F469618

General Info

Members Datasets Scaffolds Average Seq Length
617 235 616 269

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100010914|Ga0068855_10001091412
Length 315
Sequence MSGMKKLRFQERLIDPRSPDRSPRRAAYALPTLFTAGNVFLGFYSIMEAFRGALVNAQVNGSAASSGHFRAAAIAIGVAVFLDGLDGRIARLTKTVSDFGREMDSLADVISFGIAPAVLAYAWGIEFASSPPAPITVEHLHRAGYFCAFLFLLCGALRLARFNVQVNPVPKNPGRADRKYFVGMPIPAAAGMVASVVYAFAGEGPLNWWVFSTGWLALLGLLAFLMVSTWRYPSFKDLKVMRPRSPVTFVVLSIIIYLIWNSSEEMLLGMSLCYVLSGIVLRAGGIIRRHLRHSQTVPEPRPEQHLEXXXEHRGG

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
190 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.16
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 2.43
Rhizosphere 97.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10098614 3300005290 Unclassified 2114
2 Ga0065715_10002822 3300005293 Bacteria 4621
3 Ga0070658_10007552 3300005327 Bacteria 8773
4 Ga0070676_10000214 3300005328 Bacteria 24753
5 Ga0070676_10000744 3300005328 Bacteria 16010
6 Ga0070676_10012894 3300005328 Bacteria 4577
7 Ga0070683_100002435 3300005329 Bacteria 14799
8 Ga0070683_100035308 3300005329 Bacteria 4570
9 Ga0070683_100064293 3300005329 Bacteria 3415
10 Ga0070683_100178411 3300005329 Bacteria 2016
11 Ga0070683_100504835 3300005329 Unclassified 1155
12 Ga0070683_100762682 3300005329 Bacteria 927
13 Ga0070690_100056652 3300005330 Bacteria 2514
14 Ga0070670_100020386 3300005331 Bacteria 5698
15 Ga0070670_100057020 3300005331 Bacteria 3353
16 Ga0070677_10055764 3300005333 Bacteria 1614
17 Ga0068869_100001409 3300005334 Bacteria 14226
18 Ga0068869_100105043 3300005334 Unclassified 2141
19 Ga0068869_100119969 3300005334 Bacteria 2010
20 Ga0068869_100218695 3300005334 Unclassified 1509
21 Ga0070666_10001863 3300005335 Bacteria 12837
22 Ga0070666_10002466 3300005335 Bacteria 11191
23 Ga0070666_10043741 3300005335 Bacteria 3000
24 Ga0070666_10092606 3300005335 Bacteria 2078
25 Ga0070666_10095760 3300005335 Bacteria 2043
26 Ga0070680_100021671 3300005336 Bacteria 5109
27 Ga0068868_100000956 3300005338 Bacteria 19655
28 Ga0068868_100018850 3300005338 Bacteria 5164
29 Ga0068868_100101993 3300005338 Unclassified 2323
30 Ga0068868_100377372 3300005338 Bacteria 1219
31 Ga0068868_100609959 3300005338 Unclassified 968
32 Ga0070689_100125324 3300005340 Bacteria 2055
33 Ga0070689_100151973 3300005340 Bacteria 1867
34 Ga0070691_10001053 3300005341 Bacteria 11382
35 Ga0070687_100344423 3300005343 Bacteria 960
36 Ga0070661_100118153 3300005344 Bacteria 1984
37 Ga0070661_100172595 3300005344 Bacteria 1642
38 Ga0070692_10104064 3300005345 Bacteria 1560
39 Ga0070692_10258779 3300005345 Bacteria 1045
40 Ga0070668_100001309 3300005347 Bacteria 17812
41 Ga0070668_100002354 3300005347 Bacteria 13893
42 Ga0070668_100004138 3300005347 Bacteria 10745
43 Ga0070668_100015782 3300005347 Bacteria 5651
44 Ga0070668_100118670 3300005347 Bacteria 2112
45 Ga0070668_100540809 3300005347 Bacteria 1013
46 Ga0070669_100002295 3300005353 Bacteria 13863
47 Ga0070669_100016540 3300005353 Bacteria 5265
48 Ga0070669_100023860 3300005353 Bacteria 4383
49 Ga0070669_100073180 3300005353 Bacteria 2538
50 Ga0070669_100158883 3300005353 Bacteria 1755
51 Ga0070675_100006756 3300005354 Bacteria 8815
52 Ga0070675_100017902 3300005354 Bacteria 5635
53 Ga0070675_100090535 3300005354 Bacteria 2562
54 Ga0070675_100203436 3300005354 Bacteria 1719
55 Ga0070671_100001313 3300005355 Bacteria 18668
56 Ga0070671_100002406 3300005355 Bacteria 14465
57 Ga0070671_100025305 3300005355 Bacteria 4869
58 Ga0070671_100102418 3300005355 Bacteria 2403
59 Ga0070674_100000512 3300005356 Bacteria 19432
60 Ga0070674_100058203 3300005356 Bacteria 2686
61 Ga0070673_100000982 3300005364 Bacteria 16193
62 Ga0070673_100006169 3300005364 Bacteria 7769
63 Ga0070673_100139957 3300005364 Bacteria 2040
64 Ga0070688_100122157 3300005365 Bacteria 1746
65 Ga0070667_100000924 3300005367 Bacteria 27115
66 Ga0070667_100005521 3300005367 Bacteria 10561
67 Ga0070667_100009247 3300005367 Bacteria 8163
68 Ga0070667_100045932 3300005367 Bacteria 3674
69 Ga0070667_100243404 3300005367 Bacteria 1607
70 Ga0070667_100316735 3300005367 Bacteria 1407
71 Ga0070667_100394483 3300005367 Bacteria 1259
72 Ga0070667_100555799 3300005367 Bacteria 1055
73 Ga0070713_100028074 3300005436 Unclassified 4440
74 Ga0070711_100041168 3300005439 Unclassified 3119
75 Ga0070711_100324792 3300005439 Bacteria 1230
76 Ga0070700_100021418 3300005441 Bacteria 3758
77 Ga0070700_100120579 3300005441 Bacteria 1757
78 Ga0070700_100219177 3300005441 Bacteria 1347
79 Ga0070694_100118658 3300005444 Bacteria 1895
80 Ga0070708_100000095 3300005445 Bacteria 58224
81 Ga0070708_100024010 3300005445 Bacteria 5192
82 Ga0070678_100000282 3300005456 Bacteria 23627
83 Ga0070678_100005918 3300005456 Bacteria 7112
84 Ga0070678_100074836 3300005456 Bacteria 2546
85 Ga0070662_100175954 3300005457 Bacteria 1684
86 Ga0070681_10004209 3300005458 Bacteria 13630
87 Ga0070681_10076738 3300005458 Bacteria 3299
88 Ga0070681_10135250 3300005458 Unclassified 2396
89 Ga0068867_100000370 3300005459 Bacteria 29942
90 Ga0068867_100004639 3300005459 Bacteria 9670
91 Ga0068867_100016319 3300005459 Bacteria 5273
92 Ga0068867_100086360 3300005459 Bacteria 2374
93 Ga0068867_100260213 3300005459 Bacteria 1414
94 Ga0068867_100288402 3300005459 Unclassified 1348
95 Ga0070685_10157149 3300005466 Bacteria 1446
96 Ga0070685_10221262 3300005466 Unclassified 1240
97 Ga0070707_100095184 3300005468 Bacteria 2884
98 Ga0070679_100000612 3300005530 Bacteria 30367
99 Ga0070684_100017879 3300005535 Bacteria 5827
100 Ga0070684_100059944 3300005535 Bacteria 3327
101 Ga0070684_100073901 3300005535 Bacteria 3005
102 Ga0070684_100075890 3300005535 Bacteria 2966
103 Ga0070684_100128717 3300005535 Bacteria 2283
104 Ga0070684_100144316 3300005535 Bacteria 2154
105 Ga0070697_100046790 3300005536 Bacteria 3507
106 Ga0070697_100225619 3300005536 Unclassified 1597
107 Ga0068853_100005007 3300005539 Bacteria 10327
108 Ga0068853_100018850 3300005539 Bacteria 5715
109 Ga0068853_100093604 3300005539 Bacteria 2646
110 Ga0068853_100119234 3300005539 Bacteria 2352
111 Ga0070672_100000702 3300005543 Bacteria 19821
112 Ga0070672_100001211 3300005543 Bacteria 15809
113 Ga0070672_100021026 3300005543 Bacteria 4770
114 Ga0070672_100132355 3300005543 Bacteria 2051
115 Ga0070672_100325111 3300005543 Bacteria 1308
116 Ga0070686_100403753 3300005544 Bacteria 1040
117 Ga0070695_100036536 3300005545 Bacteria 3092
118 Ga0070695_100467822 3300005545 Bacteria 969
119 Ga0070696_100484532 3300005546 Bacteria 981
120 Ga0070665_100001475 3300005548 Bacteria 27559
121 Ga0070665_100008751 3300005548 Bacteria 10246
122 Ga0070665_100028310 3300005548 Bacteria 5644
123 Ga0070665_100062056 3300005548 Bacteria 3748
124 Ga0070665_100772181 3300005548 Bacteria 974
125 Ga0068855_100010914 3300005563 Bacteria 10964
126 Ga0068855_100027751 3300005563 Bacteria 6774
127 Ga0068855_100035090 3300005563 Bacteria 5975
128 Ga0068855_100214839 3300005563 Bacteria 2159
129 Ga0070664_100030275 3300005564 Bacteria 4515
130 Ga0070664_100536322 3300005564 Bacteria 1081
131 Ga0068857_100001603 3300005577 Bacteria 18170
132 Ga0068857_100005197 3300005577 Bacteria 11078
133 Ga0068857_100006413 3300005577 Bacteria 10087
134 Ga0068857_100073134 3300005577 Bacteria 3054
135 Ga0068857_100286120 3300005577 Bacteria 1517
136 Ga0068856_100003926 3300005614 Bacteria 14901
137 Ga0068856_100020338 3300005614 Bacteria 6448
138 Ga0068856_100040996 3300005614 Bacteria 4549
139 Ga0068856_100111516 3300005614 Unclassified 2733
140 Ga0068856_100312862 3300005614 Unclassified 1588
141 Ga0068856_100360191 3300005614 Bacteria 1473
142 Ga0070702_100027615 3300005615 Bacteria 3065
143 Ga0068852_100137889 3300005616 Bacteria 2254
144 Ga0068852_100406230 3300005616 Bacteria 1341
145 Ga0068859_100000699 3300005617 Bacteria 33623
146 Ga0068859_100008649 3300005617 Bacteria 10287
147 Ga0068859_100013055 3300005617 Bacteria 8346
148 Ga0068859_100043832 3300005617 Bacteria 4496
149 Ga0068864_100004467 3300005618 Bacteria 11496
150 Ga0068864_100004480 3300005618 Bacteria 11482
151 Ga0068864_100010673 3300005618 Bacteria 7591
152 Ga0068864_100043086 3300005618 Bacteria 3863
153 Ga0068864_100076752 3300005618 Bacteria 2921
154 Ga0068864_100267184 3300005618 Bacteria 1593
155 Ga0068861_100005974 3300005719 Bacteria 8270
156 Ga0068861_100016924 3300005719 Bacteria 5169
157 Ga0068861_100191416 3300005719 Bacteria 1710
158 Ga0068851_10001244 3300005834 Bacteria 11077
159 Ga0068870_10015375 3300005840 Bacteria 3629
160 Ga0068870_10070205 3300005840 Bacteria 1908
161 Ga0068863_100026884 3300005841 Bacteria 5487
162 Ga0068863_100041743 3300005841 Bacteria 4361
