F469645
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 617 | 353 | 599 | 355 |
Family's Representative Sequence
| Representative Sequence | 3300025972|Ga0207668_10087820|Ga0207668_100878203 |
| Length | 395 |
| Sequence | MVWLWFRPYDWVLSSPCFGAYVREQAAPSNHSNRTAMKILITGNMGYVGPLVVRQLRRSHPQAILAGIDTAYFAHCLTGADMLPERNLDIQHFGDVRDLSDAALAGVDAVVHLAAISNDPMGKSFEAVTYEVNHRASVGLAQRAKKAGVRSFVFASSCSMYGLADDTPRKETSPLNPLTAYAISKVRTESDLQDIADSGFRVTCLRFATACGMSDRLRLDLVVNDFVACAVSSGNISILSDGTPWRPLIHVRDMARAIDWAIDRDREQGGDFLAVNVGSNVWNYQVKELADAVAKVIPGVTISVNKNAPPDNRSYRVDFALYERLAPSHQPQVDLLTAVSELQEGLSTMGFRDPNFRVSRFMRLEVLKQLGAKGLIGEDLRWTAERSHQVRTEGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 4 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 5 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 6 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 7 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 8 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 9 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 10 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 11 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 12 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 13 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 14 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 15 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 16 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 17 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 124 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 125 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 185 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 188 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 189 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 192 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 201 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 202 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 210 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 215 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 226 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 227 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 228 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 231 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 232 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 233 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 236 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 237 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 238 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 239 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 240 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 241 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 242 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 243 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 244 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 245 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 246 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 280 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 281 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 282 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 283 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 284 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 292 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 293 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 294 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 295 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 296 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 297 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 314 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 315 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 316 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 319 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 320 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 321 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 331 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 333 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 334 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 335 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 336 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 337 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 338 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 339 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 340 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 341 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 342 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 343 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 344 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 345 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 346 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 347 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 348 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 349 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 350 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 351 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 353 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.92 |
| Metatranscriptomes | 0.32 |
| Isolates | 2.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.81 |
| Nodule | 1.13 |
| Rhizoplane | 4.05 |
| Rhizosphere | 79.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_7679642 | 2162886012 | Unclassified | 1596 |
| 2 | JGI24739J22299_10019237 | 3300001989 | Bacteria | 2447 |
| 3 | JGI25153J46596_10004924 | 3300003215 | Bacteria | 7097 |
| 4 | JGI25153J46596_10005349 | 3300003215 | Bacteria | 6743 |
| 5 | rootL2_10126575 | 3300003322 | Bacteria | 6216 |
| 6 | Ga0055526_1000017 | 3300003771 | Bacteria | 210613 |
| 7 | Ga0055524_1006128 | 3300003775 | Bacteria | 5258 |
| 8 | Ga0065712_10069472 | 3300005290 | Bacteria | 7215 |
| 9 | Ga0065712_10083676 | 3300005290 | Bacteria | 2819 |
| 10 | Ga0065707_10004727 | 3300005295 | Bacteria | 3262 |
| 11 | Ga0070690_100005471 | 3300005330 | Bacteria | 7136 |
| 12 | Ga0070670_100021623 | 3300005331 | Bacteria | 5532 |
| 13 | Ga0070670_100037529 | 3300005331 | Bacteria | 4169 |
| 14 | Ga0070670_100106215 | 3300005331 | Unclassified | 2419 |
| 15 | Ga0068869_100008842 | 3300005334 | Bacteria | 6517 |
| 16 | Ga0068869_100012376 | 3300005334 | Bacteria | 5638 |
| 17 | Ga0068869_100019772 | 3300005334 | Bacteria | 4608 |
| 18 | Ga0068869_100177140 | 3300005334 | Bacteria | 1670 |
| 19 | Ga0070666_10027073 | 3300005335 | Unclassified | 3751 |
| 20 | Ga0070680_100017881 | 3300005336 | Bacteria | 5595 |
| 21 | Ga0070680_100039720 | 3300005336 | Unclassified | 3807 |
| 22 | Ga0070682_100005312 | 3300005337 | Bacteria | 7167 |
| 23 | Ga0070682_100052870 | 3300005337 | Bacteria | 2543 |
| 24 | Ga0068868_100015499 | 3300005338 | Bacteria | 5639 |
| 25 | Ga0068868_100153744 | 3300005338 | Bacteria | 1896 |
