F469607

General Info

Members Datasets Scaffolds Average Seq Length
617 311 1234 257

Family's Representative Sequence

Representative Sequence 3300003762|Ga0055542_1004132|Ga0055542_10041322
Length 302
Sequence MAERLFDKTGSSPLPRPTSRSRVILSGGWAGERAGTAPGKRSSVLSQTGSEAARKLDTIDVRPAFTQAEVDALNARFAGVETLPMLRALFADNILGETAVVSSFGTESAVLLDLISRVAPNTPVVFVDTLKMFPETLAYRDALLDRLGMHNRRTITPNSEVIAAKDATGLRWSYDPDGCCAIRKVEPIARAKQGLDSWFSGRKAFQSQTRANLPRFELEDGRLKVNPLGDWAKDDLDAYFAERDLPRHPLEAEGYLSIGCSPCTSKVMPGEDPRAGRWRGWDKVECGIHTPVDGPSEDDPIF

Samples

Sample ID Description Type Environment
1 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
189 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
190 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
193 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
194 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
204 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
211 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
215 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
231 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
232 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
233 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
252 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
253 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
254 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
255 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
256 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
257 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
260 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
261 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
262 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
263 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
264 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
265 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
266 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
267 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
268 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
269 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
270 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
276 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
277 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
278 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
279 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
280 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
281 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
282 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
283 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
284 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
285 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
286 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
287 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
288 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
289 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
290 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
291 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
292 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
293 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
296 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
297 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
298 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
299 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
300 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
301 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
302 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
303 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
304 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
305 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
306 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
307 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
308 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
309 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
310 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
311 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 0.32
Isolates 2.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.35
Nodule 0
Rhizoplane 1.78
Rhizosphere 77.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055542_1004132 3300003762 Bacteria 3650
2 SwRhRL2b_contig_2794509 2162886007 Bacteria 1486
3 JGI24741J21665_1005221 3300001915 Bacteria 2753
4 JGI24752J21851_1001572 3300001976 Bacteria 3074
5 JGI24740J21852_10001016 3300001979 Bacteria 12545
6 JGI24740J21852_10012988 3300001979 Bacteria 3124
7 JGI24739J22299_10001067 3300001989 Bacteria 10203
8 JGI24739J22299_10003139 3300001989 Bacteria 6304
9 JGI24739J22299_10012763 3300001989 Bacteria 3080
10 JGI24739J22299_10038747 3300001989 Bacteria 1600
11 JGI24737J22298_10004452 3300001990 Bacteria 4883
12 JGI24737J22298_10005014 3300001990 Bacteria 4587
13 JGI24737J22298_10050336 3300001990 Bacteria 1266
14 JGI24735J21928_10004189 3300002067 Bacteria 4871
15 JGI24735J21928_10004916 3300002067 Bacteria 4455
16 JGI24735J21928_10007068 3300002067 Bacteria 3667
17 JGI24735J21928_10019301 3300002067 Bacteria 2096
18 JGI24750J21931_1010742 3300002070 Bacteria 1197
19 JGI24738J21930_10000464 3300002075 Bacteria 11506
20 JGI24738J21930_10002688 3300002075 Bacteria 4585
21 JGI24751J29686_10007032 3300002459 Bacteria 2299
22 JGI25150J39212_1000213 3300002774 Bacteria 31530
23 JGI25165J46597_1000112 3300003214 Bacteria 147097
24 JGI25153J46596_10000036 3300003215 Bacteria 182205
25 rootH1_10111877 3300003316 Bacteria 1296
26 rootL2_10227911 3300003322 Bacteria 1674
27 Ga0055526_1000948 3300003771 Bacteria 21478
28 Ga0055526_1040803 3300003771 Bacteria 1165
29 Ga0055536_1013054 3300003781 Bacteria 3028
30 Ga0055540_1001281 3300003792 Bacteria 15301
31 JGI25405J52794_10003443 3300003911 Bacteria 2773
32 Ga0065165_1077603 3300005262 Bacteria 869
33 Ga0065704_10072077 3300005289 Bacteria 9198
34 Ga0070658_10000896 3300005327 Bacteria 25520
35 Ga0070658_10005034 3300005327 Bacteria 10754
36 Ga0070658_10006492 3300005327 Bacteria 9479
37 Ga0070658_10081915 3300005327 Bacteria 2651
38 Ga0070676_10000257 3300005328 Bacteria 23128
39 Ga0070670_100042123 3300005331 Bacteria 3924