163 Ga0068863_100063565 3300005841 Unclassified 3491
164 Ga0068863_100120499 3300005841 Bacteria 2501
165 Ga0068863_100141809 3300005841 Bacteria 2297
166 Ga0068863_100291449 3300005841 Bacteria 1582
167 Ga0068858_100002586 3300005842 Bacteria 18225
168 Ga0068858_100003832 3300005842 Bacteria 14871
169 Ga0068858_100005571 3300005842 Bacteria 12319
170 Ga0068858_100066655 3300005842 Bacteria 3333
171 Ga0068860_100001362 3300005843 Bacteria 26563
172 Ga0068860_100004465 3300005843 Bacteria 14276
173 Ga0068860_100019076 3300005843 Bacteria 6658
174 Ga0068860_100020844 3300005843 Bacteria 6350
175 Ga0068860_100022951 3300005843 Bacteria 6034
176 Ga0068860_100108841 3300005843 Bacteria 2648
177 Ga0068862_100010906 3300005844 Bacteria 7504
178 Ga0068862_100208403 3300005844 Bacteria 1765
179 Ga0068862_100259471 3300005844 Bacteria 1586
180 Ga0068862_100367609 3300005844 Bacteria 1338
181 Ga0068862_100379991 3300005844 Bacteria 1317
182 Ga0081539_10017668 3300005985 Bacteria 4994
183 Ga0081539_10118004 3300005985 Bacteria 1323
184 Ga0070716_100260117 3300006173 Bacteria 1187
185 Ga0097621_100010973 3300006237 Bacteria 6653
186 Ga0097621_100014731 3300006237 Bacteria 5861
187 Ga0097621_100033584 3300006237 Bacteria 4087
188 Ga0097621_100122763 3300006237 Bacteria 2205
189 Ga0068871_100003161 3300006358 Bacteria 11309
190 Ga0068871_100010975 3300006358 Bacteria 6635
191 Ga0068871_100021521 3300006358 Unclassified 4958
192 Ga0068871_100074379 3300006358 Bacteria 2802
193 Ga0068871_100077785 3300006358 Unclassified 2742
194 Ga0068871_100101896 3300006358 Bacteria 2406
195 Ga0068871_100153711 3300006358 Bacteria 1963
196 Ga0068871_100160487 3300006358 Bacteria 1922
197 Ga0075428_100164630 3300006844 Bacteria 2406
198 Ga0075430_100212050 3300006846 Bacteria 1607
199 Ga0075430_100250193 3300006846 Bacteria 1469
200 Ga0075431_100034136 3300006847 Bacteria 5242
201 Ga0075431_100617767 3300006847 Unclassified 1066
202 Ga0075433_10712388 3300006852 Bacteria 879
203 Ga0075434_100175465 3300006871 Unclassified 2163
204 Ga0075434_100299970 3300006871 Bacteria 1627
205 Ga0075434_100342042 3300006871 Unclassified 1517
206 Ga0068865_100002004 3300006881 Bacteria 12013
207 Ga0068865_100012322 3300006881 Bacteria 5378
208 Ga0068865_100099901 3300006881 Bacteria 2122
209 Ga0068865_100132725 3300006881 Bacteria 1867
210 Ga0097620_100000699 3300006931 Bacteria 33623
211 Ga0097620_100008648 3300006931 Bacteria 10287
212 Ga0097620_100013055 3300006931 Bacteria 8346
213 Ga0097620_100043834 3300006931 Bacteria 4496
214 Ga0099794_10078937 3300007265 Bacteria 1621
215 Ga0105240_10003072 3300009093 Bacteria 26221
216 Ga0105240_10006331 3300009093 Bacteria 17426
217 Ga0105240_10356090 3300009093 Bacteria 1659
218 Ga0105240_10423982 3300009093 Unclassified 1494
219 Ga0105240_10617752 3300009093 Bacteria 1191
220 Ga0105245_10007372 3300009098 Bacteria 9630
221 Ga0105245_10021118 3300009098 Bacteria 5710
222 Ga0105245_10041917 3300009098 Bacteria 4082
223 Ga0105245_10086488 3300009098 Bacteria 2875
224 Ga0105245_10096639 3300009098 Bacteria 2726
225 Ga0105245_10399147 3300009098 Bacteria 1374
226 Ga0105247_10081875 3300009101 Bacteria 2036
227 Ga0114129_10442840 3300009147 Bacteria 1705
228 Ga0114129_10727682 3300009147 Bacteria 1272
229 Ga0105243_10018342 3300009148 Bacteria 5299
230 Ga0105243_10026040 3300009148 Bacteria 4475
231 Ga0105243_10044977 3300009148 Bacteria 3467
232 Ga0105243_10327737 3300009148 Bacteria 1398
233 Ga0105243_10384035 3300009148 Bacteria 1300
234 Ga0105241_10014364 3300009174 Bacteria 5799
235 Ga0105241_10015901 3300009174 Bacteria 5513
236 Ga0105241_10157181 3300009174 Bacteria 1865
237 Ga0105242_10006033 3300009176 Bacteria 9343
238 Ga0105242_10014802 3300009176 Bacteria 6041
239 Ga0105242_10039676 3300009176 Bacteria 3790
240 Ga0105242_10042767 3300009176 Bacteria 3661
241 Ga0105248_10006770 3300009177 Bacteria 12566
242 Ga0105248_10016872 3300009177 Bacteria 8038
243 Ga0105248_10046067 3300009177 Bacteria 4888
244 Ga0105248_10173168 3300009177 Bacteria 2433
245 Ga0105248_10220507 3300009177 Bacteria 2135
246 Ga0105237_10001777 3300009545 Bacteria 27878
247 Ga0105237_10056538 3300009545 Bacteria 3927
248 Ga0105237_10648597 3300009545 Bacteria 1062
249 Ga0105238_10000877 3300009551 Bacteria 31045
250 Ga0105238_10055769 3300009551 Bacteria 3966
251 Ga0105238_10066320 3300009551 Unclassified 3611
252 Ga0105238_10111340 3300009551 Bacteria 2718
253 Ga0105238_10118574 3300009551 Bacteria 2627
254 Ga0105249_10024386 3300009553 Bacteria 5436
255 Ga0105249_10219685 3300009553 Unclassified 1869
256 Ga0105239_10000747 3300010375 Bacteria 46191
257 Ga0105239_10031334 3300010375 Bacteria 5849
258 Ga0105239_10058124 3300010375 Bacteria 4243
259 Ga0105239_10109797 3300010375 Bacteria 3057
260 Ga0105239_10148216 3300010375 Bacteria 2618
261 Ga0105239_10166377 3300010375 Bacteria 2466
262 Ga0105246_10334658 3300011119 Bacteria 1235
263 Ga0105246_10375907 3300011119 Bacteria 1172
264 Ga0105246_10434366 3300011119 Bacteria 1099
265 Ga0157373_10343366 3300013100 Bacteria 1064
266 Ga0157370_10000541 3300013104 Bacteria 47240
267 Ga0157370_10008207 3300013104 Bacteria 11283
268 Ga0157370_10187984 3300013104 Bacteria 1917
269 Ga0157369_10002365 3300013105 Bacteria 22675
270 Ga0157369_10007625 3300013105 Bacteria 12449
271 Ga0157369_10082731 3300013105 Bacteria 3434
272 Ga0157374_10002543 3300013296 Bacteria 15382
273 Ga0157374_10081556 3300013296 Bacteria 3070
274 Ga0157374_10128292 3300013296 Bacteria 2453
275 Ga0157374_10169193 3300013296 Bacteria 2131
276 Ga0157374_10290572 3300013296 Bacteria 1615
277 Ga0157378_10001312 3300013297 Bacteria 22366
278 Ga0157378_10006711 3300013297 Bacteria 10058
279 Ga0157378_10121952 3300013297 Bacteria 2404
280 Ga0157378_10135993 3300013297 Bacteria 2279
281 Ga0157378_10158675 3300013297 Bacteria 2114
282 Ga0157378_10590840 3300013297 Bacteria 1120
283 Ga0163162_10038134 3300013306 Bacteria 4796
284 Ga0163162_10054236 3300013306 Bacteria 4032
285 Ga0163162_10221977 3300013306 Bacteria 2020
286 Ga0163162_10294652 3300013306 Bacteria 1754
287 Ga0163162_10337052 3300013306 Bacteria 1640
288 Ga0163162_10568807 3300013306 Bacteria 1261
289 Ga0163162_11203578 3300013306 Bacteria 860
290 Ga0157372_10001898 3300013307 Bacteria 22682
291 Ga0157372_10023617 3300013307 Bacteria 6670
292 Ga0157372_10026052 3300013307 Bacteria 6360
293 Ga0157372_10041273 3300013307 Bacteria 5101
294 Ga0157372_10087373 3300013307 Unclassified 3538
295 Ga0157372_10235294 3300013307 Bacteria 2124
296 Ga0157372_10464433 3300013307 Bacteria 1475
297 Ga0157375_10003822 3300013308 Bacteria 13062
298 Ga0157375_10030435 3300013308 Bacteria 5090
299 Ga0157375_10133807 3300013308 Bacteria 2601
300 Ga0157375_10356999 3300013308 Bacteria 1628
301 Ga0163163_10003550 3300014325 Bacteria 13246
302 Ga0163163_10051305 3300014325 Bacteria 4067
303 Ga0163163_10122949 3300014325 Bacteria 2630
304 Ga0163163_10128831 3300014325 Bacteria 2570
305 Ga0157380_10026051 3300014326 Bacteria 4439
306 Ga0157380_10036364 3300014326 Bacteria 3809
307 Ga0157380_10225226 3300014326 Bacteria 1680
308 Ga0157377_10482063 3300014745 Bacteria 863
309 Ga0157379_10000544 3300014968 Bacteria 30401
310 Ga0157379_10000731 3300014968 Bacteria 26584
311 Ga0157379_10001556 3300014968 Bacteria 18887
312 Ga0157379_10002150 3300014968 Bacteria 16353
313 Ga0157379_10191718 3300014968 Bacteria 1847
314 Ga0157379_10256845 3300014968 Bacteria 1587
315 Ga0157376_10026202 3300014969 Bacteria 4604
316 Ga0157376_10102284 3300014969 Bacteria 2506
317 Ga0157376_10111287 3300014969 Bacteria 2411
318 Ga0157376_10185863 3300014969 Bacteria 1903
319 Ga0157376_10335145 3300014969 Bacteria 1443
320 Ga0163161_10010634 3300017792 Bacteria 6372
321 Ga0163161_10109010 3300017792 Bacteria 2068
322 Ga0224712_10052799 3300022467 Unclassified 1589
323 Ga0207697_10017307 3300025315 Bacteria 2962
324 Ga0207656_10006229 3300025321 Bacteria 4275
325 Ga0207642_10090256 3300025899 Bacteria 1512
326 Ga0207680_10002195 3300025903 Bacteria 9141
327 Ga0207680_10005666 3300025903 Bacteria 5978
328 Ga0207680_10030894 3300025903 Bacteria 3028
329 Ga0207645_10000629 3300025907 Bacteria 29266
330 Ga0207645_10001172 3300025907 Bacteria 21640
331 Ga0207645_10010234 3300025907 Bacteria 6447
332 Ga0207643_10077635 3300025908 Bacteria 1920
333 Ga0207654_10004304 3300025911 Bacteria 7177
334 Ga0207654_10061634 3300025911 Bacteria 2195
335 Ga0207707_10006840 3300025912 Bacteria 9945
336 Ga0207707_10083672 3300025912 Bacteria 2786
337 Ga0207695_10001608 3300025913 Bacteria 36608
338 Ga0207695_10003203 3300025913 Bacteria 23317
339 Ga0207695_10367946 3300025913 Bacteria 1324
340 Ga0207671_10035157 3300025914 Bacteria 3720