| 26 | Ga0070689_100118239 | 3300005340 | Bacteria | 2115 |
| 27 | Ga0070689_100237666 | 3300005340 | Bacteria | 1500 |
| 28 | Ga0070691_10013261 | 3300005341 | Bacteria | 3775 |
| 29 | Ga0070687_100001463 | 3300005343 | Bacteria | 8318 |
| 30 | Ga0070668_100022086 | 3300005347 | Bacteria | 4810 |
| 31 | Ga0070668_100050442 | 3300005347 | Bacteria | 3204 |
| 32 | Ga0070668_100091091 | 3300005347 | Unclassified | 2403 |
| 33 | Ga0070669_100009863 | 3300005353 | Bacteria | 6802 |
| 34 | Ga0070669_100282409 | 3300005353 | Unclassified | 1330 |
| 35 | Ga0070675_100058611 | 3300005354 | Unclassified | 3176 |
| 36 | Ga0070675_100074553 | 3300005354 | Bacteria | 2819 |
| 37 | Ga0070675_100105580 | 3300005354 | Bacteria | 2377 |
| 38 | Ga0070675_100138970 | 3300005354 | Bacteria | 2075 |
| 39 | Ga0070674_100000066 | 3300005356 | Bacteria | 47605 |
| 40 | Ga0070674_100048107 | 3300005356 | Bacteria | 2926 |
| 41 | Ga0070688_100002786 | 3300005365 | Bacteria | 8878 |
| 42 | Ga0070667_100074208 | 3300005367 | Bacteria | 2901 |
| 43 | Ga0070667_100158328 | 3300005367 | Bacteria | 1993 |
| 44 | Ga0070709_10005175 | 3300005434 | Bacteria | 7055 |
| 45 | Ga0070709_10071255 | 3300005434 | Bacteria | 2243 |
| 46 | Ga0070714_100079221 | 3300005435 | Bacteria | 2856 |
| 47 | Ga0070713_100032165 | 3300005436 | Bacteria | 4187 |
| 48 | Ga0070711_100003347 | 3300005439 | Bacteria | 9329 |
| 49 | Ga0070705_100010260 | 3300005440 | Bacteria | 4683 |
| 50 | Ga0070700_100293379 | 3300005441 | Bacteria | 1184 |
| 51 | Ga0070694_100011060 | 3300005444 | Bacteria | 5585 |
| 52 | Ga0070694_100133710 | 3300005444 | Bacteria | 1795 |
| 53 | Ga0070663_100034776 | 3300005455 | Bacteria | 3491 |
| 54 | Ga0070678_100028047 | 3300005456 | Bacteria | 3833 |
| 55 | Ga0070678_100111276 | 3300005456 | Bacteria | 2143 |
| 56 | Ga0070662_100008235 | 3300005457 | Bacteria | 6789 |
| 57 | Ga0070662_100031331 | 3300005457 | Bacteria | 3732 |
| 58 | Ga0070662_100082219 | 3300005457 | Bacteria | 2402 |
| 59 | Ga0070681_10002597 | 3300005458 | Bacteria | 16573 |
| 60 | Ga0068867_100002648 | 3300005459 | Bacteria | 12632 |
| 61 | Ga0068867_100029015 | 3300005459 | Unclassified | 3986 |
| 62 | Ga0068867_100187496 | 3300005459 | Bacteria | 1648 |
| 63 | Ga0070706_100044651 | 3300005467 | Unclassified | 4093 |
| 64 | Ga0070707_100000358 | 3300005468 | Bacteria | 44828 |
| 65 | Ga0070698_100080822 | 3300005471 | Bacteria | 3245 |
| 66 | Ga0070698_100137077 | 3300005471 | Bacteria | 2401 |
| 67 | Ga0070699_100006108 | 3300005518 | Bacteria | 10539 |
| 68 | Ga0070699_100163289 | 3300005518 | Bacteria | 1972 |
| 69 | Ga0070697_100009148 | 3300005536 | Bacteria | 7738 |
| 70 | Ga0068853_100120230 | 3300005539 | Bacteria | 2342 |
| 71 | Ga0068853_100227078 | 3300005539 | Bacteria | 1707 |
| 72 | Ga0070672_100008669 | 3300005543 | Bacteria | 6971 |
| 73 | Ga0070672_100163169 | 3300005543 | Bacteria | 1850 |
| 74 | Ga0070686_100000843 | 3300005544 | Bacteria | 17764 |
| 75 | Ga0070686_100261453 | 3300005544 | Unclassified | 1269 |
| 76 | Ga0070695_100005437 | 3300005545 | Bacteria | 7494 |
| 77 | Ga0070696_100023352 | 3300005546 | Bacteria | 4204 |
| 78 | Ga0070693_100001638 | 3300005547 | Bacteria | 10126 |
| 79 | Ga0070665_100000023 | 3300005548 | Bacteria | 375278 |
| 80 | Ga0070665_100038696 | 3300005548 | Bacteria | 4794 |
| 81 | Ga0070665_100099053 | 3300005548 | Bacteria | 2919 |
| 82 | Ga0070704_100012970 | 3300005549 | Bacteria | 5156 |
| 83 | Ga0070704_100289666 | 3300005549 | Bacteria | 1360 |
| 84 | Ga0068855_100041475 | 3300005563 | Bacteria | 5455 |
| 85 | Ga0068855_100149646 | 3300005563 | Bacteria | 2654 |
| 86 | Ga0068857_100021621 | 3300005577 | Bacteria | 5661 |
| 87 | Ga0068854_100194034 | 3300005578 | Unclassified | 1593 |
| 88 | Ga0068856_100010813 | 3300005614 | Bacteria | 8863 |
| 89 | Ga0068856_100037555 | 3300005614 | Bacteria | 4752 |
| 90 | Ga0070702_100023699 | 3300005615 | Unclassified | 3265 |
| 91 | Ga0070702_100146188 | 3300005615 | Bacteria | 1512 |
| 92 | Ga0070702_100195130 | 3300005615 | Bacteria | 1336 |
| 93 | Ga0068852_100124491 | 3300005616 | Bacteria | 2365 |
| 94 | Ga0068852_100137364 | 3300005616 | Bacteria | 2258 |
| 95 | Ga0068859_100002443 | 3300005617 | Bacteria | 18918 |
| 96 | Ga0068859_100030510 | 3300005617 | Bacteria | 5410 |
| 97 | Ga0068859_100079852 | 3300005617 | Bacteria | 3312 |
| 98 | Ga0068859_100126724 | 3300005617 | Bacteria | 2622 |
| 99 | Ga0068859_100169306 | 3300005617 | Bacteria | 2265 |
| 100 | Ga0068859_100173518 | 3300005617 | Bacteria | 2238 |
| 101 | Ga0068864_100021473 | 3300005618 | Bacteria | 5410 |
| 102 | Ga0068866_10151937 | 3300005718 | Bacteria | 1342 |
| 103 | Ga0068861_100002019 | 3300005719 | Bacteria | 13142 |
| 104 | Ga0068861_100012886 | 3300005719 | Bacteria | 5838 |
| 105 | Ga0068870_10009032 | 3300005840 | Unclassified | 4511 |
| 106 | Ga0068863_100155189 | 3300005841 | Bacteria | 2191 |
| 107 | Ga0068863_100468484 | 3300005841 | Bacteria | 1238 |
| 108 | Ga0068858_100000397 | 3300005842 | Bacteria | 45633 |
| 109 | Ga0068858_100024427 | 3300005842 | Bacteria | 5631 |
| 110 | Ga0068860_100000135 | 3300005843 | Bacteria | 120265 |
| 111 | Ga0068860_100030383 | 3300005843 | Bacteria | 5196 |
| 112 | Ga0068860_100164456 | 3300005843 | Bacteria | 2141 |
| 113 | Ga0068860_100264601 | 3300005843 | Unclassified | 1677 |
| 114 | Ga0068862_100006072 | 3300005844 | Bacteria | 10058 |
| 115 | Ga0068862_100022695 | 3300005844 | Bacteria | 5251 |
| 116 | Ga0068862_100278844 | 3300005844 | Unclassified | 1531 |
| 117 | Ga0081455_10001076 | 3300005937 | Bacteria | 34369 |
| 118 | Ga0081455_10027187 | 3300005937 | Bacteria | 5244 |
| 119 | Ga0081540_1000590 | 3300005983 | Bacteria | 34934 |
| 120 | Ga0081540_1020469 | 3300005983 | Bacteria | 3977 |
| 121 | Ga0081539_10014316 | 3300005985 | Bacteria | 5877 |
| 122 | Ga0070716_100002766 | 3300006173 | Bacteria | 8147 |
| 123 | Ga0070716_100005032 | 3300006173 | Bacteria | 6373 |
| 124 | Ga0070716_100093545 | 3300006173 | Unclassified | 1825 |
| 125 | Ga0097621_100010866 | 3300006237 | Bacteria | 6680 |
| 126 | Ga0097621_100106118 | 3300006237 | Bacteria | 2369 |
| 127 | Ga0097621_100185503 | 3300006237 | Bacteria | 1799 |
| 128 | Ga0075370_10039963 | 3300006353 | Bacteria | 2645 |
| 129 | Ga0068871_100219226 | 3300006358 | Bacteria | 1648 |
| 130 | Ga0075428_100001613 | 3300006844 | Bacteria | 24108 |
| 131 | Ga0075430_100004646 | 3300006846 | Bacteria | 11548 |
| 132 | Ga0075430_100008951 | 3300006846 | Bacteria | 8455 |
| 133 | Ga0075430_100066585 | 3300006846 | Bacteria | 3025 |
| 134 | Ga0075430_100125399 | 3300006846 | Bacteria | 2140 |
| 135 | Ga0075431_100006287 | 3300006847 | Bacteria | 11802 |
| 136 | Ga0075431_100047009 | 3300006847 | Bacteria | 4450 |
| 137 | Ga0075431_100314583 | 3300006847 | Bacteria | 1580 |
| 138 | Ga0075433_10003516 | 3300006852 | Bacteria | 12103 |
| 139 | Ga0075433_10280394 | 3300006852 | Bacteria | 1476 |