40 Ga0068869_100004094 3300005334 Bacteria 9028
41 Ga0070666_10000063 3300005335 Bacteria 80378
42 Ga0068868_100000023 3300005338 Bacteria 85334
43 Ga0070660_100000395 3300005339 Bacteria 28996
44 Ga0070660_100049125 3300005339 Bacteria 3242
45 Ga0070660_100084076 3300005339 Bacteria 2501
46 Ga0070660_100217734 3300005339 Bacteria 1551
47 Ga0070661_100036450 3300005344 Bacteria 3575
48 Ga0070661_100042406 3300005344 Bacteria 3321
49 Ga0070661_100123609 3300005344 Bacteria 1940
50 Ga0070668_100000739 3300005347 Bacteria 22344
51 Ga0070668_100013413 3300005347 Bacteria 6116
52 Ga0070668_100088273 3300005347 Bacteria 2441
53 Ga0070669_100000042 3300005353 Bacteria 123396
54 Ga0070671_100000002 3300005355 Bacteria 292733
55 Ga0070671_100043899 3300005355 Bacteria 3715
56 Ga0070671_100162503 3300005355 Bacteria 1888
57 Ga0070671_100182742 3300005355 Bacteria 1776
58 Ga0070674_100068398 3300005356 Bacteria 2502
59 Ga0070673_100000001 3300005364 Bacteria 239842
60 Ga0070673_100335412 3300005364 Bacteria 1339
61 Ga0070659_100017522 3300005366 Bacteria 5394
62 Ga0070659_100021216 3300005366 Bacteria 4942
63 Ga0070659_100056093 3300005366 Bacteria 3106
64 Ga0070659_100137208 3300005366 Bacteria 1989
65 Ga0070667_100000016 3300005367 Bacteria 237028
66 Ga0070667_100000162 3300005367 Bacteria 83150
67 Ga0070667_100035266 3300005367 Bacteria 4190
68 Ga0070714_100262029 3300005435 Bacteria 1601
69 Ga0070663_100012272 3300005455 Bacteria 5413
70 Ga0070663_100013894 3300005455 Bacteria 5150
71 Ga0070662_100002436 3300005457 Bacteria 11448
72 Ga0070662_100009003 3300005457 Bacteria 6513
73 Ga0070662_100039173 3300005457 Bacteria 3371
74 Ga0070662_100067495 3300005457 Bacteria 2626
75 Ga0070662_100206618 3300005457 Bacteria 1561
76 Ga0068867_100000387 3300005459 Bacteria 29397
77 Ga0070679_100008282 3300005530 Bacteria 9782
78 Ga0070679_100274033 3300005530 Bacteria 1641
79 Ga0070684_100042855 3300005535 Bacteria 3908
80 Ga0068853_100013579 3300005539 Bacteria 6655
81 Ga0068853_100018932 3300005539 Bacteria 5702
82 Ga0068853_100209603 3300005539 Bacteria 1776
83 Ga0068853_100364157 3300005539 Bacteria 1347
84 Ga0070672_100093513 3300005543 Bacteria 2429
85 Ga0070686_100160416 3300005544 Bacteria 1583
86 Ga0070665_100000186 3300005548 Bacteria 110750
87 Ga0070665_100105320 3300005548 Bacteria 2822
88 Ga0068855_100000092 3300005563 Bacteria 107195
89 Ga0068855_100008444 3300005563 Bacteria 12453
90 Ga0068855_100014816 3300005563 Bacteria 9389
91 Ga0068855_100034440 3300005563 Bacteria 6040
92 Ga0068855_100144960 3300005563 Bacteria 2704
93 Ga0068855_100299424 3300005563 Bacteria 1781
94 Ga0070664_100011340 3300005564 Bacteria 7233
95 Ga0070664_100013946 3300005564 Bacteria 6552
96 Ga0070664_100025320 3300005564 Bacteria 4917
97 Ga0070664_100255870 3300005564 Bacteria 1575
98 Ga0068857_100051510 3300005577 Bacteria 3653
99 Ga0068857_100056170 3300005577 Bacteria 3494
100 Ga0068857_100283789 3300005577 Bacteria 1523
101 Ga0068857_100502939 3300005577 Bacteria 1137
102 Ga0068854_100001764 3300005578 Bacteria 13172
103 Ga0068854_100013863 3300005578 Bacteria 5301
104 Ga0068854_100019275 3300005578 Bacteria 4595
105 Ga0068854_100114825 3300005578 Bacteria 2036
106 Ga0068856_100011968 3300005614 Bacteria 8401
107 Ga0068856_100033420 3300005614 Bacteria 5036
108 Ga0068856_100322377 3300005614 Bacteria 1562
109 Ga0068852_100001030 3300005616 Bacteria 18351
110 Ga0068852_100080343 3300005616 Bacteria 2890
111 Ga0068852_100538086 3300005616 Bacteria 1167
112 Ga0068852_100722711 3300005616 Bacteria 1007
113 Ga0068859_100002597 3300005617 Bacteria 18383
114 Ga0068864_100000731 3300005618 Bacteria 27480
115 Ga0068864_100537051 3300005618 Bacteria 1129
116 Ga0068866_10042187 3300005718 Bacteria 2269
117 Ga0068861_100000148 3300005719 Bacteria 36127
118 Ga0068851_10011304 3300005834 Bacteria 4185
119 Ga0068851_10012072 3300005834 Bacteria 4067
120 Ga0068863_100000047 3300005841 Bacteria 140249
121 Ga0068863_100003767 3300005841 Bacteria 15004
122 Ga0068863_100010486 3300005841 Bacteria 9007
123 Ga0068863_100014281 3300005841 Bacteria 7649
124 Ga0068858_100000588 3300005842 Bacteria 38216
125 Ga0068858_100003492 3300005842 Bacteria 15587
126 Ga0068860_100000196 3300005843 Bacteria 97096
127 Ga0068860_100008267 3300005843 Bacteria 10356
128 Ga0068860_100023270 3300005843 Bacteria 5987
129 Ga0068860_100036289 3300005843 Bacteria 4724
130 Ga0068862_100000063 3300005844 Bacteria 124662
131 Ga0068862_100007384 3300005844 Bacteria 9116
132 Ga0068862_100924121 3300005844 Bacteria 859
133 Ga0081455_10002546 3300005937 Bacteria 21639
134 Ga0075368_10000252 3300006042 Bacteria 15267
135 Ga0075363_100052875 3300006048 Bacteria 2169
136 Ga0075367_10000054 3300006178 Bacteria 27401
137 Ga0097621_100031374 3300006237 Bacteria 4217
138 Ga0097621_100190058 3300006237 Bacteria 1778
139 Ga0075370_10006098 3300006353 Bacteria 6045
140 Ga0075370_10037579 3300006353 Bacteria 2723
141 Ga0068871_100185845 3300006358 Bacteria 1788
142 Ga0068865_100000072 3300006881 Bacteria 53411
143 Ga0068865_100279800 3300006881 Bacteria 1328
144 Ga0097620_100002597 3300006931 Bacteria 18383
145 Ga0097620_100011775 3300006931 Bacteria 8788
146 Ga0105251_10015352 3300009011 Bacteria 4192
147 Ga0105240_10000959 3300009093 Bacteria 51453
148 Ga0105240_10004825 3300009093 Bacteria 20323
149 Ga0105240_10043982 3300009093 Bacteria 5679
150 Ga0105240_10055391 3300009093 Bacteria 4964
151 Ga0105240_10056021 3300009093 Bacteria 4934
152 Ga0105245_10000991 3300009098 Bacteria 25817
153 Ga0105245_10001709 3300009098 Bacteria 20004
154 Ga0105247_10001115 3300009101 Bacteria 20007
155 Ga0105247_10063313 3300009101 Bacteria 2295
156 Ga0105243_10000737 3300009148 Bacteria 31311
157 Ga0105243_10047869 3300009148 Bacteria 3369
158 Ga0105243_10129062 3300009148 Bacteria 2142
159 Ga0105241_10002409 3300009174 Bacteria 14050
160 Ga0105241_10030503 3300009174 Bacteria 4030
161 Ga0105241_10446330 3300009174 Bacteria 1143
162 Ga0105242_10000178 3300009176 Bacteria 48486
163 Ga0105248_10019155 3300009177 Bacteria 7571
164 Ga0105237_10001281 3300009545 Bacteria 33535
165 Ga0105237_10007067 3300009545 Bacteria 12344
166 Ga0105237_10016910 3300009545 Bacteria 7569
167 Ga0105237_10104848 3300009545 Bacteria 2819