341 Ga0207671_10154841 3300025914 Bacteria 1772
342 Ga0207663_10257330 3300025916 Bacteria 1288
343 Ga0207660_10031200 3300025917 Bacteria 3668
344 Ga0207660_10238790 3300025917 Bacteria 1431
345 Ga0207660_10418717 3300025917 Bacteria 1080
346 Ga0207662_10123005 3300025918 Bacteria 1629
347 Ga0207657_10020130 3300025919 Bacteria 6314
348 Ga0207649_10111434 3300025920 Bacteria 1829
349 Ga0207649_10173362 3300025920 Bacteria 1504
350 Ga0207652_10001546 3300025921 Bacteria 20278
351 Ga0207681_10013271 3300025923 Bacteria 5094
352 Ga0207681_10423681 3300025923 Bacteria 1079
353 Ga0207694_10014055 3300025924 Bacteria 6037
354 Ga0207694_10017415 3300025924 Bacteria 5431
355 Ga0207694_10123788 3300025924 Bacteria 2066
356 Ga0207650_10039539 3300025925 Bacteria 3447
357 Ga0207650_10061297 3300025925 Bacteria 2808
358 Ga0207659_10000389 3300025926 Bacteria 26469
359 Ga0207659_10012567 3300025926 Bacteria 5392
360 Ga0207687_10001649 3300025927 Bacteria 15404
361 Ga0207687_10002739 3300025927 Bacteria 11941
362 Ga0207687_10109779 3300025927 Bacteria 2044
363 Ga0207687_10159368 3300025927 Bacteria 1730
364 Ga0207687_10391452 3300025927 Bacteria 1141
365 Ga0207644_10001001 3300025931 Bacteria 18052
366 Ga0207644_10002499 3300025931 Bacteria 11837
367 Ga0207644_10079989 3300025931 Bacteria 2413
368 Ga0207644_10182449 3300025931 Bacteria 1646
369 Ga0207644_10215059 3300025931 Bacteria 1521
370 Ga0207644_10232415 3300025931 Bacteria 1465
371 Ga0207706_10064657 3300025933 Bacteria 3221
372 Ga0207706_10146275 3300025933 Bacteria 2079
373 Ga0207686_10031322 3300025934 Bacteria 3156
374 Ga0207686_10037806 3300025934 Bacteria 2916
375 Ga0207709_10041500 3300025935 Bacteria 2761
376 Ga0207709_10329137 3300025935 Bacteria 1146
377 Ga0207669_10003730 3300025937 Bacteria 6623
378 Ga0207669_10069764 3300025937 Bacteria 2201
379 Ga0207704_10005842 3300025938 Bacteria 5693
380 Ga0207704_10019109 3300025938 Bacteria 3593
381 Ga0207704_10026286 3300025938 Bacteria 3191
382 Ga0207704_10078673 3300025938 Bacteria 2122
383 Ga0207704_10260174 3300025938 Bacteria 1308
384 Ga0207691_10000458 3300025940 Bacteria 40362
385 Ga0207691_10000463 3300025940 Bacteria 40122
386 Ga0207691_10083125 3300025940 Bacteria 2875
387 Ga0207691_10086928 3300025940 Bacteria 2805
388 Ga0207711_10004168 3300025941 Bacteria 12376
389 Ga0207711_10012463 3300025941 Bacteria 7065
390 Ga0207711_10016630 3300025941 Bacteria 6108
391 Ga0207711_10031821 3300025941 Bacteria 4456
392 Ga0207711_10059627 3300025941 Bacteria 3286
393 Ga0207711_10774826 3300025941 Bacteria 894
394 Ga0207689_10001557 3300025942 Bacteria 21753
395 Ga0207689_10005214 3300025942 Bacteria 11665
396 Ga0207689_10007663 3300025942 Bacteria 9454
397 Ga0207689_10007904 3300025942 Bacteria 9290
398 Ga0207689_10041911 3300025942 Unclassified 3788
399 Ga0207689_10088834 3300025942 Bacteria 2538
400 Ga0207689_10416514 3300025942 Bacteria 1121
401 Ga0207661_10003225 3300025944 Bacteria 11305
402 Ga0207661_10007078 3300025944 Bacteria 7966
403 Ga0207661_10070713 3300025944 Bacteria 2849
404 Ga0207679_10062672 3300025945 Bacteria 2772
405 Ga0207667_10000761 3300025949 Bacteria 41908
406 Ga0207667_10030469 3300025949 Bacteria 5836
407 Ga0207667_10042546 3300025949 Bacteria 4827
408 Ga0207667_10060641 3300025949 Bacteria 3959
409 Ga0207667_10094328 3300025949 Unclassified 3089
410 Ga0207667_10484140 3300025949 Bacteria 1256
411 Ga0207651_10001966 3300025960 Bacteria 9666
412 Ga0207651_10193232 3300025960 Bacteria 1625
413 Ga0207712_10247171 3300025961 Bacteria 1440
414 Ga0207668_10007420 3300025972 Bacteria 6517
415 Ga0207668_10010605 3300025972 Bacteria 5575
416 Ga0207668_10018062 3300025972 Bacteria 4431
417 Ga0207668_10038845 3300025972 Bacteria 3198
418 Ga0207668_10147378 3300025972 Bacteria 1818
419 Ga0207658_10003442 3300025986 Bacteria 11196
420 Ga0207658_10014140 3300025986 Bacteria 5466
421 Ga0207658_10017708 3300025986 Bacteria 4911
422 Ga0207658_10051703 3300025986 Bacteria 3029
423 Ga0207658_10085734 3300025986 Bacteria 2427
424 Ga0207658_10274764 3300025986 Bacteria 1442
425 Ga0207658_10430273 3300025986 Bacteria 1165
426 Ga0207677_10053680 3300026023 Bacteria 2745
427 Ga0207677_10083116 3300026023 Bacteria 2304
428 Ga0207677_10209894 3300026023 Bacteria 1554
429 Ga0207677_10409389 3300026023 Bacteria 1152
430 Ga0207703_10002644 3300026035 Bacteria 15435
431 Ga0207703_10003035 3300026035 Bacteria 14209
432 Ga0207703_10018064 3300026035 Bacteria 5508
433 Ga0207703_10085688 3300026035 Bacteria 2637
434 Ga0207639_10012753 3300026041 Bacteria 5863
435 Ga0207639_10051954 3300026041 Bacteria 3120
436 Ga0207639_10066221 3300026041 Bacteria 2807
437 Ga0207639_10200097 3300026041 Bacteria 1713
438 Ga0207639_10444373 3300026041 Bacteria 1176
439 Ga0207678_10021762 3300026067 Bacteria 5625
440 Ga0207678_10183158 3300026067 Bacteria 1789
441 Ga0207708_10103739 3300026075 Bacteria 2203
442 Ga0207708_10107685 3300026075 Bacteria 2161
443 Ga0207708_10252056 3300026075 Bacteria 1423
444 Ga0207702_10050822 3300026078 Unclassified 3500
445 Ga0207702_10246145 3300026078 Bacteria 1677
446 Ga0207702_10279870 3300026078 Unclassified 1577
447 Ga0207702_10461673 3300026078 Unclassified 1234
448 Ga0207641_10000588 3300026088 Bacteria 39984
449 Ga0207641_10019268 3300026088 Bacteria 5599
450 Ga0207641_10075430 3300026088 Unclassified 2912
451 Ga0207641_10075588 3300026088 Bacteria 2909
452 Ga0207641_10109987 3300026088 Bacteria 2441
453 Ga0207641_10151082 3300026088 Bacteria 2103
454 Ga0207641_10241196 3300026088 Bacteria 1684
455 Ga0207648_10001118 3300026089 Bacteria 30131
456 Ga0207648_10006491 3300026089 Bacteria 11615
457 Ga0207648_10008009 3300026089 Bacteria 10301
458 Ga0207648_10014003 3300026089 Bacteria 7431
459 Ga0207648_10039807 3300026089 Bacteria 4131
460 Ga0207648_10065194 3300026089 Bacteria 3175
461 Ga0207648_10143441 3300026089 Bacteria 2106
462 Ga0207648_10253337 3300026089 Bacteria 1570
463 Ga0207648_10501282 3300026089 Bacteria 1111
464 Ga0207676_10001146 3300026095 Bacteria 19971
465 Ga0207676_10001463 3300026095 Bacteria 17539
466 Ga0207676_10013604 3300026095 Bacteria 5840
467 Ga0207676_10055037 3300026095 Bacteria 3121
468 Ga0207676_10096898 3300026095 Bacteria 2436
469 Ga0207674_10001480 3300026116 Bacteria 30334
470 Ga0207674_10008435 3300026116 Bacteria 11903
471 Ga0207674_10010975 3300026116 Bacteria 10194
472 Ga0207674_10016380 3300026116 Bacteria 8116
473 Ga0207674_10208291 3300026116 Bacteria 1904
474 Ga0207675_100001856 3300026118 Bacteria 21157
475 Ga0207675_100014228 3300026118 Bacteria 7417
476 Ga0207675_100052176 3300026118 Bacteria 3816
477 Ga0207675_100085228 3300026118 Bacteria 2965
478 Ga0207675_100155198 3300026118 Bacteria 2181
479 Ga0207675_100219404 3300026118 Bacteria 1832
480 Ga0207683_10000076 3300026121 Bacteria 77762
481 Ga0207683_10000265 3300026121 Bacteria 46746
482 Ga0207683_10026696 3300026121 Bacteria 4987
483 Ga0207683_10046504 3300026121 Bacteria 3798
484 Ga0207683_10168934 3300026121 Bacteria 1980
485 Ga0207698_10120977 3300026142 Bacteria 2216
486 Ga0268266_10003578 3300028379 Bacteria 15404
487 Ga0268266_10005429 3300028379 Bacteria 11887
488 Ga0268266_10238543 3300028379 Bacteria 1677
489 Ga0268266_10437376 3300028379 Bacteria 1242
490 Ga0268265_10012681 3300028380 Bacteria 5719
491 Ga0268265_10242212 3300028380 Bacteria 1592
492 Ga0268265_10251971 3300028380 Bacteria 1564
493 Ga0268264_10001578 3300028381 Bacteria 21120
494 Ga0268264_10011108 3300028381 Bacteria 7439
495 Ga0268264_10019654 3300028381 Bacteria 5518
496 Ga0268264_10028431 3300028381 Bacteria 4574
497 Ga0268264_10056431 3300028381 Bacteria 3284
498 Ga0268264_10206641 3300028381 Bacteria 1800
499 Ga0268264_11039540 3300028381 Bacteria 826
500 Ga0265324_10027194 3300029957 Bacteria 2021
501 Ga0265330_10000546 3300031235 Bacteria 24652
502 Ga0265332_10001580 3300031238 Bacteria 12481
503 Ga0265325_10014918 3300031241 Bacteria 4381
504 Ga0265329_10002668 3300031242 Bacteria 8033
505 Ga0265331_10001628 3300031250 Bacteria 16386
506 Ga0265327_10009764 3300031251 Bacteria 6863
507 Ga0265316_10016393 3300031344 Bacteria 6427
508 Ga0307408_100013118 3300031548 Bacteria 5501
509 Ga0265314_10001596 3300031711 Bacteria 24926
510 Ga0265314_10010366 3300031711 Bacteria 7780
511 Ga0265342_10012171 3300031712 Bacteria 5835
512 Ga0307405_10007321 3300031731 Bacteria 5506
513 Ga0307413_10011890 3300031824 Bacteria 4304
514 Ga0307413_10089383 3300031824 Bacteria 2001
515 Ga0307413_10184603 3300031824 Bacteria 1491
516 Ga0307410_10034260 3300031852 Bacteria 3287
517 Ga0307410_10042310 3300031852 Bacteria 3010
518 Ga0307406_10129940 3300031901 Bacteria 1766