| 140 | Ga0075434_100000732 | 3300006871 | Bacteria | 25783 |
| 141 | Ga0075434_100385401 | 3300006871 | Bacteria | 1422 |
| 142 | Ga0075429_100000412 | 3300006880 | Bacteria | 31781 |
| 143 | Ga0075429_100015697 | 3300006880 | Bacteria | 6562 |
| 144 | Ga0075429_100077402 | 3300006880 | Unclassified | 2898 |
| 145 | Ga0075429_100290464 | 3300006880 | Bacteria | 1431 |
| 146 | Ga0068865_100005519 | 3300006881 | Bacteria | 7676 |
| 147 | Ga0075436_100003338 | 3300006914 | Bacteria | 10987 |
| 148 | Ga0075436_100004459 | 3300006914 | Bacteria | 9607 |
| 149 | Ga0075436_100096668 | 3300006914 | Bacteria | 2055 |
| 150 | Ga0097620_100002442 | 3300006931 | Bacteria | 18918 |
| 151 | Ga0097620_100030510 | 3300006931 | Bacteria | 5410 |
| 152 | Ga0097620_100079853 | 3300006931 | Bacteria | 3312 |
| 153 | Ga0097620_100126722 | 3300006931 | Bacteria | 2622 |
| 154 | Ga0097620_100169297 | 3300006931 | Bacteria | 2265 |
| 155 | Ga0097620_100173509 | 3300006931 | Bacteria | 2238 |
| 156 | Ga0075435_100241772 | 3300007076 | Bacteria | 1536 |
| 157 | Ga0099794_10000099 | 3300007265 | Bacteria | 32049 |
| 158 | Ga0105240_10001003 | 3300009093 | Bacteria | 50390 |
| 159 | Ga0105240_10007009 | 3300009093 | Bacteria | 16450 |
| 160 | Ga0105240_10159657 | 3300009093 | Unclassified | 2679 |
| 161 | Ga0105240_10210614 | 3300009093 | Bacteria | 2272 |
| 162 | Ga0111539_10003717 | 3300009094 | Bacteria | 20082 |
| 163 | Ga0111539_10010980 | 3300009094 | Bacteria | 11400 |
| 164 | Ga0111539_10015034 | 3300009094 | Bacteria | 9646 |
| 165 | Ga0111539_10024276 | 3300009094 | Bacteria | 7444 |
| 166 | Ga0111539_10220997 | 3300009094 | Bacteria | 2206 |
| 167 | Ga0105245_10006486 | 3300009098 | Bacteria | 10286 |
| 168 | Ga0105245_10056941 | 3300009098 | Bacteria | 3515 |
| 169 | Ga0105247_10051820 | 3300009101 | Bacteria | 2529 |
| 170 | Ga0105247_10066872 | 3300009101 | Bacteria | 2239 |
| 171 | Ga0114129_10002654 | 3300009147 | Bacteria | 24899 |
| 172 | Ga0114129_10004025 | 3300009147 | Bacteria | 20739 |
| 173 | Ga0114129_10006442 | 3300009147 | Bacteria | 16645 |
| 174 | Ga0114129_10010475 | 3300009147 | Bacteria | 13222 |
| 175 | Ga0114129_10629056 | 3300009147 | Bacteria | 1387 |
| 176 | Ga0105243_10010440 | 3300009148 | Bacteria | 7051 |
| 177 | Ga0105243_10038548 | 3300009148 | Bacteria | 3721 |
| 178 | Ga0105243_10113273 | 3300009148 | Bacteria | 2274 |
| 179 | Ga0105243_10256907 | 3300009148 | Bacteria | 1563 |
| 180 | Ga0105241_10060086 | 3300009174 | Bacteria | 2923 |
| 181 | Ga0105242_10003075 | 3300009176 | Bacteria | 13016 |
| 182 | Ga0105242_10599632 | 3300009176 | Unclassified | 1064 |
| 183 | Ga0105248_10001248 | 3300009177 | Bacteria | 28422 |
| 184 | Ga0105248_10075500 | 3300009177 | Bacteria | 3788 |
| 185 | Ga0105248_10105859 | 3300009177 | Bacteria | 3171 |
| 186 | Ga0105248_10188860 | 3300009177 | Bacteria | 2321 |
| 187 | Ga0105248_10350741 | 3300009177 | Bacteria | 1661 |
| 188 | Ga0105248_10394199 | 3300009177 | Bacteria | 1559 |
| 189 | Ga0105237_10000537 | 3300009545 | Bacteria | 53507 |
| 190 | Ga0105237_10003536 | 3300009545 | Bacteria | 18519 |
| 191 | Ga0105237_10096528 | 3300009545 | Bacteria | 2946 |
| 192 | Ga0105249_10005684 | 3300009553 | Bacteria | 10783 |
| 193 | Ga0105249_10016117 | 3300009553 | Bacteria | 6625 |
| 194 | Ga0105249_10148080 | 3300009553 | Bacteria | 2257 |
| 195 | Ga0105239_10000037 | 3300010375 | Bacteria | 206779 |
| 196 | Ga0105239_10000537 | 3300010375 | Bacteria | 54882 |
| 197 | Ga0105239_10032969 | 3300010375 | Bacteria | 5690 |
| 198 | Ga0105239_10044997 | 3300010375 | Bacteria | 4838 |
| 199 | Ga0105239_10144619 | 3300010375 | Bacteria | 2651 |
| 200 | Ga0105239_10400733 | 3300010375 | Bacteria | 1553 |
| 201 | Ga0105246_10015541 | 3300011119 | Bacteria | 4810 |
| 202 | Ga0157369_10138104 | 3300013105 | Bacteria | 2580 |
| 203 | Ga0157374_10041905 | 3300013296 | Bacteria | 4221 |
| 204 | Ga0157378_10011091 | 3300013297 | Bacteria | 7888 |
| 205 | Ga0157378_10020587 | 3300013297 | Bacteria | 5801 |
| 206 | Ga0157378_10030998 | 3300013297 | Bacteria | 4722 |
| 207 | Ga0157378_10194596 | 3300013297 | Bacteria | 1915 |
| 208 | Ga0163162_10030665 | 3300013306 | Bacteria | 5328 |
| 209 | Ga0163162_10053017 | 3300013306 | Bacteria | 4076 |
| 210 | Ga0157372_10132975 | 3300013307 | Bacteria | 2864 |
| 211 | Ga0157372_10749871 | 3300013307 | Bacteria | 1135 |
| 212 | Ga0157375_10002523 | 3300013308 | Bacteria | 15891 |
| 213 | Ga0157375_10081980 | 3300013308 | Bacteria | 3267 |
| 214 | Ga0157375_10115404 | 3300013308 | Bacteria | 2788 |
| 215 | Ga0157375_10136156 | 3300013308 | Bacteria | 2580 |
| 216 | Ga0163163_10072699 | 3300014325 | Bacteria | 3428 |
| 217 | Ga0163163_10289498 | 3300014325 | Bacteria | 1690 |
| 218 | Ga0157380_10000255 | 3300014326 | Bacteria | 31852 |
| 219 | Ga0157380_10001701 | 3300014326 | Bacteria | 14535 |
| 220 | Ga0157380_10018891 | 3300014326 | Bacteria | 5127 |
| 221 | Ga0157377_10001466 | 3300014745 | Bacteria | 10209 |
| 222 | Ga0157379_10020026 | 3300014968 | Bacteria | 5913 |
| 223 | Ga0157379_10029505 | 3300014968 | Bacteria | 4877 |
| 224 | Ga0157376_10011776 | 3300014969 | Bacteria | 6461 |
| 225 | Ga0157376_10200414 | 3300014969 | Bacteria | 1836 |
| 226 | Ga0163161_10036206 | 3300017792 | Bacteria | 3534 |
| 227 | Ga0213873_10000018 | 3300021358 | Bacteria | 123140 |
| 228 | Ga0213876_10000058 | 3300021384 | Bacteria | 134080 |
| 229 | Ga0209564_1000031 | 3300025295 | Bacteria | 494703 |
| 230 | Ga0209758_1000628 | 3300025297 | Bacteria | 54130 |
| 231 | Ga0209758_1004855 | 3300025297 | Bacteria | 10842 |
| 232 | Ga0209758_1011338 | 3300025297 | Bacteria | 5178 |
| 233 | Ga0209758_1043650 | 3300025297 | Bacteria | 1649 |
| 234 | Ga0209050_1003852 | 3300025298 | Bacteria | 10683 |
| 235 | Ga0209256_1000071 | 3300025299 | Bacteria | 242618 |
| 236 | Ga0207697_10028120 | 3300025315 | Bacteria | 2299 |
| 237 | Ga0207692_10030555 | 3300025898 | Bacteria | 2570 |
| 238 | Ga0207710_10031090 | 3300025900 | Bacteria | 2332 |
| 239 | Ga0207680_10017535 | 3300025903 | Unclassified | 3786 |
| 240 | Ga0207647_10004912 | 3300025904 | Bacteria | 9866 |
| 241 | Ga0207699_10057359 | 3300025906 | Bacteria | 2325 |
| 242 | Ga0207645_10080773 | 3300025907 | Bacteria | 2084 |
| 243 | Ga0207643_10008018 | 3300025908 | Bacteria | 5667 |
| 244 | Ga0207643_10152553 | 3300025908 | Unclassified | 1386 |
| 245 | Ga0207643_10201964 | 3300025908 | Unclassified | 1211 |
| 246 | Ga0207654_10102113 | 3300025911 | Bacteria | 1769 |
| 247 | Ga0207707_10106187 | 3300025912 | Bacteria | 2455 |
| 248 | Ga0207695_10003329 | 3300025913 | Bacteria | 22777 |
| 249 | Ga0207695_10068690 | 3300025913 | Bacteria | 3630 |
| 250 | Ga0207695_10109477 | 3300025913 | Bacteria | 2744 |
| 251 | Ga0207671_10001619 | 3300025914 | Bacteria | 25633 |
| 252 | Ga0207671_10013776 | 3300025914 | Bacteria | 6420 |
| 253 | Ga0207671_10342078 | 3300025914 | Unclassified | 1185 |
| 254 | Ga0207693_10014506 | 3300025915 | Bacteria | 6333 |