168 Ga0105237_10233537 3300009545 Bacteria 1840
169 Ga0105238_10017266 3300009551 Bacteria 7330
170 Ga0105238_10092272 3300009551 Bacteria 3016
171 Ga0105238_10210877 3300009551 Bacteria 1918
172 Ga0105249_10129922 3300009553 Bacteria 2403
173 Ga0105249_10321312 3300009553 Bacteria 1559
174 Ga0105239_10000156 3300010375 Bacteria 98400
175 Ga0105239_10027427 3300010375 Bacteria 6270
176 Ga0105246_10000632 3300011119 Bacteria 19638
177 Ga0105246_10003219 3300011119 Bacteria 9909
178 Ga0157373_10003358 3300013100 Bacteria 12096
179 Ga0157373_10024990 3300013100 Bacteria 4324
180 Ga0157373_10066548 3300013100 Bacteria 2549
181 Ga0157373_10119605 3300013100 Bacteria 1851
182 Ga0157371_10000030 3300013102 Bacteria 241585
183 Ga0157371_10003665 3300013102 Bacteria 13817
184 Ga0157371_10148248 3300013102 Bacteria 1673
185 Ga0157370_10000213 3300013104 Bacteria 73863
186 Ga0157370_10008634 3300013104 Bacteria 10966
187 Ga0157370_10027202 3300013104 Bacteria 5639
188 Ga0157370_10031556 3300013104 Bacteria 5180
189 Ga0157369_10030780 3300013105 Bacteria 5917
190 Ga0157369_10049579 3300013105 Bacteria 4552
191 Ga0157369_10374014 3300013105 Bacteria 1479
192 Ga0157369_10536632 3300013105 Bacteria 1210
193 Ga0157374_10005847 3300013296 Bacteria 10390
194 Ga0157374_10026073 3300013296 Bacteria 5255
195 Ga0157374_10399118 3300013296 Bacteria 1372
196 Ga0157378_10017190 3300013297 Bacteria 6340
197 Ga0157378_10376366 3300013297 Bacteria 1393
198 Ga0163162_10025996 3300013306 Bacteria 5785
199 Ga0163162_10305216 3300013306 Bacteria 1724
200 Ga0157372_10005904 3300013307 Bacteria 13033
201 Ga0157372_10064731 3300013307 Bacteria 4102
202 Ga0157372_10148749 3300013307 Bacteria 2702
203 Ga0157372_10215277 3300013307 Bacteria 2226
204 Ga0157372_10321430 3300013307 Bacteria 1802
205 Ga0157372_10597749 3300013307 Bacteria 1286
206 Ga0157375_10009597 3300013308 Bacteria 8502
207 Ga0157375_10648450 3300013308 Bacteria 1212
208 Ga0157380_10259177 3300014326 Bacteria 1578
209 Ga0157377_10008193 3300014745 Bacteria 5086
210 Ga0157376_10000287 3300014969 Bacteria 34078
211 Ga0183363_1005 3300015690 Bacteria 403020
212 Ga0163161_10033177 3300017792 Bacteria 3689
213 Ga0206356_10706515 3300020070 Bacteria 975
214 Ga0213875_10000229 3300021388 Bacteria 56654
215 Ga0213875_10091761 3300021388 Bacteria 1417
216 Ga0209147_100491 3300025229 Bacteria 23505
217 Ga0209563_100047 3300025230 Bacteria 366620
218 Ga0207425_1000037 3300025245 Bacteria 224645
219 Ga0209148_1000133 3300025254 Bacteria 171351
220 Ga0209148_1001220 3300025254 Bacteria 14537
221 Ga0209129_1000363 3300025258 Bacteria 37614
222 Ga0209233_1000078 3300025261 Bacteria 348118
223 Ga0209565_1000427 3300025263 Bacteria 34040
224 Ga0209455_1014725 3300025272 Bacteria 1755
225 Ga0209676_1002287 3300025292 Bacteria 13986
226 Ga0209676_1010356 3300025292 Bacteria 3899
227 Ga0209025_1000117 3300025294 Bacteria 215073
228 Ga0209564_1003622 3300025295 Bacteria 10279
229 Ga0209564_1005290 3300025295 Bacteria 7438
230 Ga0209758_1000103 3300025297 Bacteria 223968
231 Ga0209758_1029405 3300025297 Bacteria 2299
232 Ga0209050_1000001 3300025298 Bacteria 3563507
233 Ga0209050_1004951 3300025298 Bacteria 8681
234 Ga0209050_1014423 3300025298 Bacteria 3404
235 Ga0207426_1009119 3300025302 Bacteria 3945
236 Ga0209051_1003509 3300025303 Bacteria 10253
237 Ga0209257_1005036 3300025304 Bacteria 9613
238 Ga0209257_1005111 3300025304 Bacteria 9510
239 Ga0207697_10000130 3300025315 Bacteria 36265
240 Ga0207656_10008971 3300025321 Bacteria 3704
241 Ga0207642_10032946 3300025899 Bacteria 2187
242 Ga0207710_10008193 3300025900 Bacteria 4411
243 Ga0207710_10033001 3300025900 Bacteria 2269
244 Ga0207688_10132857 3300025901 Bacteria 1460
245 Ga0207680_10000033 3300025903 Bacteria 77177
246 Ga0207647_10001366 3300025904 Bacteria 18757
247 Ga0207647_10005723 3300025904 Bacteria 9077
248 Ga0207647_10008063 3300025904 Bacteria 7573
249 Ga0207647_10123078 3300025904 Bacteria 1528
250 Ga0207645_10000520 3300025907 Bacteria 31954
251 Ga0207645_10030776 3300025907 Bacteria 3459
252 Ga0207705_10000018 3300025909 Bacteria 319792
253 Ga0207705_10000163 3300025909 Bacteria 71674
254 Ga0207705_10001877 3300025909 Bacteria 16493
255 Ga0207705_10009458 3300025909 Bacteria 7088
256 Ga0207705_10277494 3300025909 Bacteria 1282
257 Ga0207654_10000852 3300025911 Bacteria 16833
258 Ga0207707_10026421 3300025912 Bacteria 5074
259 Ga0207707_10079378 3300025912 Bacteria 2866
260 Ga0207695_10000521 3300025913 Bacteria 81496
261 Ga0207695_10003499 3300025913 Bacteria 22030
262 Ga0207695_10015077 3300025913 Bacteria 9118
263 Ga0207695_10029492 3300025913 Bacteria 6059
264 Ga0207695_10136608 3300025913 Bacteria 2405
265 Ga0207671_10000607 3300025914 Bacteria 47542
266 Ga0207671_10023761 3300025914 Bacteria 4619
267 Ga0207671_10028062 3300025914 Bacteria 4207
268 Ga0207660_10089146 3300025917 Bacteria 2283
269 Ga0207657_10000408 3300025919 Bacteria 45400
270 Ga0207657_10012810 3300025919 Bacteria 8253
271 Ga0207657_10016065 3300025919 Bacteria 7226
272 Ga0207657_10058219 3300025919 Bacteria 3326
273 Ga0207657_10138453 3300025919 Bacteria 1990
274 Ga0207657_10160254 3300025919 Bacteria 1828
275 Ga0207657_10489385 3300025919 Bacteria 964
276 Ga0207649_10000199 3300025920 Bacteria 49941
277 Ga0207649_10005456 3300025920 Bacteria 6885
278 Ga0207649_10112409 3300025920 Bacteria 1822
279 Ga0207652_10251142 3300025921 Bacteria 1595
280 Ga0207652_10328239 3300025921 Bacteria 1381
281 Ga0207652_10342710 3300025921 Bacteria 1349
282 Ga0207681_10000002 3300025923 Bacteria 985597
283 Ga0207694_10004278 3300025924 Bacteria 11176
284 Ga0207694_10057818 3300025924 Bacteria 3016
285 Ga0207694_10153631 3300025924 Bacteria 1855
286 Ga0207650_10097313 3300025925 Bacteria 2259
287 Ga0207659_10297651 3300025926 Bacteria 1324
288 Ga0207687_10002396 3300025927 Bacteria 12709
289 Ga0207687_10009517 3300025927 Bacteria 6355
290 Ga0207664_10284302 3300025929 Bacteria 1452
291 Ga0207644_10000002 3300025931 Bacteria 942221
292 Ga0207644_10031668 3300025931 Bacteria 3686
293 Ga0207690_10003817 3300025932 Bacteria 8918
294 Ga0207690_10013220 3300025932 Bacteria 4956
295 Ga0207690_10049134 3300025932 Bacteria 2810
296 Ga0207706_10004237 3300025933 Bacteria 13507