519 Ga0307407_10011576 3300031903 Bacteria 4205
520 Ga0307412_10031225 3300031911 Bacteria 3362
521 Ga0307409_100083242 3300031995 Bacteria 2593
522 Ga0307409_100427338 3300031995 Bacteria 1272
523 Ga0307416_100001805 3300032002 Bacteria 11892
524 Ga0307416_100007971 3300032002 Bacteria 6784
525 Ga0307414_10031620 3300032004 Bacteria 3475
526 Ga0307411_10000502 3300032005 Bacteria 13711
527 Ga0307415_100043898 3300032126 Bacteria 2985
528 Ga0373926_0029325 3300035083 Bacteria 1934
529 Ga0373934_0007947 3300035086 Bacteria 3947
530 Ga0373953_0026246 3300035117 Bacteria 2231
531 Ga0373954_0006873 3300035118 Bacteria 4967
532 Ga0373954_0082451 3300035118 Bacteria 1537
533 Ga0373957_0020486 3300035120 Bacteria 2337
534 Ga0373931_0064402 3300035691 Bacteria 1984
535 Ga0373927_0078997 3300035695 Bacteria 2131
536 Ga0373933_0015272 3300035724 Bacteria 4280
537 Ga0373933_0073253 3300035724 Bacteria 2086
538 Ga0373947_0039460 3300035725 Bacteria 2809
539 Ga0373937_0006017 3300036401 Bacteria 10443
540 Ga0373937_0071302 3300036401 Bacteria 3204
541 Ga0373937_0122619 3300036401 Bacteria 2423
542 Ga0373937_0147259 3300036401 Bacteria 2205
543 Ga0316582_0064779 3300036647 Bacteria 2352
544 Ga0373925_0020272 3300037068 Bacteria 4838
545 Ga0373925_0021107 3300037068 Bacteria 4745
546 Ga0395901_0091395 3300038443 Bacteria 3186
547 Ga0451807_0539397 3300041486 Bacteria 1355
548 Ga0451807_0720304 3300041486 Bacteria 921
549 Ga0450896_019071 3300042133 Bacteria 997
550 Ga0451577_0000074 3300042876 Bacteria 232698
551 Ga0451577_0000609 3300042876 Bacteria 57625
552 Ga0451577_0020592 3300042876 Bacteria 6049
553 Ga0451577_0034075 3300042876 Bacteria 4592
554 Ga0451577_0259539 3300042876 Bacteria 1573
555 Ga0451577_0312898 3300042876 Bacteria 1423
556 Ga0451577_0616690 3300042876 Bacteria 984
557 Ga0453683_0054172 3300044673 Bacteria 2511
558 Ga0453684_0000348 3300044712 Bacteria 192530
559 Ga0453684_0000482 3300044712 Bacteria 158296
560 Ga0453684_0007245 3300044712 Bacteria 20535
561 Ga0453684_0010417 3300044712 Bacteria 15906
562 Ga0453684_0039475 3300044712 Bacteria 6432
563 Ga0453684_0056211 3300044712 Bacteria 5106
564 Ga0453684_0107360 3300044712 Bacteria 3399
565 Ga0453684_0223602 3300044712 Bacteria 2179
566 Ga0451576_0000166 3300045051 Bacteria 166647
567 Ga0451576_0066838 3300045051 Bacteria 3742
568 Ga0451576_0092353 3300045051 Bacteria 3148
569 Ga0451576_0132523 3300045051 Bacteria 2598
570 Ga0466958_0035860 3300045836 Bacteria 2965
571 Ga0466967_0345176 3300045976 Bacteria 1440
572 Ga0495592_0132501 3300046454 Bacteria 1742
573 Ga0495592_0263243 3300046454 Bacteria 1135
574 Ga0495580_0005245 3300046472 Bacteria 10769
575 Ga0495580_0031495 3300046472 Bacteria 3832
576 Ga0495639_0062232 3300046475 Bacteria 1712
577 Ga0495652_0319420 3300046529 Bacteria 1122
578 Ga0495586_0207647 3300046535 Bacteria 1111
579 Ga0495587_0005484 3300046536 Bacteria 8272
580 Ga0495634_0231945 3300046642 Bacteria 1135
581 Ga0495635_0182367 3300046663 Bacteria 1427
582 Ga0495647_0044690 3300046681 Bacteria 1700
583 Ga0495658_0065163 3300046683 Bacteria 2101
584 Ga0495680_0115028 3300047322 Bacteria 1991
585 Ga0495602_0003716 3300048088 Bacteria 15844
586 Ga0496101_0140229 3300048904 Bacteria 1842
587 Ga0496102_0044624 3300048905 Bacteria 4024
588 Ga0496102_0050962 3300048905 Bacteria 3771
589 Ga0496103_0015226 3300048906 Bacteria 4573
590 Ga0496104_0357666 3300048907 Unclassified 1373
591 Ga0496106_0183712 3300048909 Bacteria 1661
592 Ga0496106_0378574 3300048909 Bacteria 1137
593 Ga0496108_0018065 3300048911 Bacteria 5769
594 Ga0496108_0053364 3300048911 Bacteria 3390
595 Ga0496109_0174272 3300048912 Bacteria 2019
596 Ga0496110_0159148 3300048913 Bacteria 2047
597 Ga0496112_0350842 3300048915 Unclassified 1418
598 Ga0496114_0174820 3300048917 Bacteria 1873
599 Ga0501034_0001644 3300049571 Bacteria 28871
600 Ga0501042_0436134 3300049578 Bacteria 950
601 Ga0501048_0347349 3300049582 Bacteria 1058
602 Ga0501068_0013403 3300049584 Bacteria 4664
603 Ga0501071_0214535 3300049587 Bacteria 1448
604 Ga0501072_0042125 3300049588 Bacteria 3586
605 Ga0501073_0001888 3300049589 Bacteria 15612
606 Ga0501074_0028694 3300049590 Bacteria 4033
607 Ga0501076_0211225 3300049592 Bacteria 1586
608 Ga0501077_0113783 3300049593 Bacteria 1716
609 Ga0501080_0007029 3300049742 Bacteria 10162
610 nmdc:mga05p37_471413_c1 3300050507 Bacteria 1448
611 nmdc:mga0qj67_78738_c1 3300050509 Bacteria 2638
612 nmdc:mga06r32_178181_c1 3300050510 Bacteria 2110
613 nmdc:mga06r32_200229_c1 3300050510 Bacteria 1985
614 nmdc:mga06r32_212250_c1 3300050510 Unclassified 1923
615 nmdc:mga08y16_613491_c1 3300050511 Bacteria 1095
616 Ga0500568_0000760 3300053139 Bacteria 22894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028381 Ga0268264_11039540 Ga0268264_110395401 210
2 3300026118 Ga0207675_100155198 Ga0207675_1001551982 214
3 3300005536 Ga0070697_100046790 Ga0070697_1000467902 216
4 3300041486 Ga0451807_0720304 Ga0451807_0720304_58_867 216
5 3300005345 Ga0070692_10258779 Ga0070692_102587791 219
6 3300025923 Ga0207681_10423681 Ga0207681_104236812 219
7 3300005445 Ga0070708_100024010 Ga0070708_1000240106 220
8 3300042876 Ga0451577_0616690 Ga0451577_0616690_254_958 221
9 3300044712 Ga0453684_0107360 Ga0453684_0107360_2662_3366 221
10 3300014968 Ga0157379_10000731 Ga0157379_1000073127 222
11 3300014969 Ga0157376_10185863 Ga0157376_101858632 222
12 3300014969 Ga0157376_10335145 Ga0157376_103351452 222
13 3300005335 Ga0070666_10095760 Ga0070666_100957602 224
14 3300005548 Ga0070665_100062056 Ga0070665_1000620564 224
15 3300005841 Ga0068863_100120499 Ga0068863_1001204992 224
16 3300013308 Ga0157375_10133807 Ga0157375_101338072 224
17 3300014325 Ga0163163_10128831 Ga0163163_101288313 224
18 3300014968 Ga0157379_10191718 Ga0157379_101917182 224
19 3300005338 Ga0068868_100609959 Ga0068868_1006099591 225
20 3300025931 Ga0207644_10182449 Ga0207644_101824492 225
21 3300026121 Ga0207683_10046504 Ga0207683_100465043 225
22 3300028379 Ga0268266_10238543 Ga0268266_102385432 225
23 3300005459 Ga0068867_100288402 Ga0068867_1002884022 226
24 3300009148 Ga0105243_10384035 Ga0105243_103840352 226
25 3300025935 Ga0207709_10329137 Ga0207709_103291372 226
26 3300025937 Ga0207669_10069764 Ga0207669_100697642 226
27 3300026089 Ga0207648_10065194 Ga0207648_100651942 226
28 3300005618 Ga0068864_100076752 Ga0068864_1000767523 227
29 3300006237 Ga0097621_100014731 Ga0097621_1000147316 227
30 3300006358 Ga0068871_100160487 Ga0068871_1001604872 227
31 3300005367 Ga0070667_100394483 Ga0070667_1003944831 228
32 3300026088 Ga0207641_10109987 Ga0207641_101099872 228
33 3300005548 Ga0070665_100028310 Ga0070665_1000283103 230
34 3300005840 Ga0068870_10070205 Ga0068870_100702052 230
35 3300006237 Ga0097621_100122763 Ga0097621_1001227631 230
36 3300009098 Ga0105245_10041917 Ga0105245_100419174 230
37 3300009101 Ga0105247_10081875 Ga0105247_100818751 230
38 3300009174 Ga0105241_10157181 Ga0105241_101571813 230
39 3300009177 Ga0105248_10016872 Ga0105248_100168724 230
40 3300010375 Ga0105239_10148216 Ga0105239_101482162 230
41 3300025908 Ga0207643_10077635 Ga0207643_100776352 230
42 3300025941 Ga0207711_10016630 Ga0207711_100166304 230
43 3300025942 Ga0207689_10007904 Ga0207689_100079044 230
44 3300026088 Ga0207641_10075588 Ga0207641_100755882 230
45 3300026089 Ga0207648_10501282 Ga0207648_105012822 230
46 3300026118 Ga0207675_100014228 Ga0207675_1000142286 230
47 3300028381 Ga0268264_10056431 Ga0268264_100564312 230
48 3300013306 Ga0163162_10294652 Ga0163162_102946522 231
49 3300025972 Ga0207668_10147378 Ga0207668_101473782 231
50 3300005347 Ga0070668_100540809 Ga0070668_1005408091 232
51 3300049571 Ga0501034_0001644 Ga0501034_0001644_11087_11884 234
52 3300049588 Ga0501072_0042125 Ga0501072_0042125_2764_3561 234
53 iso_pu_bacteria 8002745576 8002746921 234
54 3300005345 Ga0070692_10104064 Ga0070692_101040641 235
55 3300005441 Ga0070700_100021418 Ga0070700_1000214183 235
56 3300005444 Ga0070694_100118658 Ga0070694_1001186581 235
57 3300006881 Ga0068865_100099901 Ga0068865_1000999012 235
58 3300009148 Ga0105243_10044977 Ga0105243_100449772 235
59 3300009176 Ga0105242_10039676 Ga0105242_100396762 235
60 3300025938 Ga0207704_10078673 Ga0207704_100786732 235
61 3300026075 Ga0207708_10103739 Ga0207708_101037392 235
62 3300026089 Ga0207648_10039807 Ga0207648_100398072 235
63 3300005458 Ga0070681_10076738 Ga0070681_100767382 236
64 3300005539 Ga0068853_100018850 Ga0068853_1000188504 236
65 3300005545 Ga0070695_100467822 Ga0070695_1004678221 236
66 3300005577 Ga0068857_100005197 Ga0068857_1000051976 236
67 3300005614 Ga0068856_100360191 Ga0068856_1003601911 236
68 3300009093 Ga0105240_10356090 Ga0105240_103560902 236