| 255 | Ga0207660_10004041 | 3300025917 | Bacteria | 9572 |
| 256 | Ga0207660_10046256 | 3300025917 | Unclassified | 3070 |
| 257 | Ga0207662_10003737 | 3300025918 | Bacteria | 7892 |
| 258 | Ga0207662_10103770 | 3300025918 | Bacteria | 1765 |
| 259 | Ga0207652_10071205 | 3300025921 | Bacteria | 3021 |
| 260 | Ga0207646_10000008 | 3300025922 | Bacteria | 457143 |
| 261 | Ga0207646_10000009 | 3300025922 | Bacteria | 453146 |
| 262 | Ga0207681_10070994 | 3300025923 | Bacteria | 2427 |
| 263 | Ga0207681_10083712 | 3300025923 | Bacteria | 2259 |
| 264 | Ga0207650_10043930 | 3300025925 | Bacteria | 3283 |
| 265 | Ga0207659_10065221 | 3300025926 | Bacteria | 2638 |
| 266 | Ga0207687_10007306 | 3300025927 | Bacteria | 7286 |
| 267 | Ga0207700_10033917 | 3300025928 | Bacteria | 3658 |
| 268 | Ga0207664_10231655 | 3300025929 | Bacteria | 1606 |
| 269 | Ga0207690_10297854 | 3300025932 | Bacteria | 1261 |
| 270 | Ga0207706_10013072 | 3300025933 | Bacteria | 7554 |
| 271 | Ga0207706_10015911 | 3300025933 | Bacteria | 6798 |
| 272 | Ga0207706_10028964 | 3300025933 | Bacteria | 4944 |
| 273 | Ga0207706_10272437 | 3300025933 | Bacteria | 1477 |
| 274 | Ga0207686_10008341 | 3300025934 | Bacteria | 5593 |
| 275 | Ga0207686_10041322 | 3300025934 | Bacteria | 2810 |
| 276 | Ga0207686_10067125 | 3300025934 | Unclassified | 2293 |
| 277 | Ga0207709_10002338 | 3300025935 | Bacteria | 11964 |
| 278 | Ga0207709_10170745 | 3300025935 | Bacteria | 1526 |
| 279 | Ga0207670_10230723 | 3300025936 | Bacteria | 1421 |
| 280 | Ga0207669_10000554 | 3300025937 | Bacteria | 16317 |
| 281 | Ga0207669_10002009 | 3300025937 | Bacteria | 8629 |
| 282 | Ga0207669_10127603 | 3300025937 | Bacteria | 1741 |
| 283 | Ga0207704_10119569 | 3300025938 | Bacteria | 1800 |
| 284 | Ga0207665_10003717 | 3300025939 | Bacteria | 10190 |
| 285 | Ga0207665_10010768 | 3300025939 | Bacteria | 6004 |
| 286 | Ga0207691_10061209 | 3300025940 | Unclassified | 3420 |
| 287 | Ga0207691_10177190 | 3300025940 | Bacteria | 1864 |
| 288 | Ga0207711_10004771 | 3300025941 | Bacteria | 11509 |
| 289 | Ga0207711_10016054 | 3300025941 | Bacteria | 6213 |
| 290 | Ga0207689_10001496 | 3300025942 | Bacteria | 22313 |
| 291 | Ga0207689_10004614 | 3300025942 | Bacteria | 12460 |
| 292 | Ga0207689_10012328 | 3300025942 | Bacteria | 7315 |
| 293 | Ga0207689_10017177 | 3300025942 | Bacteria | 6124 |
| 294 | Ga0207667_10054070 | 3300025949 | Bacteria | 4224 |
| 295 | Ga0207668_10008963 | 3300025972 | Bacteria | 5984 |
| 296 | Ga0207668_10087820 | 3300025972 | Unclassified | 2275 |
| 297 | Ga0207668_10215945 | 3300025972 | Bacteria | 1537 |
| 298 | Ga0207640_10009053 | 3300025981 | Bacteria | 5556 |
| 299 | Ga0207640_10262019 | 3300025981 | Unclassified | 1348 |
| 300 | Ga0207658_10051757 | 3300025986 | Bacteria | 3027 |
| 301 | Ga0207677_10043770 | 3300026023 | Bacteria | 2978 |
| 302 | Ga0207677_10123031 | 3300026023 | Bacteria | 1955 |
| 303 | Ga0207677_10128562 | 3300026023 | Bacteria | 1919 |
| 304 | Ga0207703_10001606 | 3300026035 | Bacteria | 20452 |
| 305 | Ga0207703_10019741 | 3300026035 | Bacteria | 5269 |
| 306 | Ga0207678_10022586 | 3300026067 | Bacteria | 5510 |
| 307 | Ga0207678_10110380 | 3300026067 | Bacteria | 2346 |
| 308 | Ga0207678_10181910 | 3300026067 | Bacteria | 1795 |
| 309 | Ga0207708_10002744 | 3300026075 | Bacteria | 12933 |
| 310 | Ga0207708_10014441 | 3300026075 | Bacteria | 5911 |
| 311 | Ga0207708_10076058 | 3300026075 | Bacteria | 2575 |
| 312 | Ga0207702_10222961 | 3300026078 | Bacteria | 1758 |
| 313 | Ga0207641_10150119 | 3300026088 | Bacteria | 2110 |
| 314 | Ga0207648_10002639 | 3300026089 | Bacteria | 19155 |
| 315 | Ga0207648_10029681 | 3300026089 | Bacteria | 4849 |
| 316 | Ga0207648_10042838 | 3300026089 | Bacteria | 3974 |
| 317 | Ga0207674_10033963 | 3300026116 | Bacteria | 5335 |
| 318 | Ga0207675_100000282 | 3300026118 | Bacteria | 48883 |
| 319 | Ga0207675_100001855 | 3300026118 | Bacteria | 21175 |
| 320 | Ga0207675_100014304 | 3300026118 | Bacteria | 7398 |
| 321 | Ga0207675_100081355 | 3300026118 | Bacteria | 3037 |
| 322 | Ga0207683_10018973 | 3300026121 | Bacteria | 5869 |
| 323 | Ga0207683_10086757 | 3300026121 | Bacteria | 2783 |
| 324 | Ga0207683_10094845 | 3300026121 | Unclassified | 2660 |
| 325 | Ga0207683_10128993 | 3300026121 | Bacteria | 2274 |
| 326 | Ga0207698_10190881 | 3300026142 | Bacteria | 1825 |
| 327 | Ga0209588_1000276 | 3300027671 | Bacteria | 13648 |
| 328 | Ga0209974_10005986 | 3300027876 | Bacteria | 4258 |
| 329 | Ga0207428_10049318 | 3300027907 | Bacteria | 3374 |
| 330 | Ga0207428_10092400 | 3300027907 | Bacteria | 2348 |
| 331 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 332 | Ga0268265_10012036 | 3300028380 | Bacteria | 5856 |
| 333 | Ga0268265_10036681 | 3300028380 | Unclassified | 3592 |
| 334 | Ga0268264_10000038 | 3300028381 | Bacteria | 383623 |
| 335 | Ga0268264_10082198 | 3300028381 | Bacteria | 2755 |
| 336 | Ga0268264_10198098 | 3300028381 | Bacteria | 1835 |
| 337 | Ga0307511_10110457 | 3300030521 | Bacteria | 1752 |
| 338 | Ga0307511_10123666 | 3300030521 | Bacteria | 1588 |
| 339 | Ga0265325_10004858 | 3300031241 | Bacteria | 8401 |
| 340 | Ga0265339_10000109 | 3300031249 | Bacteria | 66969 |
| 341 | Ga0307513_10007695 | 3300031456 | Bacteria | 13922 |
| 342 | Ga0307509_10067612 | 3300031507 | Bacteria | 3742 |
| 343 | Ga0265313_10000257 | 3300031595 | Bacteria | 57767 |
| 344 | Ga0265314_10052549 | 3300031711 | Bacteria | 2831 |
| 345 | Ga0307516_10001624 | 3300031730 | Bacteria | 30958 |
| 346 | Ga0316577_10034730 | 3300031733 | Bacteria | 2818 |
| 347 | Ga0307407_10057727 | 3300031903 | Bacteria | 2253 |
| 348 | Ga0307409_100249371 | 3300031995 | Bacteria | 1622 |
| 349 | Ga0307416_100059757 | 3300032002 | Bacteria | 3100 |
| 350 | Ga0307414_10016334 | 3300032004 | Bacteria | 4510 |
| 351 | Ga0307414_10085019 | 3300032004 | Bacteria | 2329 |
| 352 | Ga0307414_10112891 | 3300032004 | Bacteria | 2073 |
| 353 | Ga0307414_10205215 | 3300032004 | Bacteria | 1607 |
| 354 | Ga0307411_10002864 | 3300032005 | Bacteria | 7796 |
| 355 | Ga0307415_100153021 | 3300032126 | Bacteria | 1778 |
| 356 | Ga0307415_100463947 | 3300032126 | Bacteria | 1098 |
| 357 | Ga0316593_10000965 | 3300032168 | Bacteria | 5943 |
| 358 | Ga0316593_10006768 | 3300032168 | Bacteria | 3115 |
| 359 | Ga0307507_10053079 | 3300033179 | Bacteria | 3877 |
| 360 | Ga0373926_0155562 | 3300035083 | Bacteria | 871 |
| 361 | Ga0373934_0007036 | 3300035086 | Bacteria | 4173 |
| 362 | Ga0373932_0007238 | 3300035112 | Bacteria | 2639 |
| 363 | Ga0373936_0010325 | 3300035113 | Unclassified | 3524 |
| 364 | Ga0373945_0037585 | 3300035116 | Bacteria | 1738 |
| 365 | Ga0373953_0004717 | 3300035117 | Bacteria | 4368 |
| 366 | Ga0373954_0002190 | 3300035118 | Bacteria | 8122 |
| 367 | Ga0373956_0001065 | 3300035119 | Bacteria | 11292 |
| 368 | Ga0373957_0001462 | 3300035120 | Bacteria | 6402 |
| 369 | Ga0373943_0000592 | 3300035170 | Bacteria | 15728 |