297 Ga0207706_10005782 3300025933 Bacteria 11503
298 Ga0207706_10016251 3300025933 Bacteria 6723
299 Ga0207706_10017165 3300025933 Bacteria 6527
300 Ga0207706_10029979 3300025933 Bacteria 4856
301 Ga0207706_10036693 3300025933 Bacteria 4353
302 Ga0207706_10055843 3300025933 Bacteria 3482
303 Ga0207706_10060294 3300025933 Bacteria 3341
304 Ga0207686_10001920 3300025934 Bacteria 11495
305 Ga0207709_10000432 3300025935 Bacteria 40012
306 Ga0207709_10096414 3300025935 Bacteria 1945
307 Ga0207704_10000032 3300025938 Bacteria 108408
308 Ga0207704_10179440 3300025938 Bacteria 1528
309 Ga0207691_10073708 3300025940 Bacteria 3079
310 Ga0207711_10029217 3300025941 Bacteria 4647
311 Ga0207689_10008114 3300025942 Bacteria 9158
312 Ga0207661_10120942 3300025944 Bacteria 2229
313 Ga0207667_10000013 3300025949 Bacteria 435875
314 Ga0207667_10007430 3300025949 Bacteria 13168
315 Ga0207667_10047477 3300025949 Bacteria 4545
316 Ga0207667_10088539 3300025949 Bacteria 3201
317 Ga0207667_10266992 3300025949 Bacteria 1750
318 Ga0207651_10000001 3300025960 Bacteria 516823
319 Ga0207712_10000069 3300025961 Bacteria 127318
320 Ga0207712_10001860 3300025961 Bacteria 13872
321 Ga0207640_10000050 3300025981 Bacteria 96203
322 Ga0207640_10084174 3300025981 Bacteria 2183
323 Ga0207640_10109461 3300025981 Bacteria 1955
324 Ga0207640_10192816 3300025981 Bacteria 1537
325 Ga0207640_10278503 3300025981 Bacteria 1312
326 Ga0207658_10000075 3300025986 Bacteria 109004
327 Ga0207658_10017969 3300025986 Bacteria 4874
328 Ga0207677_10001163 3300026023 Bacteria 14359
329 Ga0207703_10001509 3300026035 Bacteria 21208
330 Ga0207639_10000138 3300026041 Bacteria 54326
331 Ga0207639_10003659 3300026041 Bacteria 10329
332 Ga0207639_10005117 3300026041 Bacteria 8835
333 Ga0207639_10038650 3300026041 Bacteria 3551
334 Ga0207639_10205081 3300026041 Bacteria 1694
335 Ga0207678_10002459 3300026067 Bacteria 16827
336 Ga0207678_10003700 3300026067 Bacteria 13745
337 Ga0207678_10021977 3300026067 Bacteria 5592
338 Ga0207702_10010000 3300026078 Bacteria 7953
339 Ga0207702_10010202 3300026078 Bacteria 7863
340 Ga0207702_10012601 3300026078 Bacteria 7037
341 Ga0207702_10022803 3300026078 Bacteria 5193
342 Ga0207702_10114116 3300026078 Bacteria 2407
343 Ga0207641_10000973 3300026088 Bacteria 29317
344 Ga0207641_10001660 3300026088 Bacteria 21708
345 Ga0207641_10019831 3300026088 Bacteria 5518
346 Ga0207648_10001195 3300026089 Bacteria 29082
347 Ga0207676_10000705 3300026095 Bacteria 26301
348 Ga0207676_10653108 3300026095 Bacteria 1015
349 Ga0207674_10003143 3300026116 Bacteria 20360
350 Ga0207674_10006416 3300026116 Bacteria 13835
351 Ga0207674_10018492 3300026116 Bacteria 7574
352 Ga0207674_10059376 3300026116 Bacteria 3870
353 Ga0207674_10063616 3300026116 Bacteria 3724
354 Ga0207674_10088996 3300026116 Bacteria 3080
355 Ga0207674_10732169 3300026116 Bacteria 954
356 Ga0207675_100000355 3300026118 Bacteria 43840
357 Ga0207683_10004967 3300026121 Bacteria 11438
358 Ga0207683_10268557 3300026121 Bacteria 1558
359 Ga0207698_10000551 3300026142 Bacteria 21787
360 Ga0207698_10033092 3300026142 Bacteria 3753
361 Ga0207698_10174385 3300026142 Bacteria 1897
362 Ga0207698_10179648 3300026142 Bacteria 1873
363 Ga0209813_10000063 3300027866 Bacteria 43741
364 Ga0268266_10000002 3300028379 Bacteria 3059047
365 Ga0268265_10000055 3300028380 Bacteria 158947
366 Ga0268265_10000361 3300028380 Bacteria 49182
367 Ga0268265_10892249 3300028380 Bacteria 872
368 Ga0268264_10000087 3300028381 Bacteria 236696
369 Ga0268264_10000116 3300028381 Bacteria 198591
370 Ga0268264_10000381 3300028381 Bacteria 64651
371 Ga0307517_10019763 3300028786 Bacteria 8619
372 Ga0307517_10082933 3300028786 Bacteria 2716
373 Ga0307408_100024384 3300031548 Bacteria 4130
374 Ga0307413_10033283 3300031824 Bacteria 2933
375 Ga0307410_10093588 3300031852 Bacteria 2139
376 Ga0307410_10125478 3300031852 Bacteria 1878
377 Ga0307406_10101318 3300031901 Bacteria 1962
378 Ga0307406_10179361 3300031901 Bacteria 1540
379 Ga0307412_10000950 3300031911 Bacteria 16577
380 Ga0307412_10023565 3300031911 Bacteria 3789
381 Ga0307412_10086127 3300031911 Bacteria 2185
382 Ga0307412_10186843 3300031911 Bacteria 1563
383 Ga0307409_100135470 3300031995 Bacteria 2113
384 Ga0307409_100412705 3300031995 Bacteria 1293
385 Ga0307409_100736415 3300031995 Bacteria 988
386 Ga0307416_100018666 3300032002 Bacteria 4894
387 Ga0307414_10001891 3300032004 Bacteria 10819
388 Ga0307414_10112675 3300032004 Bacteria 2074
389 Ga0307414_10320199 3300032004 Bacteria 1319
390 Ga0307411_10067422 3300032005 Bacteria 2408
391 Ga0307411_10551386 3300032005 Bacteria 983
392 Ga0373923_0046343 3300035111 Bacteria 1808
393 Ga0316584_0116543 3300036712 Bacteria 1998
394 Ga0395899_0002292 3300037312 Bacteria 15614
395 Ga0395900_0021625 3300037418 Bacteria 6576
396 Ga0395900_0179985 3300037418 Bacteria 2149
397 Ga0395905_0016001 3300037471 Bacteria 7130
398 Ga0395905_0030594 3300037471 Bacteria 5071
399 Ga0395905_0148075 3300037471 Bacteria 2209
400 Ga0395905_0584614 3300037471 Bacteria 1018
401 Ga0395905_0726545 3300037471 Bacteria 895
402 Ga0436364_0413697 3300037853 Bacteria 1944
403 Ga0436364_0530420 3300037853 Bacteria 132998
404 Ga0436365_1704067 3300039437 Bacteria 1313
405 Ga0451793_1365563 3300041452 Bacteria 1797
406 Ga0451802_1527592 3300041460 Bacteria 3233
407 Ga0451806_292367 3300041462 Bacteria 1569
408 Ga0451807_2051197 3300041486 Bacteria 1589
409 Ga0439448_0022377 3300042005 Bacteria 1964
410 Ga0439455_0000137 3300042012 Bacteria 7821
411 Ga0439458_0000756 3300042157 Bacteria 8283
412 Ga0439458_0012507 3300042157 Bacteria 1906
413 Ga0439458_0037728 3300042157 Bacteria 1165
414 Ga0466972_0010998 3300044658 Bacteria 4543
415 Ga0466972_0019619 3300044658 Bacteria 3380
416 Ga0466965_0069761 3300044683 Bacteria 1766
417 Ga0466961_0002427 3300044693 Bacteria 11561
418 Ga0466961_0151817 3300044693 Bacteria 1446
419 Ga0466970_0010891 3300044765 Bacteria 4625
420 Ga0466957_0086515 3300044842 Bacteria 1959
421 Ga0466957_0131832 3300044842 Bacteria 1602
422 Ga0466960_0002678 3300044901 Bacteria 6726
423 Ga0466959_0000595 3300045049 Bacteria 21075
424 Ga0466958_0090108 3300045836 Bacteria 1897
425 Ga0466958_0095266 3300045836 Bacteria 1845
426 Ga0495617_035157 3300046452 Bacteria 1683