69 3300009551 Ga0105238_10111340 Ga0105238_101113403 236
70 3300010375 Ga0105239_10031334 Ga0105239_100313345 236
71 3300013307 Ga0157372_10464433 Ga0157372_104644332 236
72 3300025912 Ga0207707_10083672 Ga0207707_100836722 236
73 3300025914 Ga0207671_10154841 Ga0207671_101548412 236
74 3300025917 Ga0207660_10418717 Ga0207660_104187171 236
75 3300025949 Ga0207667_10042546 Ga0207667_100425463 236
76 3300026041 Ga0207639_10051954 Ga0207639_100519543 236
77 3300026116 Ga0207674_10008435 Ga0207674_100084356 236
78 3300035695 Ga0373927_0078997 Ga0373927_0078997_1018_1842 236
79 3300035725 Ga0373947_0039460 Ga0373947_0039460_576_1400 236
80 3300037068 Ga0373925_0020272 Ga0373925_0020272_3649_4473 236
81 3300046472 Ga0495580_0005245 Ga0495580_0005245_378_1202 236
82 3300049584 Ga0501068_0013403 Ga0501068_0013403_1113_1910 236
83 3300049589 Ga0501073_0001888 Ga0501073_0001888_1286_2083 236
84 3300049590 Ga0501074_0028694 Ga0501074_0028694_1164_1961 236
85 3300049593 Ga0501077_0113783 Ga0501077_0113783_136_933 236
86 3300049742 Ga0501080_0007029 Ga0501080_0007029_6008_6805 236
87 3300042876 Ga0451577_0259539 Ga0451577_0259539_699_1436 237
88 3300045051 Ga0451576_0066838 Ga0451576_0066838_1566_2303 237
89 3300044712 Ga0453684_0039475 Ga0453684_0039475_3738_4478 238
90 3300009545 Ga0105237_10648597 Ga0105237_106485971 239
91 3300050511 nmdc:mga08y16_613491_c1 nmdc:mga08y16_613491_c1_47_856 239
92 3300005328 Ga0070676_10000744 Ga0070676_1000074416 241
93 3300005331 Ga0070670_100057020 Ga0070670_1000570204 241
94 3300005334 Ga0068869_100119969 Ga0068869_1001199694 241
95 3300005335 Ga0070666_10001863 Ga0070666_100018639 241
96 3300005335 Ga0070666_10092606 Ga0070666_100926062 241
97 3300005338 Ga0068868_100018850 Ga0068868_1000188504 241
98 3300005347 Ga0070668_100002354 Ga0070668_1000023549 241
99 3300005353 Ga0070669_100158883 Ga0070669_1001588833 241
100 3300005354 Ga0070675_100006756 Ga0070675_1000067566 241
101 3300005355 Ga0070671_100001313 Ga0070671_10000131315 241
102 3300005355 Ga0070671_100025305 Ga0070671_1000253055 241
103 3300005356 Ga0070674_100000512 Ga0070674_1000005128 241
104 3300005364 Ga0070673_100006169 Ga0070673_1000061696 241
105 3300005367 Ga0070667_100005521 Ga0070667_1000055219 241
106 3300005456 Ga0070678_100005918 Ga0070678_1000059186 241
107 3300005457 Ga0070662_100175954 Ga0070662_1001759542 241
108 3300005459 Ga0068867_100016319 Ga0068867_1000163195 241
109 3300005466 Ga0070685_10157149 Ga0070685_101571492 241
110 3300005539 Ga0068853_100005007 Ga0068853_1000050077 241
111 3300005543 Ga0070672_100001211 Ga0070672_10000121111 241
112 3300005548 Ga0070665_100008751 Ga0070665_1000087518 241
113 3300005618 Ga0068864_100004467 Ga0068864_10000446717 241
114 3300005834 Ga0068851_10001244 Ga0068851_100012448 241
115 3300005841 Ga0068863_100291449 Ga0068863_1002914492 241
116 3300005843 Ga0068860_100022951 Ga0068860_1000229517 241
117 3300005844 Ga0068862_100367609 Ga0068862_1003676092 241
118 3300006237 Ga0097621_100010973 Ga0097621_1000109735 241
119 3300006358 Ga0068871_100010975 Ga0068871_1000109754 241
120 3300006844 Ga0075428_100164630 Ga0075428_1001646302 241
121 3300006846 Ga0075430_100250193 Ga0075430_1002501932 241
122 3300006881 Ga0068865_100012322 Ga0068865_1000123225 241
123 3300009147 Ga0114129_10727682 Ga0114129_107276822 241
124 3300013104 Ga0157370_10187984 Ga0157370_101879843 241
125 3300013296 Ga0157374_10169193 Ga0157374_101691932 241
126 3300013297 Ga0157378_10006711 Ga0157378_100067116 241
127 3300013306 Ga0163162_10054236 Ga0163162_100542362 241
128 3300013307 Ga0157372_10026052 Ga0157372_100260526 241
129 3300013307 Ga0157372_10235294 Ga0157372_102352942 241
130 3300013308 Ga0157375_10003822 Ga0157375_100038224 241
131 3300014325 Ga0163163_10122949 Ga0163163_101229493 241
132 3300017792 Ga0163161_10109010 Ga0163161_101090102 241
133 3300025315 Ga0207697_10017307 Ga0207697_100173074 241
134 3300025321 Ga0207656_10006229 Ga0207656_100062292 241
135 3300025899 Ga0207642_10090256 Ga0207642_100902561 241
136 3300025903 Ga0207680_10002195 Ga0207680_100021959 241
137 3300025907 Ga0207645_10000629 Ga0207645_1000062927 241
138 3300025917 Ga0207660_10238790 Ga0207660_102387902 241
139 3300025919 Ga0207657_10020130 Ga0207657_100201305 241
140 3300025920 Ga0207649_10173362 Ga0207649_101733622 241
141 3300025925 Ga0207650_10039539 Ga0207650_100395395 241
142 3300025926 Ga0207659_10012567 Ga0207659_100125672 241
143 3300025931 Ga0207644_10001001 Ga0207644_100010016 241
144 3300025931 Ga0207644_10232415 Ga0207644_102324152 241
145 3300025933 Ga0207706_10146275 Ga0207706_101462752 241
146 3300025937 Ga0207669_10003730 Ga0207669_100037307 241
147 3300025938 Ga0207704_10019109 Ga0207704_100191094 241
148 3300025940 Ga0207691_10000463 Ga0207691_1000046337 241
149 3300025941 Ga0207711_10059627 Ga0207711_100596275 241
150 3300025942 Ga0207689_10088834 Ga0207689_100888342 241
151 3300025949 Ga0207667_10484140 Ga0207667_104841402 241
152 3300025960 Ga0207651_10001966 Ga0207651_100019669 241
153 3300025972 Ga0207668_10007420 Ga0207668_100074207 241
154 3300025986 Ga0207658_10014140 Ga0207658_100141405 241
155 3300026023 Ga0207677_10083116 Ga0207677_100831162 241
156 3300026041 Ga0207639_10012753 Ga0207639_100127537 241
157 3300026067 Ga0207678_10021762 Ga0207678_100217625 241
158 3300026088 Ga0207641_10241196 Ga0207641_102411962 241
159 3300026089 Ga0207648_10008009 Ga0207648_100080098 241
160 3300026095 Ga0207676_10013604 Ga0207676_100136043 241
161 3300026121 Ga0207683_10000265 Ga0207683_1000026545 241
162 3300028379 Ga0268266_10003578 Ga0268266_1000357817 241
163 3300028381 Ga0268264_10019654 Ga0268264_100196543 241
164 3300035691 Ga0373931_0064402 Ga0373931_0064402_1148_1912 241
165 3300036401 Ga0373937_0147259 Ga0373937_0147259_892_1656 241
166 3300005293 Ga0065715_10002822 Ga0065715_100028222 242
167 3300005328 Ga0070676_10000214 Ga0070676_1000021414 242
168 3300005330 Ga0070690_100056652 Ga0070690_1000566523 242
169 3300005331 Ga0070670_100020386 Ga0070670_1000203862 242
170 3300005333 Ga0070677_10055764 Ga0070677_100557642 242
171 3300005334 Ga0068869_100001409 Ga0068869_10000140910 242
172 3300005335 Ga0070666_10002466 Ga0070666_1000246610 242
173 3300005335 Ga0070666_10043741 Ga0070666_100437412 242
174 3300005338 Ga0068868_100000956 Ga0068868_10000095614 242
175 3300005340 Ga0070689_100125324 Ga0070689_1001253242 242
176 3300005343 Ga0070687_100344423 Ga0070687_1003444231 242
177 3300005347 Ga0070668_100001309 Ga0070668_10000130915 242
178 3300005347 Ga0070668_100004138 Ga0070668_1000041386 242
179 3300005353 Ga0070669_100002295 Ga0070669_10000229510 242
180 3300005353 Ga0070669_100023860 Ga0070669_1000238602 242
181 3300005354 Ga0070675_100017902 Ga0070675_1000179024 242
182 3300005355 Ga0070671_100102418 Ga0070671_1001024183 242
183 3300005364 Ga0070673_100000982 Ga0070673_10000098212 242
184 3300005367 Ga0070667_100000924 Ga0070667_10000092420 242
185 3300005367 Ga0070667_100009247 Ga0070667_1000092476 242
186 3300005367 Ga0070667_100045932 Ga0070667_1000459325 242
187 3300005367 Ga0070667_100243404 Ga0070667_1002434041 242
188 3300005441 Ga0070700_100219177 Ga0070700_1002191772 242
189 3300005445 Ga0070708_100000095 Ga0070708_1000000955 242
190 3300005456 Ga0070678_100000282 Ga0070678_10000028224 242
191 3300005459 Ga0068867_100000370 Ga0068867_1000003706 242
192 3300005459 Ga0068867_100004639 Ga0068867_1000046398 242
193 3300005459 Ga0068867_100086360 Ga0068867_1000863602 242
194 3300005539 Ga0068853_100119234 Ga0068853_1001192341 242
195 3300005543 Ga0070672_100000702 Ga0070672_10000070213 242
196 3300005543 Ga0070672_100132355 Ga0070672_1001323552 242
197 3300005548 Ga0070665_100001475 Ga0070665_10000147521 242
198 3300005548 Ga0070665_100772181 Ga0070665_1007721811 242
199 3300005563 Ga0068855_100027751 Ga0068855_1000277516 242
200 3300005577 Ga0068857_100073134 Ga0068857_1000731341 242
201 3300005615 Ga0070702_100027615 Ga0070702_1000276153 242
202 3300005617 Ga0068859_100000699 Ga0068859_10000069928 242
203 3300005617 Ga0068859_100013055 Ga0068859_1000130559 242
204 3300005618 Ga0068864_100004480 Ga0068864_10000448010 242
205 3300005618 Ga0068864_100010673 Ga0068864_1000106736 242
206 3300005719 Ga0068861_100005974 Ga0068861_1000059746 242
207 3300005719 Ga0068861_100016924 Ga0068861_1000169244 242
208 3300005841 Ga0068863_100026884 Ga0068863_1000268843 242
209 3300005842 Ga0068858_100002586 Ga0068858_1000025867 242
210 3300005842 Ga0068858_100003832 Ga0068858_1000038326 242
211 3300005842 Ga0068858_100005571 Ga0068858_1000055714 242
212 3300005843 Ga0068860_100001362 Ga0068860_10000136211 242
213 3300005843 Ga0068860_100004465 Ga0068860_1000044653 242