| 370 | Ga0373955_0066166 | 3300035172 | Bacteria | 2008 |
| 371 | Ga0373931_0019233 | 3300035691 | Bacteria | 3407 |
| 372 | Ga0373935_0144321 | 3300035692 | Bacteria | 1610 |
| 373 | Ga0373935_0159320 | 3300035692 | Unclassified | 1537 |
| 374 | Ga0373927_0021622 | 3300035695 | Bacteria | 4217 |
| 375 | Ga0373927_0032538 | 3300035695 | Bacteria | 3396 |
| 376 | Ga0373927_0036631 | 3300035695 | Bacteria | 3190 |
| 377 | Ga0373933_0002728 | 3300035724 | Bacteria | 9875 |
| 378 | Ga0373947_0007044 | 3300035725 | Bacteria | 6517 |
| 379 | Ga0373947_0018618 | 3300035725 | Bacteria | 3998 |
| 380 | Ga0373937_0041035 | 3300036401 | Bacteria | 4220 |
| 381 | Ga0316582_0022433 | 3300036647 | Bacteria | 3748 |
| 382 | Ga0373925_0043763 | 3300037068 | Bacteria | 3324 |
| 383 | Ga0373925_0069110 | 3300037068 | Bacteria | 2667 |
| 384 | Ga0373925_0180613 | 3300037068 | Bacteria | 1670 |
| 385 | Ga0373925_0246348 | 3300037068 | Bacteria | 1432 |
| 386 | Ga0395899_0085555 | 3300037312 | Bacteria | 2291 |
| 387 | Ga0395900_0028161 | 3300037418 | Bacteria | 5754 |
| 388 | Ga0395905_0103901 | 3300037471 | Bacteria | 2667 |
| 389 | Ga0436364_0420422 | 3300037853 | Bacteria | 1718 |
| 390 | Ga0436364_0459481 | 3300037853 | Bacteria | 4337 |
| 391 | Ga0436364_1376026 | 3300037853 | Bacteria | 2499 |
| 392 | Ga0395901_0016073 | 3300038443 | Bacteria | 7626 |
| 393 | Ga0395901_0193283 | 3300038443 | Bacteria | 2134 |
| 394 | Ga0400484_19896 | 3300038725 | Bacteria | 2116 |
| 395 | Ga0400490_09372 | 3300038726 | Bacteria | 14741 |
| 396 | Ga0400490_10463 | 3300038726 | Bacteria | 6199 |
| 397 | Ga0400490_39904 | 3300038726 | Bacteria | 15867 |
| 398 | Ga0400486_10384 | 3300038742 | Bacteria | 8720 |
| 399 | Ga0400486_17264 | 3300038742 | Bacteria | 7284 |
| 400 | Ga0400483_207311 | 3300039062 | Bacteria | 1684 |
| 401 | Ga0400483_234344 | 3300039062 | Bacteria | 3636 |
| 402 | Ga0436365_0337700 | 3300039437 | Bacteria | 40984 |
| 403 | Ga0436365_1710345 | 3300039437 | Bacteria | 5598 |
| 404 | Ga0436360_1061678 | 3300039438 | Bacteria | 1413 |
| 405 | Ga0436360_1335800 | 3300039438 | Unclassified | 1233 |
| 406 | Ga0436363_1527683 | 3300039450 | Bacteria | 3384 |
| 407 | Ga0436363_1599379 | 3300039450 | Unclassified | 2867 |
| 408 | Ga0436362_0011715 | 3300039453 | Bacteria | 44760 |
| 409 | Ga0439453_0002669 | 3300041408 | Bacteria | 2484 |
| 410 | Ga0451853_3003930 | 3300041512 | Bacteria | 3432 |
| 411 | Ga0439443_007424 | 3300042003 | Bacteria | 1525 |
| 412 | Ga0439449_0012140 | 3300042007 | Bacteria | 3239 |
| 413 | Ga0439434_0006060 | 3300042435 | Bacteria | 3528 |
| 414 | Ga0439435_0016645 | 3300042436 | Bacteria | 1847 |
| 415 | Ga0439464_0028552 | 3300042439 | Bacteria | 1555 |
| 416 | Ga0451577_0001797 | 3300042876 | Bacteria | 27439 |
| 417 | Ga0451577_0011700 | 3300042876 | Bacteria | 8284 |
| 418 | Ga0451577_0090385 | 3300042876 | Unclassified | 2733 |
| 419 | Ga0466969_0043481 | 3300044656 | Unclassified | 2239 |
| 420 | Ga0466973_0115202 | 3300044659 | Bacteria | 2232 |
| 421 | Ga0453683_0000931 | 3300044673 | Bacteria | 27801 |
| 422 | Ga0453683_0008486 | 3300044673 | Bacteria | 6892 |
| 423 | Ga0453684_0000762 | 3300044712 | Bacteria | 111891 |
| 424 | Ga0453684_0007497 | 3300044712 | Bacteria | 20015 |
| 425 | Ga0453684_0013804 | 3300044712 | Bacteria | 13054 |
| 426 | Ga0453684_0048547 | 3300044712 | Bacteria | 5610 |
| 427 | Ga0453684_0070803 | 3300044712 | Bacteria | 4413 |
| 428 | Ga0453684_0101103 | 3300044712 | Bacteria | 3528 |
| 429 | Ga0453684_0122837 | 3300044712 | Unclassified | 3132 |
| 430 | Ga0453684_0482815 | 3300044712 | Bacteria | 1374 |
| 431 | Ga0451576_0002498 | 3300045051 | Bacteria | 27301 |
| 432 | Ga0451576_0004796 | 3300045051 | Bacteria | 17332 |
| 433 | Ga0451576_0151200 | 3300045051 | Bacteria | 2421 |
| 434 | Ga0451576_0456998 | 3300045051 | Bacteria | 1341 |
| 435 | Ga0495638_0082280 | 3300046460 | Bacteria | 1953 |
| 436 | Ga0495641_0068483 | 3300046461 | Bacteria | 1596 |
| 437 | Ga0495580_0001979 | 3300046472 | Bacteria | 18014 |
| 438 | Ga0495584_0007601 | 3300046491 | Bacteria | 5648 |
| 439 | Ga0495606_0083994 | 3300046507 | Bacteria | 1973 |
| 440 | Ga0495608_0045480 | 3300046511 | Bacteria | 2925 |
| 441 | Ga0495618_0043761 | 3300046514 | Bacteria | 2825 |
| 442 | Ga0495620_0067732 | 3300046515 | Bacteria | 1468 |
| 443 | Ga0495630_0085356 | 3300046517 | Bacteria | 2383 |
| 444 | Ga0495632_0000506 | 3300046519 | Bacteria | 36758 |
| 445 | Ga0495648_0000357 | 3300046524 | Bacteria | 50228 |
| 446 | Ga0495663_0001112 | 3300046525 | Bacteria | 8690 |
| 447 | Ga0495586_0097074 | 3300046535 | Bacteria | 1632 |
| 448 | Ga0495622_0035633 | 3300046557 | Bacteria | 2320 |
| 449 | Ga0495667_0001884 | 3300046559 | Bacteria | 13924 |
| 450 | Ga0495668_0158027 | 3300046616 | Bacteria | 1242 |
| 451 | Ga0495611_0099993 | 3300046648 | Bacteria | 1346 |
| 452 | Ga0495625_0010682 | 3300046660 | Bacteria | 7565 |
| 453 | Ga0495625_0104058 | 3300046660 | Bacteria | 1946 |
| 454 | Ga0495635_0108499 | 3300046663 | Unclassified | 1897 |
| 455 | Ga0495588_0135278 | 3300046674 | Bacteria | 1301 |
| 456 | Ga0495658_0017873 | 3300046683 | Bacteria | 3675 |
| 457 | Ga0495658_0160584 | 3300046683 | Bacteria | 1386 |
| 458 | Ga0495669_0000283 | 3300046684 | Bacteria | 29078 |
| 459 | Ga0495660_0018361 | 3300046810 | Bacteria | 4021 |
| 460 | Ga0495604_0053150 | 3300047317 | Bacteria | 3133 |
| 461 | Ga0495680_0098432 | 3300047322 | Bacteria | 2182 |
| 462 | Ga0495683_0037152 | 3300047323 | Bacteria | 2470 |
| 463 | Ga0495687_000240 | 3300047443 | Bacteria | 75621 |
| 464 | Ga0495685_042295 | 3300047447 | Bacteria | 1555 |
| 465 | Ga0495681_0005652 | 3300047470 | Bacteria | 8330 |
| 466 | Ga0495684_0050570 | 3300047471 | Bacteria | 3172 |
| 467 | Ga0495686_0015635 | 3300047472 | Bacteria | 5175 |
| 468 | Ga0495686_0157363 | 3300047472 | Bacteria | 1330 |
| 469 | Ga0496100_0006983 | 3300048903 | Bacteria | 6191 |
| 470 | Ga0496101_0164562 | 3300048904 | Bacteria | 1702 |
| 471 | Ga0496102_0025634 | 3300048905 | Bacteria | 5252 |
| 472 | Ga0496102_0401730 | 3300048905 | Bacteria | 1288 |
| 473 | Ga0496104_0264581 | 3300048907 | Bacteria | 1632 |
| 474 | Ga0496104_0267881 | 3300048907 | Bacteria | 1620 |
| 475 | Ga0496105_0003823 | 3300048908 | Bacteria | 11233 |
| 476 | Ga0496105_0211385 | 3300048908 | Bacteria | 1581 |
| 477 | Ga0496106_0000635 | 3300048909 | Bacteria | 25180 |
| 478 | Ga0496106_0000846 | 3300048909 | Bacteria | 22208 |
| 479 | Ga0496106_0059308 | 3300048909 | Bacteria | 2898 |
| 480 | Ga0496106_0138482 | 3300048909 | Bacteria | 1913 |
| 481 | Ga0496106_0350027 | 3300048909 | Bacteria | 1187 |
| 482 | Ga0496107_0014595 | 3300048910 | Bacteria | 5498 |
| 483 | Ga0496108_0377986 | 3300048911 | Bacteria | 1237 |
| 484 | Ga0496108_0556205 | 3300048911 | Bacteria | 1001 |
| 485 | Ga0496109_0046953 | 3300048912 | Bacteria | 3924 |
| 486 | Ga0496109_0267695 | 3300048912 | Bacteria | 1610 |