427 Ga0495627_000193 3300046453 Bacteria 67253
428 Ga0495627_000478 3300046453 Bacteria 33914
429 Ga0495638_0000011 3300046460 Bacteria 442453
430 Ga0495650_0000373 3300046471 Bacteria 78223
431 Ga0495650_0006527 3300046471 Bacteria 7250
432 Ga0495650_0049726 3300046471 Bacteria 1739
433 Ga0495584_0074512 3300046491 Bacteria 1706
434 Ga0495583_0000305 3300046506 Bacteria 78306
435 Ga0495583_0002224 3300046506 Bacteria 17153
436 Ga0495583_0011527 3300046506 Bacteria 5070
437 Ga0495583_0063366 3300046506 Bacteria 1643
438 Ga0495606_0000591 3300046507 Bacteria 57426
439 Ga0495606_0008930 3300046507 Bacteria 8581
440 Ga0495606_0149671 3300046507 Bacteria 1371
441 Ga0495610_0001092 3300046512 Bacteria 24761
442 Ga0495616_0000018 3300046513 Bacteria 167281
443 Ga0495631_0026785 3300046518 Bacteria 2643
444 Ga0495632_0000042 3300046519 Bacteria 145186
445 Ga0495632_0000538 3300046519 Bacteria 35631
446 Ga0495637_0000626 3300046520 Bacteria 24967
447 Ga0495637_0019775 3300046520 Bacteria 3109
448 Ga0495637_0020613 3300046520 Bacteria 3031
449 Ga0495643_0000005 3300046522 Bacteria 443135
450 Ga0495648_0000023 3300046524 Bacteria 240174
451 Ga0495648_0000115 3300046524 Bacteria 98656
452 Ga0495648_0009282 3300046524 Bacteria 7645
453 Ga0495663_0000015 3300046525 Bacteria 145185
454 Ga0495663_0004526 3300046525 Bacteria 3899
455 Ga0495587_0195933 3300046536 Bacteria 1143
456 Ga0495622_0006174 3300046557 Bacteria 5565
457 Ga0495633_0000197 3300046558 Bacteria 76903
458 Ga0495633_0000262 3300046558 Bacteria 62524
459 Ga0495633_0002581 3300046558 Bacteria 12683
460 Ga0495633_0011568 3300046558 Bacteria 4749
461 Ga0495633_0038543 3300046558 Bacteria 2282
462 Ga0495633_0044808 3300046558 Bacteria 2096
463 Ga0495668_0014245 3300046616 Bacteria 4668
464 Ga0495668_0173497 3300046616 Bacteria 1181
465 Ga0495611_0044505 3300046648 Bacteria 1986
466 Ga0495611_0111175 3300046648 Bacteria 1275
467 Ga0495625_0000959 3300046660 Bacteria 38428
468 Ga0495625_0003788 3300046660 Bacteria 14662
469 Ga0495625_0133328 3300046660 Bacteria 1681
470 Ga0495625_0165586 3300046660 Bacteria 1478
471 Ga0495661_0101759 3300046665 Bacteria 1616
472 Ga0495669_0000268 3300046684 Bacteria 29882
473 Ga0495671_0000007 3300046692 Bacteria 443069
474 Ga0495671_0000012 3300046692 Bacteria 358632
475 Ga0495671_0007760 3300046692 Bacteria 6080
476 Ga0495600_0015371 3300046809 Bacteria 4839
477 Ga0495660_0071088 3300046810 Bacteria 1846
478 Ga0495672_0227828 3300047320 Bacteria 916
479 Ga0495683_0131357 3300047323 Bacteria 1181
480 Ga0495677_0045964 3300047445 Bacteria 1602
481 Ga0495673_0000029 3300047469 Bacteria 471019
482 Ga0495681_0000032 3300047470 Bacteria 127415
483 Ga0495686_0000149 3300047472 Bacteria 135332
484 Ga0495686_0008181 3300047472 Bacteria 7718
485 Ga0495686_0008478 3300047472 Bacteria 7539
486 Ga0495686_0009317 3300047472 Bacteria 7085
487 Ga0495686_0022254 3300047472 Bacteria 4195
488 Ga0495686_0093226 3300047472 Bacteria 1826
489 Ga0495686_0098955 3300047472 Bacteria 1761
490 Ga0495686_0246744 3300047472 Bacteria 1005
491 Ga0496102_0000049 3300048905 Bacteria 179480
492 Ga0496102_0123199 3300048905 Bacteria 2422
493 Ga0496103_0000037 3300048906 Bacteria 179474
494 Ga0496108_0018131 3300048911 Bacteria 5759
495 Ga0496110_0069636 3300048913 Bacteria 3116
496 Ga0496115_0019493 3300048918 Bacteria 5220
497 Ga0496116_0000664 3300048919 Bacteria 44805
498 Ga0496116_0059042 3300048919 Bacteria 2497
499 Ga0496117_0000115 3300048920 Bacteria 179488
500 Ga0496117_0048676 3300048920 Bacteria 3024
501 Ga0496117_0066120 3300048920 Bacteria 2454
502 Ga0496117_0084565 3300048920 Bacteria 2069
503 Ga0496117_0111413 3300048920 Bacteria 1704
504 Ga0496118_0000086 3300048921 Bacteria 179488
505 Ga0496118_0024617 3300048921 Bacteria 5191
506 Ga0496118_0038779 3300048921 Bacteria 3813
507 Ga0496118_0067935 3300048921 Bacteria 2591
508 Ga0496118_0117603 3300048921 Bacteria 1743
509 Ga0496119_0026037 3300048922 Bacteria 4067
510 Ga0496120_0043762 3300048923 Bacteria 2606
511 Ga0496120_0056749 3300048923 Bacteria 2208
512 Ga0496121_0000208 3300048924 Bacteria 129753
513 Ga0496121_0000237 3300048924 Bacteria 118615
514 Ga0496121_0006256 3300048924 Bacteria 14903
515 Ga0496121_0010863 3300048924 Bacteria 10179
516 Ga0496121_0021861 3300048924 Bacteria 6245
517 Ga0496121_0356664 3300048924 Bacteria 972
518 Ga0496122_0000970 3300048925 Bacteria 51487
519 Ga0496122_0009733 3300048925 Bacteria 10045
520 Ga0496122_0010014 3300048925 Bacteria 9863
521 Ga0496122_0046575 3300048925 Bacteria 3357
522 Ga0496122_0049081 3300048925 Bacteria 3238
523 Ga0496123_0000286 3300048926 Bacteria 98752
524 Ga0496123_0004476 3300048926 Bacteria 14656
525 Ga0496123_0010752 3300048926 Bacteria 8036
526 Ga0496123_0014617 3300048926 Bacteria 6490
527 Ga0496123_0015139 3300048926 Bacteria 6347
528 Ga0496124_0000102 3300048927 Bacteria 179488
529 Ga0496124_0000510 3300048927 Bacteria 66863
530 Ga0496124_0002035 3300048927 Bacteria 27471
531 Ga0496124_0002045 3300048927 Bacteria 27415
532 Ga0496124_0009343 3300048927 Bacteria 10103
533 Ga0496124_0027789 3300048927 Bacteria 5069
534 Ga0496124_0054093 3300048927 Bacteria 3399
535 Ga0496124_0070937 3300048927 Bacteria 2889
536 Ga0496124_0090087 3300048927 Bacteria 2503
537 Ga0496124_0154889 3300048927 Bacteria 1793
538 Ga0496125_0022011 3300048928 Bacteria 5928
539 Ga0496125_0128582 3300048928 Bacteria 1789
540 Ga0496126_0047987 3300048929 Bacteria 3907
541 Ga0496126_0317127 3300048929 Bacteria 1282
542 Ga0495678_029037 3300049459 Bacteria 2327
543 Ga0495682_0052089 3300049460 Bacteria 1488
544 Ga0501290_001795 3300049513 Bacteria 2851
545 Ga0501290_005576 3300049513 Bacteria 1570
546 Ga0501292_000008 3300049515 Bacteria 83748
547 Ga0501294_001311 3300049517 Bacteria 2546
548 Ga0501300_000363 3300049523 Bacteria 6905
549 Ga0501335_000124 3300049551 Bacteria 3760
550 Ga0501036_0612885 3300049572 Bacteria 902
551 Ga0501223_000368 3300049663 Bacteria 11106
552 Ga0501233_004089 3300049668 Bacteria 2655
553 Ga0501235_000385 3300049669 Bacteria 8468
554 Ga0501235_001136 3300049669 Bacteria 5577
555 Ga0501236_021268 3300049670 Bacteria 960
556 Ga0501257_001545 3300049686 Bacteria 4799
557 Ga0501257_007205 3300049686 Bacteria 2483