214 3300005844 Ga0068862_100010906 Ga0068862_1000109064 242
215 3300005844 Ga0068862_100259471 Ga0068862_1002594712 242
216 3300005985 Ga0081539_10017668 Ga0081539_100176686 242
217 3300005985 Ga0081539_10118004 Ga0081539_101180042 242
218 3300006173 Ga0070716_100260117 Ga0070716_1002601172 242
219 3300006358 Ga0068871_100003161 Ga0068871_1000031615 242
220 3300006881 Ga0068865_100002004 Ga0068865_1000020044 242
221 3300006931 Ga0097620_100000699 Ga0097620_10000069911 242
222 3300006931 Ga0097620_100013055 Ga0097620_1000130559 242
223 3300009177 Ga0105248_10006770 Ga0105248_100067706 242
224 3300009553 Ga0105249_10024386 Ga0105249_100243863 242
225 3300010375 Ga0105239_10166377 Ga0105239_101663772 242
226 3300011119 Ga0105246_10434366 Ga0105246_104343662 242
227 3300013296 Ga0157374_10002543 Ga0157374_1000254319 242
228 3300013296 Ga0157374_10290572 Ga0157374_102905722 242
229 3300013297 Ga0157378_10121952 Ga0157378_101219521 242
230 3300013297 Ga0157378_10135993 Ga0157378_101359931 242
231 3300013306 Ga0163162_10221977 Ga0163162_102219772 242
232 3300013308 Ga0157375_10030435 Ga0157375_100304355 242
233 3300014325 Ga0163163_10003550 Ga0163163_100035503 242
234 3300014745 Ga0157377_10482063 Ga0157377_104820631 242
235 3300014968 Ga0157379_10000544 Ga0157379_1000054415 242
236 3300014968 Ga0157379_10001556 Ga0157379_100015566 242
237 3300014968 Ga0157379_10002150 Ga0157379_100021509 242
238 3300014969 Ga0157376_10026202 Ga0157376_100262024 242
239 3300017792 Ga0163161_10010634 Ga0163161_100106344 242
240 3300025903 Ga0207680_10005666 Ga0207680_100056665 242
241 3300025903 Ga0207680_10030894 Ga0207680_100308942 242
242 3300025907 Ga0207645_10001172 Ga0207645_1000117211 242
243 3300025918 Ga0207662_10123005 Ga0207662_101230051 242
244 3300025923 Ga0207681_10013271 Ga0207681_100132715 242
245 3300025925 Ga0207650_10061297 Ga0207650_100612971 242
246 3300025926 Ga0207659_10000389 Ga0207659_1000038919 242
247 3300025931 Ga0207644_10002499 Ga0207644_100024993 242
248 3300025931 Ga0207644_10079989 Ga0207644_100799893 242
249 3300025938 Ga0207704_10005842 Ga0207704_100058424 242
250 3300025938 Ga0207704_10260174 Ga0207704_102601742 242
251 3300025940 Ga0207691_10000458 Ga0207691_1000045822 242
252 3300025940 Ga0207691_10083125 Ga0207691_100831253 242
253 3300025941 Ga0207711_10012463 Ga0207711_100124636 242
254 3300025942 Ga0207689_10001557 Ga0207689_1000155718 242
255 3300025942 Ga0207689_10005214 Ga0207689_100052146 242
256 3300025942 Ga0207689_10416514 Ga0207689_104165141 242
257 3300025949 Ga0207667_10030469 Ga0207667_100304696 242
258 3300025961 Ga0207712_10247171 Ga0207712_102471712 242
259 3300025972 Ga0207668_10018062 Ga0207668_100180624 242
260 3300025972 Ga0207668_10038845 Ga0207668_100388453 242
261 3300025986 Ga0207658_10003442 Ga0207658_100034424 242
262 3300025986 Ga0207658_10017708 Ga0207658_100177085 242
263 3300025986 Ga0207658_10430273 Ga0207658_104302732 242
264 3300026023 Ga0207677_10409389 Ga0207677_104093892 242
265 3300026035 Ga0207703_10002644 Ga0207703_100026446 242
266 3300026035 Ga0207703_10003035 Ga0207703_100030354 242
267 3300026035 Ga0207703_10018064 Ga0207703_100180647 242
268 3300026041 Ga0207639_10200097 Ga0207639_102000971 242
269 3300026067 Ga0207678_10183158 Ga0207678_101831582 242
270 3300026088 Ga0207641_10000588 Ga0207641_1000058822 242
271 3300026088 Ga0207641_10019268 Ga0207641_100192684 242
272 3300026089 Ga0207648_10001118 Ga0207648_100011186 242
273 3300026089 Ga0207648_10006491 Ga0207648_1000649110 242
274 3300026095 Ga0207676_10001146 Ga0207676_1000114612 242
275 3300026095 Ga0207676_10001463 Ga0207676_100014637 242
276 3300026116 Ga0207674_10016380 Ga0207674_1001638011 242
277 3300026118 Ga0207675_100001856 Ga0207675_1000018564 242
278 3300026118 Ga0207675_100052176 Ga0207675_1000521762 242
279 3300026121 Ga0207683_10000076 Ga0207683_1000007627 242
280 3300028379 Ga0268266_10005429 Ga0268266_100054295 242
281 3300028380 Ga0268265_10012681 Ga0268265_100126812 242
282 3300028380 Ga0268265_10242212 Ga0268265_102422122 242
283 3300028381 Ga0268264_10001578 Ga0268264_100015785 242
284 3300028381 Ga0268264_10028431 Ga0268264_100284314 242
285 3300031548 Ga0307408_100013118 Ga0307408_1000131183 242
286 3300031731 Ga0307405_10007321 Ga0307405_100073214 242
287 3300031824 Ga0307413_10011890 Ga0307413_100118902 242
288 3300031824 Ga0307413_10089383 Ga0307413_100893833 242
289 3300031824 Ga0307413_10184603 Ga0307413_101846032 242
290 3300031852 Ga0307410_10034260 Ga0307410_100342604 242
291 3300031852 Ga0307410_10042310 Ga0307410_100423103 242
292 3300031901 Ga0307406_10129940 Ga0307406_101299402 242
293 3300031903 Ga0307407_10011576 Ga0307407_100115763 242
294 3300031911 Ga0307412_10031225 Ga0307412_100312254 242
295 3300031995 Ga0307409_100083242 Ga0307409_1000832422 242
296 3300031995 Ga0307409_100427338 Ga0307409_1004273381 242
297 3300032002 Ga0307416_100001805 Ga0307416_10000180515 242
298 3300032002 Ga0307416_100007971 Ga0307416_1000079716 242
299 3300032004 Ga0307414_10031620 Ga0307414_100316203 242
300 3300032005 Ga0307411_10000502 Ga0307411_100005024 242
301 3300032126 Ga0307415_100043898 Ga0307415_1000438982 242
302 3300041486 Ga0451807_0539397 Ga0451807_0539397_115_882 242
303 3300042133 Ga0450896_019071 Ga0450896_019071_205_972 242
304 3300042876 Ga0451577_0000074 Ga0451577_0000074_30694_31527 242
305 3300044712 Ga0453684_0000482 Ga0453684_0000482_126770_127603 242
306 3300048904 Ga0496101_0140229 Ga0496101_0140229_232_999 242
307 3300048905 Ga0496102_0044624 Ga0496102_0044624_637_1401 242
308 3300048906 Ga0496103_0015226 Ga0496103_0015226_2627_3391 242
309 3300048909 Ga0496106_0183712 Ga0496106_0183712_590_1354 242
310 3300048909 Ga0496106_0378574 Ga0496106_0378574_203_970 242
311 3300048911 Ga0496108_0018065 Ga0496108_0018065_4331_5098 242
312 3300048911 Ga0496108_0053364 Ga0496108_0053364_1564_2328 242
313 3300048912 Ga0496109_0174272 Ga0496109_0174272_824_1591 242
314 3300048913 Ga0496110_0159148 Ga0496110_0159148_669_1433 242
315 3300048917 Ga0496114_0174820 Ga0496114_0174820_233_1000 242
316 3300049582 Ga0501048_0347349 Ga0501048_0347349_153_920 242
317 3300049587 Ga0501071_0214535 Ga0501071_0214535_15_782 242
318 3300005347 Ga0070668_100015782 Ga0070668_1000157824 243
319 3300005354 Ga0070675_100203436 Ga0070675_1002034362 243
320 3300005367 Ga0070667_100316735 Ga0070667_1003167352 243
321 3300005543 Ga0070672_100325111 Ga0070672_1003251112 243
322 3300005618 Ga0068864_100267184 Ga0068864_1002671842 243
323 3300005841 Ga0068863_100141809 Ga0068863_1001418093 243
324 3300005844 Ga0068862_100379991 Ga0068862_1003799912 243
325 3300009098 Ga0105245_10086488 Ga0105245_100864882 243
326 3300013297 Ga0157378_10590840 Ga0157378_105908401 243
327 3300013306 Ga0163162_10568807 Ga0163162_105688071 243
328 3300014326 Ga0157380_10026051 Ga0157380_100260514 243
329 3300014968 Ga0157379_10256845 Ga0157379_102568452 243
330 3300025972 Ga0207668_10010605 Ga0207668_100106055 243
331 3300025986 Ga0207658_10274764 Ga0207658_102747642 243
332 3300026089 Ga0207648_10143441 Ga0207648_101434412 243
333 3300026095 Ga0207676_10055037 Ga0207676_100550374 243
334 3300028379 Ga0268266_10437376 Ga0268266_104373762 243
335 3300028380 Ga0268265_10251971 Ga0268265_102519712 243
336 3300031235 Ga0265330_10000546 Ga0265330_1000054619 243
337 3300031238 Ga0265332_10001580 Ga0265332_100015805 243
338 3300031241 Ga0265325_10014918 Ga0265325_100149184 243
339 3300031242 Ga0265329_10002668 Ga0265329_100026685 243
340 3300031250 Ga0265331_10001628 Ga0265331_100016285 243
341 3300031251 Ga0265327_10009764 Ga0265327_100097647 243
342 3300031344 Ga0265316_10016393 Ga0265316_100163937 243
343 3300031711 Ga0265314_10010366 Ga0265314_100103662 243
344 3300031712 Ga0265342_10012171 Ga0265342_100121715 243
345 3300042876 Ga0451577_0034075 Ga0451577_0034075_636_1403 243
346 3300045051 Ga0451576_0000166 Ga0451576_0000166_109115_109882 243
347 3300045051 Ga0451576_0132523 Ga0451576_0132523_617_1384 243
348 3300050507 nmdc:mga05p37_471413_c1 nmdc:mga05p37_471413_c1_34_825 243
349 3300005327 Ga0070658_10007552 Ga0070658_100075524 244
350 3300005328 Ga0070676_10012894 Ga0070676_100128942 244
351 3300005329 Ga0070683_100762682 Ga0070683_1007626821 244
352 3300005344 Ga0070661_100172595 Ga0070661_1001725952 244
353 3300005347 Ga0070668_100118670 Ga0070668_1001186701 244
354 3300005353 Ga0070669_100016540 Ga0070669_1000165406 244
355 3300005354 Ga0070675_100090535 Ga0070675_1000905353 244
356 3300005355 Ga0070671_100002406 Ga0070671_10000240615 244
357 3300005356 Ga0070674_100058203 Ga0070674_1000582034 244
358 3300005365 Ga0070688_100122157 Ga0070688_1001221571 244