| 487 | Ga0496110_0179147 | 3300048913 | Bacteria | 1924 |
| 488 | Ga0496112_0028632 | 3300048915 | Bacteria | 5379 |
| 489 | Ga0496112_0115905 | 3300048915 | Bacteria | 2649 |
| 490 | Ga0496113_0052808 | 3300048916 | Bacteria | 3037 |
| 491 | Ga0496114_0146755 | 3300048917 | Bacteria | 2045 |
| 492 | Ga0496115_0010674 | 3300048918 | Bacteria | 6868 |
| 493 | Ga0496115_0064804 | 3300048918 | Bacteria | 2951 |
| 494 | Ga0496117_0014005 | 3300048920 | Bacteria | 6943 |
| 495 | Ga0496117_0031818 | 3300048920 | Bacteria | 4022 |
| 496 | Ga0496118_0005969 | 3300048921 | Bacteria | 13587 |
| 497 | Ga0496118_0010900 | 3300048921 | Bacteria | 8941 |
| 498 | Ga0496118_0042422 | 3300048921 | Bacteria | 3589 |
| 499 | Ga0496121_0000066 | 3300048924 | Bacteria | 267065 |
| 500 | Ga0496121_0000099 | 3300048924 | Bacteria | 200160 |
| 501 | Ga0496121_0000711 | 3300048924 | Bacteria | 61682 |
| 502 | Ga0496124_0001203 | 3300048927 | Bacteria | 40096 |
| 503 | Ga0496124_0004730 | 3300048927 | Bacteria | 15715 |
| 504 | Ga0496125_0027424 | 3300048928 | Bacteria | 5162 |
| 505 | Ga0496125_0031356 | 3300048928 | Bacteria | 4739 |
| 506 | Ga0496126_0005951 | 3300048929 | Bacteria | 13731 |
| 507 | Ga0496126_0006087 | 3300048929 | Bacteria | 13533 |
| 508 | Ga0496126_0006199 | 3300048929 | Bacteria | 13378 |
| 509 | Ga0496126_0014718 | 3300048929 | Bacteria | 7892 |
| 510 | Ga0496126_0114840 | 3300048929 | Bacteria | 2342 |
| 511 | Ga0501298_018144 | 3300049521 | Unclassified | 1291 |
| 512 | Ga0501031_0049975 | 3300049568 | Bacteria | 2725 |
| 513 | Ga0501034_0202121 | 3300049571 | Unclassified | 1945 |
| 514 | Ga0501036_0026421 | 3300049572 | Bacteria | 4901 |
| 515 | Ga0501037_0086893 | 3300049573 | Unclassified | 2263 |
| 516 | Ga0501038_0147178 | 3300049574 | Bacteria | 1922 |
| 517 | Ga0501038_0199948 | 3300049574 | Bacteria | 1604 |
| 518 | Ga0501039_0000220 | 3300049575 | Bacteria | 41747 |
| 519 | Ga0501039_0030462 | 3300049575 | Bacteria | 4161 |
| 520 | Ga0501039_0134661 | 3300049575 | Bacteria | 1940 |
| 521 | Ga0501039_0186886 | 3300049575 | Bacteria | 1629 |
| 522 | Ga0501041_0018142 | 3300049577 | Bacteria | 4191 |
| 523 | Ga0501041_0071494 | 3300049577 | Unclassified | 2130 |
| 524 | Ga0501042_0002227 | 3300049578 | Bacteria | 11835 |
| 525 | Ga0501043_0012347 | 3300049579 | Bacteria | 6678 |
| 526 | Ga0501046_0006026 | 3300049580 | Bacteria | 10783 |
| 527 | Ga0501046_0015633 | 3300049580 | Bacteria | 6373 |
| 528 | Ga0501047_0000631 | 3300049581 | Bacteria | 37077 |
| 529 | Ga0501048_0020880 | 3300049582 | Unclassified | 4797 |
| 530 | Ga0501048_0044434 | 3300049582 | Bacteria | 3177 |
| 531 | Ga0501068_0092971 | 3300049584 | Bacteria | 1863 |
| 532 | Ga0501071_0031703 | 3300049587 | Bacteria | 3749 |
| 533 | Ga0501071_0171677 | 3300049587 | Bacteria | 1623 |
| 534 | Ga0501076_0072255 | 3300049592 | Bacteria | 2761 |
| 535 | Ga0501224_000028 | 3300049664 | Bacteria | 53596 |
| 536 | Ga0501249_000339 | 3300049679 | Bacteria | 12675 |
| 537 | Ga0501225_0005082 | 3300049705 | Bacteria | 3878 |
| 538 | Ga0501081_0106738 | 3300049743 | Bacteria | 1985 |
| 539 | Ga0501035_0000923 | 3300049822 | Bacteria | 31113 |
| 540 | Ga0501035_0015693 | 3300049822 | Bacteria | 6991 |
| 541 | Ga0501035_0036200 | 3300049822 | Bacteria | 4474 |
| 542 | Ga0501226_000128 | 3300049853 | Bacteria | 15003 |
| 543 | nmdc:mga06z11_21431_c1 | 3300050494 | Bacteria | 3003 |
| 544 | nmdc:mga07m45_33781_c1 | 3300050496 | Bacteria | 2841 |
| 545 | nmdc:mga05p37_1800_c1 | 3300050507 | Bacteria | 25037 |
| 546 | nmdc:mga05p37_2725_c1 | 3300050507 | Bacteria | 20523 |
| 547 | nmdc:mga05p37_319259_c1 | 3300050507 | Bacteria | 1839 |
| 548 | nmdc:mga05p37_97139_c1 | 3300050507 | Bacteria | 3629 |
| 549 | nmdc:mga09592_106430_c1 | 3300050508 | Unclassified | 2405 |
| 550 | nmdc:mga09592_266161_c1 | 3300050508 | Bacteria | 1487 |
| 551 | nmdc:mga09592_2740_c1 | 3300050508 | Bacteria | 14239 |
| 552 | nmdc:mga0qj67_19373_c1 | 3300050509 | Bacteria | 5198 |
| 553 | nmdc:mga0qj67_4545_c1 | 3300050509 | Bacteria | 10054 |
| 554 | nmdc:mga0qj67_8376_c1 | 3300050509 | Bacteria | 7665 |
| 555 | nmdc:mga06r32_275077_c1 | 3300050510 | Unclassified | 1671 |
| 556 | nmdc:mga08y16_10425_c1 | 3300050511 | Bacteria | 9749 |
| 557 | nmdc:mga08y16_11655_c1 | 3300050511 | Bacteria | 9237 |
| 558 | nmdc:mga08y16_161938_c1 | 3300050511 | Bacteria | 2325 |
| 559 | nmdc:mga08y16_164498_c1 | 3300050511 | Bacteria | 2305 |
| 560 | nmdc:mga08y16_47350_c1 | 3300050511 | Bacteria | 4500 |
| 561 | nmdc:mga08y16_57501_c1 | 3300050511 | Bacteria | 4064 |
| 562 | nmdc:mga08y16_91004_c1 | 3300050511 | Bacteria | 3180 |
| 563 | nmdc:mga0n895_216016_c1 | 3300050512 | Bacteria | 1947 |
| 564 | nmdc:mga0n895_3487_c1 | 3300050512 | Bacteria | 12698 |
| 565 | nmdc:mga08x19_1584_c2 | 3300050514 | Bacteria | 10787 |
| 566 | nmdc:mga08x19_3752_c1 | 3300050514 | Bacteria | 9042 |
| 567 | nmdc:mga0a205_6621_c1 | 3300050515 | Bacteria | 10485 |
| 568 | Ga0495601_0114222 | 3300053077 | Bacteria | 1751 |
| 569 | Ga0500635_0020933 | 3300053080 | Bacteria | 2009 |
| 570 | Ga0500635_0079914 | 3300053080 | Bacteria | 1173 |
| 571 | Ga0495619_0197753 | 3300053085 | Bacteria | 1392 |
| 572 | Ga0500647_0023976 | 3300053091 | Bacteria | 2867 |
| 573 | Ga0500583_0090130 | 3300053092 | Bacteria | 1492 |
| 574 | Ga0500648_163790 | 3300053097 | Bacteria | 1166 |
| 575 | Ga0500556_0024720 | 3300053104 | Unclassified | 1977 |
| 576 | Ga0500556_0028003 | 3300053104 | Bacteria | 1888 |
| 577 | Ga0500595_001318 | 3300053119 | Bacteria | 13452 |
| 578 | Ga0500595_002291 | 3300053119 | Bacteria | 9607 |
| 579 | Ga0500595_015008 | 3300053119 | Bacteria | 2922 |
| 580 | Ga0500597_062864 | 3300053120 | Bacteria | 1597 |
| 581 | Ga0500642_0002173 | 3300053130 | Bacteria | 5697 |
| 582 | Ga0500568_0006551 | 3300053139 | Bacteria | 5829 |
| 583 | Ga0500573_0005791 | 3300053140 | Bacteria | 6632 |
| 584 | Ga0500573_0045984 | 3300053140 | Bacteria | 2515 |
| 585 | Ga0500589_093278 | 3300053147 | Bacteria | 1321 |
| 586 | Ga0500590_055936 | 3300053148 | Bacteria | 1995 |
| 587 | Ga0500603_006556 | 3300053150 | Bacteria | 2533 |
| 588 | Ga0500604_0000202 | 3300053151 | Bacteria | 16991 |
| 589 | Ga0500616_0003160 | 3300053153 | Bacteria | 12846 |
| 590 | Ga0500638_025950 | 3300053162 | Bacteria | 2804 |
| 591 | Ga0500638_100694 | 3300053162 | Bacteria | 1348 |
| 592 | Ga0500639_056580 | 3300053163 | Bacteria | 2031 |
| 593 | Ga0500636_0020033 | 3300053177 | Bacteria | 3956 |
| 594 | Ga0500636_0088668 | 3300053177 | Bacteria | 1774 |
| 595 | Ga0500645_000134 | 3300053730 | Bacteria | 58275 |
| 596 | Ga0500645_024167 | 3300053730 | Bacteria | 1859 |
| 597 | Ga0500661_004008 | 3300055283 | Bacteria | 2756 |
| 598 | Ga0501082_0000073 | 3300060353 | Bacteria | 73297 |
| 599 | Ga0501082_0119558 | 3300060353 | Bacteria | 2283 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035083 | Ga0373926_0155562 | Ga0373926_0155562_19_861 | 280 |