558 Ga0501259_000518 3300049688 Bacteria 6179
559 Ga0501261_000020 3300049690 Bacteria 37889
560 Ga0501225_0000786 3300049705 Bacteria 9925
561 Ga0501279_000002 3300049775 Bacteria 205937
562 Ga0501280_000010 3300049776 Bacteria 63153
563 Ga0501280_004171 3300049776 Bacteria 2145
564 Ga0501282_000295 3300049778 Bacteria 6018
565 Ga0501283_001354 3300049779 Bacteria 3202
566 nmdc:mga03n38_46054_c1 3300050490 Bacteria 1923
567 nmdc:mga06z11_27_c1 3300050494 Bacteria 64010
568 nmdc:mga04h51_147_c1 3300050495 Bacteria 20575
569 nmdc:mga07m45_138208_c1 3300050496 Bacteria 1411
570 nmdc:mga07m45_18564_c1 3300050496 Bacteria 3757
571 Ga0500643_000081 3300053087 Bacteria 101681
572 Ga0500643_000306 3300053087 Bacteria 40712
573 Ga0500643_011202 3300053087 Bacteria 3285
574 Ga0500643_024242 3300053087 Bacteria 1928
575 Ga0500555_000444 3300053103 Bacteria 17141
576 Ga0500556_0000074 3300053104 Bacteria 98799
577 Ga0500562_024231 3300053108 Bacteria 1586
578 Ga0500594_0024835 3300053118 Bacteria 1530
579 Ga0500595_004504 3300053119 Bacteria 6234
580 Ga0500597_018671 3300053120 Bacteria 2693
581 Ga0500608_007974 3300053122 Bacteria 4419
582 Ga0500608_026077 3300053122 Bacteria 2742
583 Ga0500642_0000002 3300053130 Bacteria 795093
584 Ga0500642_0000116 3300053130 Bacteria 37194
585 Ga0500559_0068599 3300053136 Bacteria 1593
586 Ga0500573_0000046 3300053140 Bacteria 98723
587 Ga0500573_0245911 3300053140 Bacteria 925
588 Ga0500616_0007580 3300053153 Bacteria 6865
589 Ga0500624_000044 3300053157 Bacteria 90094
590 Ga0500624_000053 3300053157 Bacteria 74086
591 Ga0500627_0002055 3300053158 Bacteria 5826
592 Ga0500636_0028474 3300053177 Bacteria 3299
593 Ga0500637_0000008 3300053178 Bacteria 89244
594 Ga0500645_000009 3300053730 Bacteria 206177
595 Ga0500645_000439 3300053730 Bacteria 28425
596 Ga0500596_002809 3300053735 Bacteria 3401
597 Ga0500661_000082 3300055283 Bacteria 14988
598 Ga0466962_0008633 3300061719 Bacteria 4885
599 Ga0466962_0158351 3300061719 Bacteria 1100
600 Ga0466962_0182140 3300061719 Bacteria 1024
601 2512644701 2512564014 Bacteria 4639632
602 2600226338 2599185359 Bacteria 4772316
603 2643950309 2643221588 Bacteria 3692460
604 2778123872 2775507255 Bacteria 3945731
605 2809062205 2808606401 Bacteria 4586670
606 2809078455 2808606404 Bacteria 4652788
607 2809082594 2808606405 Bacteria 4586632
608 2819712418 2818991466 Bacteria 4748179
609 2830077902 2830075706 Bacteria 3855215
610 2848299367 2848297114 Bacteria 3608511
611 2880518988 2880518877 Bacteria 5012590
612 2896186827 2896184354 Bacteria 3258548
613 2896254590 2896253425 Bacteria 3418029
614 2919711732 2919709256 Bacteria 4318106
615 2928526928 2928526807 Bacteria 4760224
616 2928969467 2928968154 Bacteria 4633371
617 8057101752 8057101203 Bacteria 5034064
618 Ga0055542_1004132
619 SwRhRL2b_contig_2794509
620 JGI24741J21665_1005221
621 JGI24752J21851_1001572
622 JGI24740J21852_10001016
623 JGI24740J21852_10012988
624 JGI24739J22299_10001067
625 JGI24739J22299_10003139
626 JGI24739J22299_10012763
627 JGI24739J22299_10038747
628 JGI24737J22298_10004452
629 JGI24737J22298_10005014
630 JGI24737J22298_10050336
631 JGI24735J21928_10004189
632 JGI24735J21928_10004916
633 JGI24735J21928_10007068
634 JGI24735J21928_10019301
635 JGI24750J21931_1010742
636 JGI24738J21930_10000464
637 JGI24738J21930_10002688
638 JGI24751J29686_10007032
639 JGI25150J39212_1000213
640 JGI25165J46597_1000112
641 JGI25153J46596_10000036
642 rootH1_10111877
643 rootL2_10227911
644 Ga0055526_1000948
645 Ga0055526_1040803
646 Ga0055536_1013054
647 Ga0055540_1001281
648 JGI25405J52794_10003443
649 Ga0065165_1077603
650 Ga0065704_10072077
651 Ga0070658_10000896
652 Ga0070658_10005034
653 Ga0070658_10006492
654 Ga0070658_10081915
655 Ga0070676_10000257
656 Ga0070670_100042123
657 Ga0068869_100004094
658 Ga0070666_10000063
659 Ga0068868_100000023
660 Ga0070660_100000395
661 Ga0070660_100049125
662 Ga0070660_100084076
663 Ga0070660_100217734
664 Ga0070661_100036450
665 Ga0070661_100042406
666 Ga0070661_100123609
667 Ga0070668_100000739
668 Ga0070668_100013413
669 Ga0070668_100088273
670 Ga0070669_100000042
671 Ga0070671_100000002
672 Ga0070671_100043899
673 Ga0070671_100162503
674 Ga0070671_100182742
675 Ga0070674_100068398
676 Ga0070673_100000001
677 Ga0070673_100335412
678 Ga0070659_100017522
679 Ga0070659_100021216
680 Ga0070659_100056093
681 Ga0070659_100137208
682 Ga0070667_100000016
683 Ga0070667_100000162
684 Ga0070667_100035266
685 Ga0070714_100262029
686 Ga0070663_100012272
687 Ga0070663_100013894
688 Ga0070662_100002436
689 Ga0070662_100009003
690 Ga0070662_100039173
691 Ga0070662_100067495
692 Ga0070662_100206618
693 Ga0068867_100000387
694 Ga0070679_100008282
695 Ga0070679_100274033
696 Ga0070684_100042855
697 Ga0068853_100013579
698 Ga0068853_100018932
699 Ga0068853_100209603
700 Ga0068853_100364157
701 Ga0070672_100093513
702 Ga0070686_100160416
703 Ga0070665_100000186
704 Ga0070665_100105320
705 Ga0068855_100000092
706 Ga0068855_100008444
707 Ga0068855_100014816
708 Ga0068855_100034440
709 Ga0068855_100144960
710 Ga0068855_100299424
711 Ga0070664_100011340
712 Ga0070664_100013946
713 Ga0070664_100025320
714 Ga0070664_100255870
715 Ga0068857_100051510
716 Ga0068857_100056170
717 Ga0068857_100283789
718 Ga0068857_100502939
719 Ga0068854_100001764
720 Ga0068854_100013863
721 Ga0068854_100019275
722 Ga0068854_100114825
723 Ga0068856_100011968
724 Ga0068856_100033420
725 Ga0068856_100322377
726 Ga0068852_100001030
727 Ga0068852_100080343
728 Ga0068852_100538086
729 Ga0068852_100722711
730 Ga0068859_100002597
731 Ga0068864_100000731
732 Ga0068864_100537051
733 Ga0068866_10042187
734 Ga0068861_100000148
735 Ga0068851_10011304
736 Ga0068851_10012072
737 Ga0068863_100000047
738 Ga0068863_100003767
739 Ga0068863_100010486
740 Ga0068863_100014281
741 Ga0068858_100000588
742 Ga0068858_100003492
743 Ga0068860_100000196
744 Ga0068860_100008267
745 Ga0068860_100023270
746 Ga0068860_100036289
747 Ga0068862_100000063
748 Ga0068862_100007384
749 Ga0068862_100924121
750 Ga0081455_10002546
751 Ga0075368_10000252
752 Ga0075363_100052875
753 Ga0075367_10000054
754 Ga0097621_100031374
755 Ga0097621_100190058
756 Ga0075370_10006098
757 Ga0075370_10037579
758 Ga0068871_100185845
759 Ga0068865_100000072
760 Ga0068865_100279800