359 3300005367 Ga0070667_100555799 Ga0070667_1005557991 244
360 3300005441 Ga0070700_100120579 Ga0070700_1001205792 244
361 3300005456 Ga0070678_100074836 Ga0070678_1000748364 244
362 3300005535 Ga0070684_100128717 Ga0070684_1001287172 244
363 3300005543 Ga0070672_100021026 Ga0070672_1000210263 244
364 3300005544 Ga0070686_100403753 Ga0070686_1004037531 244
365 3300005545 Ga0070695_100036536 Ga0070695_1000365362 244
366 3300005617 Ga0068859_100043832 Ga0068859_1000438321 244
367 3300005618 Ga0068864_100043086 Ga0068864_1000430862 244
368 3300005840 Ga0068870_10015375 Ga0068870_100153751 244
369 3300005841 Ga0068863_100041743 Ga0068863_1000417433 244
370 3300005842 Ga0068858_100066655 Ga0068858_1000666551 244
371 3300005843 Ga0068860_100020844 Ga0068860_1000208445 244
372 3300005844 Ga0068862_100208403 Ga0068862_1002084031 244
373 3300006358 Ga0068871_100074379 Ga0068871_1000743793 244
374 3300006931 Ga0097620_100043834 Ga0097620_1000438341 244
375 3300009148 Ga0105243_10026040 Ga0105243_100260405 244
376 3300009176 Ga0105242_10042767 Ga0105242_100427675 244
377 3300009177 Ga0105248_10173168 Ga0105248_101731684 244
378 3300013297 Ga0157378_10158675 Ga0157378_101586752 244
379 3300013306 Ga0163162_10038134 Ga0163162_100381342 244
380 3300014326 Ga0157380_10036364 Ga0157380_100363642 244
381 3300014969 Ga0157376_10111287 Ga0157376_101112871 244
382 3300025907 Ga0207645_10010234 Ga0207645_100102345 244
383 3300025933 Ga0207706_10064657 Ga0207706_100646573 244
384 3300025940 Ga0207691_10086928 Ga0207691_100869282 244
385 3300025941 Ga0207711_10774826 Ga0207711_107748261 244
386 3300025942 Ga0207689_10007663 Ga0207689_100076635 244
387 3300025986 Ga0207658_10085734 Ga0207658_100857342 244
388 3300026035 Ga0207703_10085688 Ga0207703_100856882 244
389 3300026075 Ga0207708_10107685 Ga0207708_101076851 244
390 3300026088 Ga0207641_10151082 Ga0207641_101510822 244
391 3300026089 Ga0207648_10014003 Ga0207648_100140035 244
392 3300026118 Ga0207675_100085228 Ga0207675_1000852283 244
393 3300026121 Ga0207683_10026696 Ga0207683_100266965 244
394 3300029957 Ga0265324_10027194 Ga0265324_100271942 244
395 3300036401 Ga0373937_0122619 Ga0373937_0122619_831_1607 244
396 3300038443 Ga0395901_0091395 Ga0395901_0091395_924_1697 244
397 3300042876 Ga0451577_0000609 Ga0451577_0000609_94_948 244
398 3300042876 Ga0451577_0312898 Ga0451577_0312898_339_1193 244
399 3300044673 Ga0453683_0054172 Ga0453683_0054172_1574_2428 244
400 3300044712 Ga0453684_0010417 Ga0453684_0010417_14775_15629 244
401 3300044712 Ga0453684_0056211 Ga0453684_0056211_1236_2090 244
402 3300044712 Ga0453684_0223602 Ga0453684_0223602_664_1434 244
403 3300045051 Ga0451576_0092353 Ga0451576_0092353_248_1102 244
404 3300045836 Ga0466958_0035860 Ga0466958_0035860_1515_2285 244
405 3300045976 Ga0466967_0345176 Ga0466967_0345176_570_1379 244
406 3300007265 Ga0099794_10078937 Ga0099794_100789372 245
407 3300013100 Ga0157373_10343366 Ga0157373_103433662 245
408 3300026075 Ga0207708_10252056 Ga0207708_102520562 245
409 3300042876 Ga0451577_0020592 Ga0451577_0020592_241_1035 245
410 3300044712 Ga0453684_0007245 Ga0453684_0007245_11559_12353 245
411 3300048915 Ga0496112_0350842 Ga0496112_0350842_300_1130 245
412 3300006846 Ga0075430_100212050 Ga0075430_1002120502 246
413 3300050510 nmdc:mga06r32_178181_c1 nmdc:mga06r32_178181_c1_487_1308 246
414 3300013308 Ga0157375_10356999 Ga0157375_103569992 247
415 3300025986 Ga0207658_10051703 Ga0207658_100517034 247
416 3300044712 Ga0453684_0000348 Ga0453684_0000348_103663_104445 247
417 3300005338 Ga0068868_100377372 Ga0068868_1003773722 248
418 3300005577 Ga0068857_100286120 Ga0068857_1002861202 248
419 3300026116 Ga0207674_10208291 Ga0207674_102082912 248
420 3300048905 Ga0496102_0050962 Ga0496102_0050962_573_1373 248
421 3300049578 Ga0501042_0436134 Ga0501042_0436134_53_844 248
422 3300049592 Ga0501076_0211225 Ga0501076_0211225_557_1348 248
423 3300036647 Ga0316582_0064779 Ga0316582_0064779_1514_2341 250
424 3300013306 Ga0163162_11203578 Ga0163162_112035781 257
425 3300005536 Ga0070697_100225619 Ga0070697_1002256191 258
426 3300006871 Ga0075434_100175465 Ga0075434_1001754653 259
427 3300009177 Ga0105248_10046067 Ga0105248_100460675 259
428 3300014326 Ga0157380_10225226 Ga0157380_102252263 260
429 3300053139 Ga0500568_0000760 Ga0500568_0000760_6817_7671 260
430 3300006237 Ga0097621_100033584 Ga0097621_1000335843 262
431 3300006358 Ga0068871_100021521 Ga0068871_1000215217 262
432 3300005439 Ga0070711_100324792 Ga0070711_1003247921 264
433 3300025916 Ga0207663_10257330 Ga0207663_102573302 264
434 3300006871 Ga0075434_100342042 Ga0075434_1003420421 268
435 3300006871 Ga0075434_100299970 Ga0075434_1002999701 269
436 3300009093 Ga0105240_10617752 Ga0105240_106177522 270
437 3300009176 Ga0105242_10006033 Ga0105242_100060337 272
438 3300009545 Ga0105237_10056538 Ga0105237_100565384 272
439 3300011119 Ga0105246_10375907 Ga0105246_103759072 272
440 3300013105 Ga0157369_10082731 Ga0157369_100827312 272
441 3300013296 Ga0157374_10081556 Ga0157374_100815562 272
442 3300035724 Ga0373933_0015272 Ga0373933_0015272_1597_2529 272
443 3300036401 Ga0373937_0006017 Ga0373937_0006017_1246_2178 272
444 3300005329 Ga0070683_100504835 Ga0070683_1005048351 273
445 3300005436 Ga0070713_100028074 Ga0070713_1000280743 273
446 3300010375 Ga0105239_10109797 Ga0105239_101097973 273
447 3300026041 Ga0207639_10444373 Ga0207639_104443732 273
448 3300026078 Ga0207702_10461673 Ga0207702_104616732 273
449 3300005719 Ga0068861_100191416 Ga0068861_1001914161 274
450 3300006358 Ga0068871_100101896 Ga0068871_1001018963 274
451 3300026118 Ga0207675_100219404 Ga0207675_1002194042 274
452 3300035086 Ga0373934_0007947 Ga0373934_0007947_1741_2643 274
453 3300035117 Ga0373953_0026246 Ga0373953_0026246_452_1354 274
454 3300035118 Ga0373954_0006873 Ga0373954_0006873_1136_2038 274
455 3300035118 Ga0373954_0082451 Ga0373954_0082451_11_913 274
456 3300035120 Ga0373957_0020486 Ga0373957_0020486_522_1424 274
457 3300035724 Ga0373933_0073253 Ga0373933_0073253_776_1678 274
458 3300036401 Ga0373937_0071302 Ga0373937_0071302_2254_3156 274
459 3300046454 Ga0495592_0263243 Ga0495592_0263243_73_975 274
460 3300046663 Ga0495635_0182367 Ga0495635_0182367_218_1120 274
461 3300048907 Ga0496104_0357666 Ga0496104_0357666_415_1320 274
462 3300005353 Ga0070669_100073180 Ga0070669_1000731802 275
463 3300005459 Ga0068867_100260213 Ga0068867_1002602132 275
464 3300025927 Ga0207687_10109779 Ga0207687_101097792 275
465 3300035083 Ga0373926_0029325 Ga0373926_0029325_296_1216 275
466 3300037068 Ga0373925_0021107 Ga0373925_0021107_1285_2205 275
467 3300046454 Ga0495592_0132501 Ga0495592_0132501_366_1286 275
468 3300046472 Ga0495580_0031495 Ga0495580_0031495_1738_2658 275
469 3300046535 Ga0495586_0207647 Ga0495586_0207647_144_1088 275
470 3300046536 Ga0495587_0005484 Ga0495587_0005484_5111_6031 275
471 3300048088 Ga0495602_0003716 Ga0495602_0003716_10633_11553 275
472 3300005329 Ga0070683_100002435 Ga0070683_10000243510 276
473 3300005329 Ga0070683_100035308 Ga0070683_1000353082 276
474 3300005329 Ga0070683_100064293 Ga0070683_1000642934 276
475 3300005329 Ga0070683_100178411 Ga0070683_1001784112 276
476 3300005334 Ga0068869_100105043 Ga0068869_1001050432 276
477 3300005334 Ga0068869_100218695 Ga0068869_1002186952 276
478 3300005336 Ga0070680_100021671 Ga0070680_1000216713 276
479 3300005338 Ga0068868_100101993 Ga0068868_1001019932 276
480 3300005340 Ga0070689_100151973 Ga0070689_1001519732 276
481 3300005341 Ga0070691_10001053 Ga0070691_100010532 276
482 3300005344 Ga0070661_100118153 Ga0070661_1001181532 276
483 3300005364 Ga0070673_100139957 Ga0070673_1001399572 276
484 3300005439 Ga0070711_100041168 Ga0070711_1000411685 276
485 3300005458 Ga0070681_10004209 Ga0070681_100042096 276
486 3300005458 Ga0070681_10135250 Ga0070681_101352502 276
487 3300005530 Ga0070679_100000612 Ga0070679_10000061216 276
488 3300005535 Ga0070684_100017879 Ga0070684_1000178794 276
489 3300005535 Ga0070684_100059944 Ga0070684_1000599442 276
490 3300005535 Ga0070684_100073901 Ga0070684_1000739012 276
491 3300005535 Ga0070684_100075890 Ga0070684_1000758902 276
492 3300005535 Ga0070684_100144316 Ga0070684_1001443163 276
493 3300005539 Ga0068853_100093604 Ga0068853_1000936043 276
494 3300005546 Ga0070696_100484532 Ga0070696_1004845321 276
495 3300005563 Ga0068855_100035090 Ga0068855_1000350904 276
496 3300005563 Ga0068855_100214839 Ga0068855_1002148393 276
497 3300005564 Ga0070664_100030275 Ga0070664_1000302755 276
498 3300005564 Ga0070664_100536322 Ga0070664_1005363222 276
499 3300005577 Ga0068857_100001603 Ga0068857_10000160316 276
500 3300005577 Ga0068857_100006413 Ga0068857_10000641310 276
501 3300005614 Ga0068856_100003926 Ga0068856_1000039262 276