| 2 | 3300049574 | Ga0501038_0199948 | Ga0501038_0199948_714_1580 | 287 |
| 3 | 3300048911 | Ga0496108_0556205 | Ga0496108_0556205_78_986 | 302 |
| 4 | 3300049577 | Ga0501041_0071494 | Ga0501041_0071494_54_971 | 304 |
| 5 | 3300050509 | nmdc:mga0qj67_8376_c1 | nmdc:mga0qj67_8376_c1_6281_7309 | 317 |
| 6 | 3300050510 | nmdc:mga06r32_275077_c1 | nmdc:mga06r32_275077_c1_551_1579 | 317 |
| 7 | 3300006173 | Ga0070716_100093545 | Ga0070716_1000935453 | 319 |
| 8 | 3300009148 | Ga0105243_10113273 | Ga0105243_101132732 | 327 |
| 9 | 3300009176 | Ga0105242_10599632 | Ga0105242_105996321 | 327 |
| 10 | 3300009177 | Ga0105248_10188860 | Ga0105248_101888602 | 327 |
| 11 | 3300009553 | Ga0105249_10148080 | Ga0105249_101480802 | 327 |
| 12 | 3300013297 | Ga0157378_10194596 | Ga0157378_101945961 | 327 |
| 13 | 3300050511 | nmdc:mga08y16_161938_c1 | nmdc:mga08y16_161938_c1_1105_2088 | 327 |
| 14 | 3300032168 | Ga0316593_10006768 | Ga0316593_100067682 | 328 |
| 15 | 3300050508 | nmdc:mga09592_266161_c1 | nmdc:mga09592_266161_c1_402_1445 | 331 |
| 16 | 3300026118 | Ga0207675_100014304 | Ga0207675_1000143042 | 333 |
| 17 | 3300049571 | Ga0501034_0202121 | Ga0501034_0202121_329_1369 | 334 |
| 18 | 3300049572 | Ga0501036_0026421 | Ga0501036_0026421_2194_3234 | 334 |
| 19 | 3300049574 | Ga0501038_0147178 | Ga0501038_0147178_831_1871 | 334 |
| 20 | 3300049575 | Ga0501039_0000220 | Ga0501039_0000220_900_1940 | 334 |
| 21 | 3300049577 | Ga0501041_0018142 | Ga0501041_0018142_2441_3481 | 334 |
| 22 | 3300049578 | Ga0501042_0002227 | Ga0501042_0002227_5150_6190 | 334 |
| 23 | 3300049580 | Ga0501046_0006026 | Ga0501046_0006026_2783_3823 | 334 |
| 24 | 3300049582 | Ga0501048_0020880 | Ga0501048_0020880_3245_4285 | 334 |
| 25 | 3300049587 | Ga0501071_0031703 | Ga0501071_0031703_608_1648 | 334 |
| 26 | 3300049822 | Ga0501035_0015693 | Ga0501035_0015693_5134_6174 | 334 |
| 27 | 3300032004 | Ga0307414_10016334 | Ga0307414_100163342 | 335 |
| 28 | 3300049664 | Ga0501224_000028 | Ga0501224_000028_18887_19936 | 336 |
| 29 | 3300049705 | Ga0501225_0005082 | Ga0501225_0005082_1039_2088 | 336 |
| 30 | 3300049853 | Ga0501226_000128 | Ga0501226_000128_9019_10068 | 336 |
| 31 | 3300060353 | Ga0501082_0000073 | Ga0501082_0000073_51453_52487 | 336 |
| 32 | 3300009545 | Ga0105237_10096528 | Ga0105237_100965282 | 338 |
| 33 | 3300010375 | Ga0105239_10144619 | Ga0105239_101446192 | 338 |
| 34 | 3300010375 | Ga0105239_10400733 | Ga0105239_104007332 | 338 |
| 35 | 3300035692 | Ga0373935_0144321 | Ga0373935_0144321_264_1280 | 338 |
| 36 | 3300035695 | Ga0373927_0032538 | Ga0373927_0032538_234_1250 | 338 |
| 37 | 3300037068 | Ga0373925_0043763 | Ga0373925_0043763_961_1977 | 338 |
| 38 | 3300046557 | Ga0495622_0035633 | Ga0495622_0035633_558_1574 | 338 |
| 39 | 3300046683 | Ga0495658_0160584 | Ga0495658_0160584_114_1130 | 338 |
| 40 | 3300048909 | Ga0496106_0000635 | Ga0496106_0000635_18166_19182 | 338 |
| 41 | 3300048921 | Ga0496118_0010900 | Ga0496118_0010900_5258_6274 | 338 |
| 42 | 3300048924 | Ga0496121_0000711 | Ga0496121_0000711_8006_9022 | 338 |
| 43 | 3300048927 | Ga0496124_0001203 | Ga0496124_0001203_13201_14217 | 338 |
| 44 | 3300048928 | Ga0496125_0031356 | Ga0496125_0031356_3322_4338 | 338 |
| 45 | 3300048929 | Ga0496126_0006087 | Ga0496126_0006087_124_1140 | 338 |
| 46 | 3300053077 | Ga0495601_0114222 | Ga0495601_0114222_539_1555 | 338 |
| 47 | 3300053080 | Ga0500635_0079914 | Ga0500635_0079914_46_1062 | 338 |
| 48 | 3300053097 | Ga0500648_163790 | Ga0500648_163790_95_1111 | 338 |
| 49 | 3300053120 | Ga0500597_062864 | Ga0500597_062864_433_1449 | 338 |
| 50 | 3300053140 | Ga0500573_0045984 | Ga0500573_0045984_674_1690 | 338 |
| 51 | 3300053162 | Ga0500638_025950 | Ga0500638_025950_1743_2759 | 338 |
| 52 | 3300031733 | Ga0316577_10034730 | Ga0316577_100347303 | 339 |
| 53 | 3300048929 | Ga0496126_0005951 | Ga0496126_0005951_1923_2942 | 339 |
| 54 | 3300048929 | Ga0496126_0114840 | Ga0496126_0114840_767_1789 | 339 |
| 55 | 3300053177 | Ga0500636_0088668 | Ga0500636_0088668_159_1181 | 339 |
| 56 | 3300037853 | Ga0436364_1376026 | Ga0436364_1376026_221_1249 | 340 |
| 57 | 3300039438 | Ga0436360_1335800 | Ga0436360_1335800_145_1173 | 340 |
| 58 | 3300037312 | Ga0395899_0085555 | Ga0395899_0085555_921_1955 | 341 |
| 59 | 3300037418 | Ga0395900_0028161 | Ga0395900_0028161_4074_5108 | 341 |
| 60 | 3300037471 | Ga0395905_0103901 | Ga0395905_0103901_925_2010 | 341 |
| 61 | 3300038443 | Ga0395901_0016073 | Ga0395901_0016073_2870_3904 | 341 |
| 62 | 3300050507 | nmdc:mga05p37_97139_c1 | nmdc:mga05p37_97139_c1_1413_2447 | 341 |
| 63 | 3300005290 | Ga0065712_10069472 | Ga0065712_100694724 | 342 |
| 64 | 3300005331 | Ga0070670_100021623 | Ga0070670_1000216232 | 342 |
| 65 | 3300005354 | Ga0070675_100074553 | Ga0070675_1000745533 | 342 |
| 66 | 3300005543 | Ga0070672_100163169 | Ga0070672_1001631692 | 342 |
| 67 | 3300009098 | Ga0105245_10006486 | Ga0105245_100064867 | 342 |
| 68 | 3300025908 | Ga0207643_10201964 | Ga0207643_102019641 | 342 |
| 69 | 3300025925 | Ga0207650_10043930 | Ga0207650_100439302 | 342 |
| 70 | 3300025926 | Ga0207659_10065221 | Ga0207659_100652213 | 342 |
| 71 | iso_pu_bacteria | 8055431914 | 8055434398 | 342 |
| 72 | iso_pu_bacteria | 2507262055 | 2507506958 | 343 |
| 73 | iso_pu_bacteria | 2876808645 | 2876815078 | 343 |
| 74 | iso_pu_bacteria | 2879110137 | 2879117845 | 343 |
| 75 | iso_pu_bacteria | 2889033259 | 2889042407 | 343 |
| 76 | 3300005367 | Ga0070667_100074208 | Ga0070667_1000742083 | 344 |
| 77 | 3300005617 | Ga0068859_100126724 | Ga0068859_1001267244 | 344 |
| 78 | 3300006931 | Ga0097620_100126722 | Ga0097620_1001267224 | 344 |
| 79 | 3300009177 | Ga0105248_10075500 | Ga0105248_100755002 | 344 |
| 80 | 3300025986 | Ga0207658_10051757 | Ga0207658_100517572 | 344 |
| 81 | 3300038726 | Ga0400490_09372 | Ga0400490_09372_8626_9660 | 344 |
| 82 | 3300039062 | Ga0400483_234344 | Ga0400483_234344_579_1613 | 344 |
| 83 | iso_pu_bacteria | 2842747753 | 2842748060 | 344 |
| 84 | iso_pu_bacteria | 2885429604 | 2885429766 | 344 |
| 85 | iso_pu_bacteria | 3007252601 | 3007256540 | 344 |
| 86 | iso_pu_bacteria | 3007315729 | 3007319228 | 344 |
| 87 | 3300009093 | Ga0105240_10001003 | Ga0105240_100010039 | 345 |
| 88 | 3300025913 | Ga0207695_10003329 | Ga0207695_100033299 | 345 |
| 89 | 3300047447 | Ga0495685_042295 | Ga0495685_042295_144_1181 | 345 |
| 90 | iso_pu_bacteria | 2513237104 | 2513723875 | 345 |
| 91 | iso_pu_bacteria | 2643221605 | 2644037657 | 345 |
| 92 | iso_pu_bacteria | 3005409236 | 3005413437 | 345 |
| 93 | 3300005459 | Ga0068867_100187496 | Ga0068867_1001874962 | 346 |
| 94 | 3300005617 | Ga0068859_100002443 | Ga0068859_10000244313 | 346 |
| 95 | 3300005718 | Ga0068866_10151937 | Ga0068866_101519371 | 346 |
| 96 | 3300005719 | Ga0068861_100002019 | Ga0068861_1000020197 | 346 |
| 97 | 3300006173 | Ga0070716_100002766 | Ga0070716_1000027665 | 346 |
| 98 | 3300006237 | Ga0097621_100185503 | Ga0097621_1001855032 | 346 |