761 Ga0097620_100002597
762 Ga0097620_100011775
763 Ga0105251_10015352
764 Ga0105240_10000959
765 Ga0105240_10004825
766 Ga0105240_10043982
767 Ga0105240_10055391
768 Ga0105240_10056021
769 Ga0105245_10000991
770 Ga0105245_10001709
771 Ga0105247_10001115
772 Ga0105247_10063313
773 Ga0105243_10000737
774 Ga0105243_10047869
775 Ga0105243_10129062
776 Ga0105241_10002409
777 Ga0105241_10030503
778 Ga0105241_10446330
779 Ga0105242_10000178
780 Ga0105248_10019155
781 Ga0105237_10001281
782 Ga0105237_10007067
783 Ga0105237_10016910
784 Ga0105237_10104848
785 Ga0105237_10233537
786 Ga0105238_10017266
787 Ga0105238_10092272
788 Ga0105238_10210877
789 Ga0105249_10129922
790 Ga0105249_10321312
791 Ga0105239_10000156
792 Ga0105239_10027427
793 Ga0105246_10000632
794 Ga0105246_10003219
795 Ga0157373_10003358
796 Ga0157373_10024990
797 Ga0157373_10066548
798 Ga0157373_10119605
799 Ga0157371_10000030
800 Ga0157371_10003665
801 Ga0157371_10148248
802 Ga0157370_10000213
803 Ga0157370_10008634
804 Ga0157370_10027202
805 Ga0157370_10031556
806 Ga0157369_10030780
807 Ga0157369_10049579
808 Ga0157369_10374014
809 Ga0157369_10536632
810 Ga0157374_10005847
811 Ga0157374_10026073
812 Ga0157374_10399118
813 Ga0157378_10017190
814 Ga0157378_10376366
815 Ga0163162_10025996
816 Ga0163162_10305216
817 Ga0157372_10005904
818 Ga0157372_10064731
819 Ga0157372_10148749
820 Ga0157372_10215277
821 Ga0157372_10321430
822 Ga0157372_10597749
823 Ga0157375_10009597
824 Ga0157375_10648450
825 Ga0157380_10259177
826 Ga0157377_10008193
827 Ga0157376_10000287
828 Ga0183363_1005
829 Ga0163161_10033177
830 Ga0206356_10706515
831 Ga0213875_10000229
832 Ga0213875_10091761
833 Ga0209147_100491
834 Ga0209563_100047
835 Ga0207425_1000037
836 Ga0209148_1000133
837 Ga0209148_1001220
838 Ga0209129_1000363
839 Ga0209233_1000078
840 Ga0209565_1000427
841 Ga0209455_1014725
842 Ga0209676_1002287
843 Ga0209676_1010356
844 Ga0209025_1000117
845 Ga0209564_1003622
846 Ga0209564_1005290
847 Ga0209758_1000103
848 Ga0209758_1029405
849 Ga0209050_1000001
850 Ga0209050_1004951
851 Ga0209050_1014423
852 Ga0207426_1009119
853 Ga0209051_1003509
854 Ga0209257_1005036
855 Ga0209257_1005111
856 Ga0207697_10000130
857 Ga0207656_10008971
858 Ga0207642_10032946
859 Ga0207710_10008193
860 Ga0207710_10033001
861 Ga0207688_10132857
862 Ga0207680_10000033
863 Ga0207647_10001366
864 Ga0207647_10005723
865 Ga0207647_10008063
866 Ga0207647_10123078
867 Ga0207645_10000520
868 Ga0207645_10030776
869 Ga0207705_10000018
870 Ga0207705_10000163
871 Ga0207705_10001877
872 Ga0207705_10009458
873 Ga0207705_10277494
874 Ga0207654_10000852
875 Ga0207707_10026421
876 Ga0207707_10079378
877 Ga0207695_10000521
878 Ga0207695_10003499
879 Ga0207695_10015077
880 Ga0207695_10029492
881 Ga0207695_10136608
882 Ga0207671_10000607
883 Ga0207671_10023761
884 Ga0207671_10028062
885 Ga0207660_10089146
886 Ga0207657_10000408
887 Ga0207657_10012810
888 Ga0207657_10016065
889 Ga0207657_10058219
890 Ga0207657_10138453
891 Ga0207657_10160254
892 Ga0207657_10489385
893 Ga0207649_10000199
894 Ga0207649_10005456
895 Ga0207649_10112409
896 Ga0207652_10251142
897 Ga0207652_10328239
898 Ga0207652_10342710
899 Ga0207681_10000002
900 Ga0207694_10004278
901 Ga0207694_10057818
902 Ga0207694_10153631
903 Ga0207650_10097313
904 Ga0207659_10297651
905 Ga0207687_10002396
906 Ga0207687_10009517
907 Ga0207664_10284302
908 Ga0207644_10000002
909 Ga0207644_10031668
910 Ga0207690_10003817
911 Ga0207690_10013220
912 Ga0207690_10049134
913 Ga0207706_10004237
914 Ga0207706_10005782
915 Ga0207706_10016251
916 Ga0207706_10017165
917 Ga0207706_10029979
918 Ga0207706_10036693
919 Ga0207706_10055843
920 Ga0207706_10060294
921 Ga0207686_10001920
922 Ga0207709_10000432
923 Ga0207709_10096414
924 Ga0207704_10000032
925 Ga0207704_10179440
926 Ga0207691_10073708
927 Ga0207711_10029217
928 Ga0207689_10008114
929 Ga0207661_10120942
930 Ga0207667_10000013
931 Ga0207667_10007430
932 Ga0207667_10047477
933 Ga0207667_10088539
934 Ga0207667_10266992
935 Ga0207651_10000001
936 Ga0207712_10000069
937 Ga0207712_10001860
938 Ga0207640_10000050
939 Ga0207640_10084174
940 Ga0207640_10109461
941 Ga0207640_10192816
942 Ga0207640_10278503
943 Ga0207658_10000075
944 Ga0207658_10017969
945 Ga0207677_10001163
946 Ga0207703_10001509
947 Ga0207639_10000138
948 Ga0207639_10003659
949 Ga0207639_10005117
950 Ga0207639_10038650
951 Ga0207639_10205081
952 Ga0207678_10002459
953 Ga0207678_10003700
954 Ga0207678_10021977
955 Ga0207702_10010000
956 Ga0207702_10010202
957 Ga0207702_10012601
958 Ga0207702_10022803
959 Ga0207702_10114116
960 Ga0207641_10000973
961 Ga0207641_10001660
962 Ga0207641_10019831
963 Ga0207648_10001195
964 Ga0207676_10000705
965 Ga0207676_10653108
966 Ga0207674_10003143
967 Ga0207674_10006416
968 Ga0207674_10018492
969 Ga0207674_10059376
970 Ga0207674_10063616
971 Ga0207674_10088996
972 Ga0207674_10732169
973 Ga0207675_100000355
974 Ga0207683_10004967
975 Ga0207683_10268557
976 Ga0207698_10000551
977 Ga0207698_10033092
978 Ga0207698_10174385
979 Ga0207698_10179648
980 Ga0209813_10000063
981 Ga0268266_10000002
982 Ga0268265_10000055
983 Ga0268265_10000361
984 Ga0268265_10892249
985 Ga0268264_10000087
986 Ga0268264_10000116
987 Ga0268264_10000381
988 Ga0307517_10019763
989 Ga0307517_10082933
990 Ga0307408_100024384
991 Ga0307413_10033283
992 Ga0307410_10093588
993 Ga0307410_10125478
994 Ga0307406_10101318
995 Ga0307406_10179361
996 Ga0307412_10000950
997 Ga0307412_10023565
998 Ga0307412_10086127
999 Ga0307412_10186843
1000 Ga0307409_100135470
1001 Ga0307409_100412705
1002 Ga0307409_100736415
1003 Ga0307416_100018666
1004 Ga0307414_10001891
1005 Ga0307414_10112675
1006 Ga0307414_10320199
1007 Ga0307411_10067422
1008 Ga0307411_10551386
1009 Ga0373923_0046343
1010 Ga0316584_0116543
1011 Ga0395899_0002292
1012 Ga0395900_0021625
1013 Ga0395900_0179985
1014 Ga0395905_0016001
1015 Ga0395905_0030594
1016 Ga0395905_0148075
1017 Ga0395905_0584614
1018 Ga0395905_0726545
1019 Ga0436364_0413697
1020 Ga0436364_0530420
1021 Ga0436365_1704067
1022 Ga0451793_1365563
1023 Ga0451802_1527592
1024 Ga0451806_292367
1025 Ga0451807_2051197
1026 Ga0439448_0022377
1027 Ga0439455_0000137
1028 Ga0439458_0000756
1029 Ga0439458_0012507
1030 Ga0439458_0037728
1031 Ga0466972_0010998
1032 Ga0466972_0019619
