | crystal structure of assimilatory adenosine 5'-phosphosulfate reductase with bound aps | 0.8737 | 17 | 230 |
| 7lhu-assembly2.cif.gz_B | crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp | 0.8723 | 19 | 220 |
| 1sur-assembly1.cif.gz_A-2 | phospho-adenylyl-sulfate reductase | 0.8667 | 17 | 212 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2goyE00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8737 | 17 | 230 | 3.40.50.620 |
| af_P17854_2_216_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8684 | 17 | 212 | 3.40.50.620 |
| af_P9WIK3_10_254_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8526 | 19 | 243 | 3.40.50.620 |
| 2goyE00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8407 | 17 | 230 | 3.40.50.620 |
| 2oq2D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.818 | 17 | 239 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5R2N3D8-F1-model_v4 | Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) | 0.9533 | 62 | 224 |
GO:0004604
GO:0005737 GO:0019379 |
| AF-A0A436FC25-F1-model_v4 | deleted | 0.9442 | 19 | 220 |
|
| AF-A0A5R2N3D8-F1-model_v4 | Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) | 0.9365 | 62 | 224 |
GO:0004604
GO:0005737 GO:0019379 |
| AF-A0A3D2F615-F1-model_v4 | Phosphoadenylyl-sulfate reductase | 0.9314 | 19 | 225 |
GO:0004604
GO:0005737 GO:0019379 |
| AF-A0A2A4LKB0-F1-model_v4 | Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) | 0.9309 | 18 | 240 |
GO:0004604
GO:0005737 GO:0019379 GO:0043866 GO:0046872 GO:0051539 GO:0070814 |