502 3300005614 Ga0068856_100040996 Ga0068856_1000409965 276
503 3300005614 Ga0068856_100111516 Ga0068856_1001115162 276
504 3300005614 Ga0068856_100312862 Ga0068856_1003128622 276
505 3300005616 Ga0068852_100137889 Ga0068852_1001378892 276
506 3300005616 Ga0068852_100406230 Ga0068852_1004062301 276
507 3300005617 Ga0068859_100008649 Ga0068859_1000086498 276
508 3300005841 Ga0068863_100063565 Ga0068863_1000635653 276
509 3300005843 Ga0068860_100019076 Ga0068860_1000190763 276
510 3300005843 Ga0068860_100108841 Ga0068860_1001088413 276
511 3300006358 Ga0068871_100077785 Ga0068871_1000777852 276
512 3300006358 Ga0068871_100153711 Ga0068871_1001537112 276
513 3300006881 Ga0068865_100132725 Ga0068865_1001327252 276
514 3300006931 Ga0097620_100008648 Ga0097620_1000086488 276
515 3300009093 Ga0105240_10006331 Ga0105240_1000633115 276
516 3300009093 Ga0105240_10423982 Ga0105240_104239822 276
517 3300009098 Ga0105245_10007372 Ga0105245_100073724 276
518 3300009098 Ga0105245_10021118 Ga0105245_100211183 276
519 3300009098 Ga0105245_10096639 Ga0105245_100966392 276
520 3300009098 Ga0105245_10399147 Ga0105245_103991472 276
521 3300009148 Ga0105243_10018342 Ga0105243_100183426 276
522 3300009148 Ga0105243_10327737 Ga0105243_103277372 276
523 3300009174 Ga0105241_10014364 Ga0105241_100143644 276
524 3300009174 Ga0105241_10015901 Ga0105241_100159012 276
525 3300009176 Ga0105242_10014802 Ga0105242_100148026 276
526 3300009177 Ga0105248_10220507 Ga0105248_102205071 276
527 3300009545 Ga0105237_10001777 Ga0105237_100017779 276
528 3300009551 Ga0105238_10000877 Ga0105238_1000087715 276
529 3300009551 Ga0105238_10055769 Ga0105238_100557694 276
530 3300009551 Ga0105238_10066320 Ga0105238_100663203 276
531 3300009551 Ga0105238_10118574 Ga0105238_101185743 276
532 3300009553 Ga0105249_10219685 Ga0105249_102196852 276
533 3300010375 Ga0105239_10000747 Ga0105239_1000074716 276
534 3300010375 Ga0105239_10058124 Ga0105239_100581243 276
535 3300011119 Ga0105246_10334658 Ga0105246_103346581 276
536 3300013104 Ga0157370_10008207 Ga0157370_1000820711 276
537 3300013105 Ga0157369_10002365 Ga0157369_1000236521 276
538 3300013296 Ga0157374_10128292 Ga0157374_101282922 276
539 3300013297 Ga0157378_10001312 Ga0157378_100013126 276
540 3300013306 Ga0163162_10337052 Ga0163162_103370522 276
541 3300013307 Ga0157372_10001898 Ga0157372_1000189813 276
542 3300013307 Ga0157372_10023617 Ga0157372_100236175 276
543 3300013307 Ga0157372_10041273 Ga0157372_100412734 276
544 3300014325 Ga0163163_10051305 Ga0163163_100513054 276
545 3300014969 Ga0157376_10102284 Ga0157376_101022843 276
546 3300025911 Ga0207654_10004304 Ga0207654_100043042 276
547 3300025911 Ga0207654_10061634 Ga0207654_100616342 276
548 3300025912 Ga0207707_10006840 Ga0207707_100068408 276
549 3300025913 Ga0207695_10001608 Ga0207695_1000160820 276
550 3300025913 Ga0207695_10367946 Ga0207695_103679462 276
551 3300025914 Ga0207671_10035157 Ga0207671_100351574 276
552 3300025917 Ga0207660_10031200 Ga0207660_100312004 276
553 3300025920 Ga0207649_10111434 Ga0207649_101114342 276
554 3300025921 Ga0207652_10001546 Ga0207652_100015468 276
555 3300025924 Ga0207694_10014055 Ga0207694_100140556 276
556 3300025924 Ga0207694_10017415 Ga0207694_100174154 276
557 3300025924 Ga0207694_10123788 Ga0207694_101237881 276
558 3300025927 Ga0207687_10001649 Ga0207687_1000164911 276
559 3300025927 Ga0207687_10002739 Ga0207687_100027393 276
560 3300025927 Ga0207687_10159368 Ga0207687_101593682 276
561 3300025927 Ga0207687_10391452 Ga0207687_103914521 276
562 3300025931 Ga0207644_10215059 Ga0207644_102150592 276
563 3300025934 Ga0207686_10031322 Ga0207686_100313222 276
564 3300025934 Ga0207686_10037806 Ga0207686_100378062 276
565 3300025935 Ga0207709_10041500 Ga0207709_100415003 276
566 3300025938 Ga0207704_10026286 Ga0207704_100262864 276
567 3300025941 Ga0207711_10004168 Ga0207711_100041686 276
568 3300025941 Ga0207711_10031821 Ga0207711_100318215 276
569 3300025942 Ga0207689_10041911 Ga0207689_100419113 276
570 3300025944 Ga0207661_10003225 Ga0207661_1000322510 276
571 3300025944 Ga0207661_10007078 Ga0207661_100070784 276
572 3300025944 Ga0207661_10070713 Ga0207661_100707133 276
573 3300025945 Ga0207679_10062672 Ga0207679_100626723 276
574 3300025949 Ga0207667_10000761 Ga0207667_1000076122 276
575 3300025949 Ga0207667_10060641 Ga0207667_100606412 276
576 3300025960 Ga0207651_10193232 Ga0207651_101932322 276
577 3300026023 Ga0207677_10053680 Ga0207677_100536804 276
578 3300026023 Ga0207677_10209894 Ga0207677_102098942 276
579 3300026041 Ga0207639_10066221 Ga0207639_100662214 276
580 3300026078 Ga0207702_10246145 Ga0207702_102461452 276
581 3300026078 Ga0207702_10279870 Ga0207702_102798702 276
582 3300026088 Ga0207641_10075430 Ga0207641_100754302 276
583 3300026089 Ga0207648_10253337 Ga0207648_102533372 276
584 3300026095 Ga0207676_10096898 Ga0207676_100968983 276
585 3300026116 Ga0207674_10001480 Ga0207674_1000148015 276
586 3300026116 Ga0207674_10010975 Ga0207674_100109759 276
587 3300026121 Ga0207683_10168934 Ga0207683_101689342 276
588 3300026142 Ga0207698_10120977 Ga0207698_101209772 276
589 3300028381 Ga0268264_10011108 Ga0268264_100111083 276
590 3300028381 Ga0268264_10206641 Ga0268264_102066412 276
591 3300031711 Ga0265314_10001596 Ga0265314_1000159614 276
592 3300046475 Ga0495639_0062232 Ga0495639_0062232_204_1106 276
593 3300046529 Ga0495652_0319420 Ga0495652_0319420_158_1087 276
594 3300046642 Ga0495634_0231945 Ga0495634_0231945_72_974 276
595 3300046681 Ga0495647_0044690 Ga0495647_0044690_569_1471 276
596 3300046683 Ga0495658_0065163 Ga0495658_0065163_920_1822 276
597 3300047322 Ga0495680_0115028 Ga0495680_0115028_409_1338 276
598 3300005563 Ga0068855_100010914 Ga0068855_10001091412 278
599 3300005614 Ga0068856_100020338 Ga0068856_1000203385 278
600 3300006852 Ga0075433_10712388 Ga0075433_107123881 278
601 3300009093 Ga0105240_10003072 Ga0105240_1000307211 278
602 3300013104 Ga0157370_10000541 Ga0157370_1000054133 278
603 3300013105 Ga0157369_10007625 Ga0157369_100076258 278
604 3300013307 Ga0157372_10087373 Ga0157372_100873734 278
605 3300022467 Ga0224712_10052799 Ga0224712_100527992 278
606 3300025913 Ga0207695_10003203 Ga0207695_1000320319 278
607 3300025949 Ga0207667_10094328 Ga0207667_100943282 278
608 3300026078 Ga0207702_10050822 Ga0207702_100508222 278
609 3300005468 Ga0070707_100095184 Ga0070707_1000951842 279
610 3300006847 Ga0075431_100617767 Ga0075431_1006177671 279
611 3300050510 nmdc:mga06r32_212250_c1 nmdc:mga06r32_212250_c1_616_1458 279
612 3300005290 Ga0065712_10098614 Ga0065712_100986141 281
613 3300005466 Ga0070685_10221262 Ga0070685_102212622 281
614 3300006847 Ga0075431_100034136 Ga0075431_1000341365 281
615 3300009147 Ga0114129_10442840 Ga0114129_104428402 281
616 3300050509 nmdc:mga0qj67_78738_c1 nmdc:mga0qj67_78738_c1_1096_1941 281
617 3300050510 nmdc:mga06r32_200229_c1 nmdc:mga06r32_200229_c1_10_858 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

28

219

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.7626 25 262
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.7244 25 262
6wmv-assembly1.cif.gz_C structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding 0.7106 22 201
4q7c-assembly1.cif.gz_B structure of af2299, a cdp-alcohol phosphotransferase 0.6935 26 201
4o6m-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) 0.6914 26 201
ID Description Score Start End Superfamily
af_P9WPG1_2_192_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8618 22 208 1.20.120.1760
af_D3ZGY5_32_207_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8162 14 216 1.20.120.1760
af_D3ZGY5_32_207_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8034 14 216 1.20.120.1760
af_E7F188_23_199_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8001 16 218 1.20.120.1760
af_P9WPG1_2_192_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7988 22 208 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A6D0ZPL3-F1-model_v4 deleted 0.9397 22 141
AF-A0A2E2YVA2-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) 0.9352 15 264 GO:0003882
GO:0008654
GO:0012505
GO:0016020
AF-A0A2D7RUM3-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) (EC 2.7.8.8) (CDP-diacylglycerol--serine O-phosphatidyltransferase) (Phosphatidylserine synthase) 0.9319 24 265 GO:0003882
GO:0008654
GO:0012505
GO:0016020
AF-A0A3B1BGX2-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9317 24 264 GO:0003882
GO:0008654
GO:0012505
GO:0016020
AF-A0A0S8CBQ2-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9252 22 177 GO:0003882
GO:0008654
GO:0012505
GO:0016020

Feature Viewer

pLDDT pTM Quality
80.97 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map