1033 Ga0466965_0069761
1034 Ga0466961_0002427
1035 Ga0466961_0151817
1036 Ga0466970_0010891
1037 Ga0466957_0086515
1038 Ga0466957_0131832
1039 Ga0466960_0002678
1040 Ga0466959_0000595
1041 Ga0466958_0090108
1042 Ga0466958_0095266
1043 Ga0495617_035157
1044 Ga0495627_000193
1045 Ga0495627_000478
1046 Ga0495638_0000011
1047 Ga0495650_0000373
1048 Ga0495650_0006527
1049 Ga0495650_0049726
1050 Ga0495584_0074512
1051 Ga0495583_0000305
1052 Ga0495583_0002224
1053 Ga0495583_0011527
1054 Ga0495583_0063366
1055 Ga0495606_0000591
1056 Ga0495606_0008930
1057 Ga0495606_0149671
1058 Ga0495610_0001092
1059 Ga0495616_0000018
1060 Ga0495631_0026785
1061 Ga0495632_0000042
1062 Ga0495632_0000538
1063 Ga0495637_0000626
1064 Ga0495637_0019775
1065 Ga0495637_0020613
1066 Ga0495643_0000005
1067 Ga0495648_0000023
1068 Ga0495648_0000115
1069 Ga0495648_0009282
1070 Ga0495663_0000015
1071 Ga0495663_0004526
1072 Ga0495587_0195933
1073 Ga0495622_0006174
1074 Ga0495633_0000197
1075 Ga0495633_0000262
1076 Ga0495633_0002581
1077 Ga0495633_0011568
1078 Ga0495633_0038543
1079 Ga0495633_0044808
1080 Ga0495668_0014245
1081 Ga0495668_0173497
1082 Ga0495611_0044505
1083 Ga0495611_0111175
1084 Ga0495625_0000959
1085 Ga0495625_0003788
1086 Ga0495625_0133328
1087 Ga0495625_0165586
1088 Ga0495661_0101759
1089 Ga0495669_0000268
1090 Ga0495671_0000007
1091 Ga0495671_0000012
1092 Ga0495671_0007760
1093 Ga0495600_0015371
1094 Ga0495660_0071088
1095 Ga0495672_0227828
1096 Ga0495683_0131357
1097 Ga0495677_0045964
1098 Ga0495673_0000029
1099 Ga0495681_0000032
1100 Ga0495686_0000149
1101 Ga0495686_0008181
1102 Ga0495686_0008478
1103 Ga0495686_0009317
1104 Ga0495686_0022254
1105 Ga0495686_0093226
1106 Ga0495686_0098955
1107 Ga0495686_0246744
1108 Ga0496102_0000049
1109 Ga0496102_0123199
1110 Ga0496103_0000037
1111 Ga0496108_0018131
1112 Ga0496110_0069636
1113 Ga0496115_0019493
1114 Ga0496116_0000664
1115 Ga0496116_0059042
1116 Ga0496117_0000115
1117 Ga0496117_0048676
1118 Ga0496117_0066120
1119 Ga0496117_0084565
1120 Ga0496117_0111413
1121 Ga0496118_0000086
1122 Ga0496118_0024617
1123 Ga0496118_0038779
1124 Ga0496118_0067935
1125 Ga0496118_0117603
1126 Ga0496119_0026037
1127 Ga0496120_0043762
1128 Ga0496120_0056749
1129 Ga0496121_0000208
1130 Ga0496121_0000237
1131 Ga0496121_0006256
1132 Ga0496121_0010863
1133 Ga0496121_0021861
1134 Ga0496121_0356664
1135 Ga0496122_0000970
1136 Ga0496122_0009733
1137 Ga0496122_0010014
1138 Ga0496122_0046575
1139 Ga0496122_0049081
1140 Ga0496123_0000286
1141 Ga0496123_0004476
1142 Ga0496123_0010752
1143 Ga0496123_0014617
1144 Ga0496123_0015139
1145 Ga0496124_0000102
1146 Ga0496124_0000510
1147 Ga0496124_0002035
1148 Ga0496124_0002045
1149 Ga0496124_0009343
1150 Ga0496124_0027789
1151 Ga0496124_0054093
1152 Ga0496124_0070937
1153 Ga0496124_0090087
1154 Ga0496124_0154889
1155 Ga0496125_0022011
1156 Ga0496125_0128582
1157 Ga0496126_0047987
1158 Ga0496126_0317127
1159 Ga0495678_029037
1160 Ga0495682_0052089
1161 Ga0501290_001795
1162 Ga0501290_005576
1163 Ga0501292_000008
1164 Ga0501294_001311
1165 Ga0501300_000363
1166 Ga0501335_000124
1167 Ga0501036_0612885
1168 Ga0501223_000368
1169 Ga0501233_004089
1170 Ga0501235_000385
1171 Ga0501235_001136
1172 Ga0501236_021268
1173 Ga0501257_001545
1174 Ga0501257_007205
1175 Ga0501259_000518
1176 Ga0501261_000020
1177 Ga0501225_0000786
1178 Ga0501279_000002
1179 Ga0501280_000010
1180 Ga0501280_004171
1181 Ga0501282_000295
1182 Ga0501283_001354
1183 nmdc:mga03n38_46054_c1
1184 nmdc:mga06z11_27_c1
1185 nmdc:mga04h51_147_c1
1186 nmdc:mga07m45_138208_c1
1187 nmdc:mga07m45_18564_c1
1188 Ga0500643_000081
1189 Ga0500643_000306
1190 Ga0500643_011202
1191 Ga0500643_024242
1192 Ga0500555_000444
1193 Ga0500556_0000074
1194 Ga0500562_024231
1195 Ga0500594_0024835
1196 Ga0500595_004504
1197 Ga0500597_018671
1198 Ga0500608_007974
1199 Ga0500608_026077
1200 Ga0500642_0000002
1201 Ga0500642_0000116
1202 Ga0500559_0068599
1203 Ga0500573_0000046
1204 Ga0500573_0245911
1205 Ga0500616_0007580
1206 Ga0500624_000044
1207 Ga0500624_000053
1208 Ga0500627_0002055
1209 Ga0500636_0028474
1210 Ga0500637_0000008
1211 Ga0500645_000009
1212 Ga0500645_000439
1213 Ga0500596_002809
1214 Ga0500661_000082
1215 Ga0466962_0008633
1216 Ga0466962_0158351
1217 Ga0466962_0182140
1218 2512644701
1219 2600226338
1220 2643950309
1221 2778123872
1222 2809062205
1223 2809078455
1224 2809082594
1225 2819712418
1226 2830077902
1227 2848299367
1228 2880518988
1229 2896186827
1230 2896254590
1231 2919711732
1232 2928526928
1233 2928969467
1234 8057101752

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01507

PAPS_reduct

Phosphoadenosine phosphosulfate reductase family

97

266

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lhs-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.8819 19 220
7lhu-assembly1.cif.gz_A crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp 0.8752 19 218
2goy-assembly2.cif.gz_E crystal structure of assimilatory adenosine 5'-phosphosulfate reductase with bound aps 0.8737 17 230
7lhu-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp 0.8723 19 220
1sur-assembly1.cif.gz_A-2 phospho-adenylyl-sulfate reductase 0.8667 17 212
ID Description Score Start End Superfamily
2goyE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8737 17 230 3.40.50.620
af_P17854_2_216_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8684 17 212 3.40.50.620
af_P9WIK3_10_254_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8526 19 243 3.40.50.620
2goyE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8407 17 230 3.40.50.620
2oq2D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.818 17 239 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A5R2N3D8-F1-model_v4 Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) 0.9533 62 224 GO:0004604
GO:0005737
GO:0019379
AF-A0A436FC25-F1-model_v4 deleted 0.9442 19 220
AF-A0A5R2N3D8-F1-model_v4 Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) 0.9365 62 224 GO:0004604
GO:0005737
GO:0019379
AF-A0A3D2F615-F1-model_v4 Phosphoadenylyl-sulfate reductase 0.9314 19 225 GO:0004604
GO:0005737
GO:0019379
AF-A0A2A4LKB0-F1-model_v4 Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) 0.9309 18 240 GO:0004604
GO:0005737
GO:0019379
GO:0043866
GO:0046872
GO:0051539
GO:0070814

Map