| 99 | 3300006914 | Ga0075436_100004459 | Ga0075436_1000044596 | 346 |
| 100 | 3300006931 | Ga0097620_100002442 | Ga0097620_10000244213 | 346 |
| 101 | 3300007265 | Ga0099794_10000099 | Ga0099794_100000993 | 346 |
| 102 | 3300009177 | Ga0105248_10001248 | Ga0105248_1000124814 | 346 |
| 103 | 3300013297 | Ga0157378_10030998 | Ga0157378_100309985 | 346 |
| 104 | 3300014968 | Ga0157379_10020026 | Ga0157379_100200262 | 346 |
| 105 | 3300025934 | Ga0207686_10067125 | Ga0207686_100671251 | 346 |
| 106 | 3300025939 | Ga0207665_10010768 | Ga0207665_100107682 | 346 |
| 107 | 3300025941 | Ga0207711_10004771 | Ga0207711_100047717 | 346 |
| 108 | 3300026075 | Ga0207708_10076058 | Ga0207708_100760582 | 346 |
| 109 | 3300026118 | Ga0207675_100001855 | Ga0207675_1000018556 | 346 |
| 110 | 3300027671 | Ga0209588_1000276 | Ga0209588_100027610 | 346 |
| 111 | 3300030521 | Ga0307511_10110457 | Ga0307511_101104572 | 346 |
| 112 | 3300031241 | Ga0265325_10004858 | Ga0265325_100048587 | 346 |
| 113 | 3300031249 | Ga0265339_10000109 | Ga0265339_1000010933 | 346 |
| 114 | 3300031507 | Ga0307509_10067612 | Ga0307509_100676122 | 346 |
| 115 | 3300031595 | Ga0265313_10000257 | Ga0265313_1000025722 | 346 |
| 116 | 3300031730 | Ga0307516_10001624 | Ga0307516_100016248 | 346 |
| 117 | 3300035086 | Ga0373934_0007036 | Ga0373934_0007036_3019_4077 | 346 |
| 118 | 3300035117 | Ga0373953_0004717 | Ga0373953_0004717_1087_2145 | 346 |
| 119 | 3300035118 | Ga0373954_0002190 | Ga0373954_0002190_6374_7432 | 346 |
| 120 | 3300035119 | Ga0373956_0001065 | Ga0373956_0001065_4741_5799 | 346 |
| 121 | 3300035120 | Ga0373957_0001462 | Ga0373957_0001462_790_1848 | 346 |
| 122 | 3300035172 | Ga0373955_0066166 | Ga0373955_0066166_469_1527 | 346 |
| 123 | 3300035724 | Ga0373933_0002728 | Ga0373933_0002728_2225_3283 | 346 |
| 124 | 3300036401 | Ga0373937_0041035 | Ga0373937_0041035_2408_3466 | 346 |
| 125 | 3300046511 | Ga0495608_0045480 | Ga0495608_0045480_787_1845 | 346 |
| 126 | 3300046514 | Ga0495618_0043761 | Ga0495618_0043761_469_1527 | 346 |
| 127 | 3300046517 | Ga0495630_0085356 | Ga0495630_0085356_147_1205 | 346 |
| 128 | 3300046535 | Ga0495586_0097074 | Ga0495586_0097074_469_1527 | 346 |
| 129 | 3300046559 | Ga0495667_0001884 | Ga0495667_0001884_4695_5753 | 346 |
| 130 | 3300046683 | Ga0495658_0017873 | Ga0495658_0017873_1788_2846 | 346 |
| 131 | 3300047317 | Ga0495604_0053150 | Ga0495604_0053150_790_1848 | 346 |
| 132 | 3300047322 | Ga0495680_0098432 | Ga0495680_0098432_375_1433 | 346 |
| 133 | 3300047471 | Ga0495684_0050570 | Ga0495684_0050570_423_1481 | 346 |
| 134 | 3300050514 | nmdc:mga08x19_1584_c2 | nmdc:mga08x19_1584_c2_4806_5852 | 346 |
| 135 | 3300053151 | Ga0500604_0000202 | Ga0500604_0000202_14336_15376 | 346 |
| 136 | 3300003215 | JGI25153J46596_10005349 | JGI25153J46596_100053496 | 347 |
| 137 | 3300005334 | Ga0068869_100019772 | Ga0068869_1000197724 | 347 |
| 138 | 3300005338 | Ga0068868_100153744 | Ga0068868_1001537442 | 347 |
| 139 | 3300005347 | Ga0070668_100091091 | Ga0070668_1000910913 | 347 |
| 140 | 3300005354 | Ga0070675_100105580 | Ga0070675_1001055803 | 347 |
| 141 | 3300005367 | Ga0070667_100158328 | Ga0070667_1001583281 | 347 |
| 142 | 3300005455 | Ga0070663_100034776 | Ga0070663_1000347764 | 347 |
| 143 | 3300005456 | Ga0070678_100111276 | Ga0070678_1001112762 | 347 |
| 144 | 3300005539 | Ga0068853_100120230 | Ga0068853_1001202302 | 347 |
| 145 | 3300005548 | Ga0070665_100038696 | Ga0070665_1000386963 | 347 |
| 146 | 3300005548 | Ga0070665_100099053 | Ga0070665_1000990533 | 347 |
| 147 | 3300005563 | Ga0068855_100041475 | Ga0068855_1000414754 | 347 |
| 148 | 3300005577 | Ga0068857_100021621 | Ga0068857_1000216214 | 347 |
| 149 | 3300005614 | Ga0068856_100010813 | Ga0068856_1000108135 | 347 |
| 150 | 3300005616 | Ga0068852_100137364 | Ga0068852_1001373641 | 347 |
| 151 | 3300005841 | Ga0068863_100155189 | Ga0068863_1001551892 | 347 |
| 152 | 3300005843 | Ga0068860_100000135 | Ga0068860_10000013596 | 347 |
| 153 | 3300005843 | Ga0068860_100164456 | Ga0068860_1001644562 | 347 |
| 154 | 3300005937 | Ga0081455_10001076 | Ga0081455_1000107622 | 347 |
| 155 | 3300005983 | Ga0081540_1020469 | Ga0081540_10204697 | 347 |
| 156 | 3300005985 | Ga0081539_10014316 | Ga0081539_100143165 | 347 |
| 157 | 3300006237 | Ga0097621_100106118 | Ga0097621_1001061182 | 347 |
| 158 | 3300006353 | Ga0075370_10039963 | Ga0075370_100399632 | 347 |
| 159 | 3300009093 | Ga0105240_10159657 | Ga0105240_101596574 | 347 |
| 160 | 3300009101 | Ga0105247_10051820 | Ga0105247_100518202 | 347 |
| 161 | 3300009101 | Ga0105247_10066872 | Ga0105247_100668722 | 347 |
| 162 | 3300009147 | Ga0114129_10004025 | Ga0114129_100040256 | 347 |
| 163 | 3300009177 | Ga0105248_10105859 | Ga0105248_101058592 | 347 |
| 164 | 3300009545 | Ga0105237_10003536 | Ga0105237_1000353618 | 347 |
| 165 | 3300010375 | Ga0105239_10044997 | Ga0105239_100449975 | 347 |
| 166 | 3300011119 | Ga0105246_10015541 | Ga0105246_100155413 | 347 |
| 167 | 3300013296 | Ga0157374_10041905 | Ga0157374_100419052 | 347 |
| 168 | 3300013297 | Ga0157378_10020587 | Ga0157378_100205875 | 347 |
| 169 | 3300013306 | Ga0163162_10030665 | Ga0163162_100306652 | 347 |
| 170 | 3300013306 | Ga0163162_10053017 | Ga0163162_100530174 | 347 |
| 171 | 3300013308 | Ga0157375_10081980 | Ga0157375_100819802 | 347 |
| 172 | 3300013308 | Ga0157375_10115404 | Ga0157375_101154043 | 347 |
| 173 | 3300013308 | Ga0157375_10136156 | Ga0157375_101361562 | 347 |
| 174 | 3300014325 | Ga0163163_10072699 | Ga0163163_100726993 | 347 |
| 175 | 3300014968 | Ga0157379_10029505 | Ga0157379_100295055 | 347 |
| 176 | 3300014969 | Ga0157376_10200414 | Ga0157376_102004142 | 347 |
| 177 | 3300025297 | Ga0209758_1004855 | Ga0209758_10048553 | 347 |
| 178 | 3300025297 | Ga0209758_1011338 | Ga0209758_10113385 | 347 |
| 179 | 3300025900 | Ga0207710_10031090 | Ga0207710_100310902 | 347 |
| 180 | 3300025907 | Ga0207645_10080773 | Ga0207645_100807732 | 347 |
| 181 | 3300025914 | Ga0207671_10013776 | Ga0207671_100137763 | 347 |
| 182 | 3300025914 | Ga0207671_10342078 | Ga0207671_103420782 | 347 |
| 183 | 3300025933 | Ga0207706_10272437 | Ga0207706_102724372 | 347 |
| 184 | 3300025942 | Ga0207689_10001496 | Ga0207689_1000149620 | 347 |
| 185 | 3300025942 | Ga0207689_10004614 | Ga0207689_100046143 | 347 |
| 186 | 3300025949 | Ga0207667_10054070 | Ga0207667_100540704 | 347 |
| 187 | 3300025972 | Ga0207668_10087820 | Ga0207668_100878203 | 347 |
| 188 | 3300025972 | Ga0207668_10215945 | Ga0207668_102159452 | 347 |
| 189 | 3300026023 | Ga0207677_10123031 | Ga0207677_101230313 | 347 |
| 190 | 3300026023 | Ga0207677_10128562 | Ga0207677_101285622 | 347 |
| 191 | 3300026067 | Ga0207678_10022586 | Ga0207678_100225862 | 347 |
| 192 | 3300026067 | Ga0207678_10181910 | Ga0207678_101819102 | 347 |
| 193 | 3300026088 | Ga0207641_10150119 | Ga0207641_101501191 | 347 |
| 194 | 3300026116 | Ga0207674_10033963 | Ga0207674_100339634 | 347 |
| 195 | 3300026118 | Ga0207675_100081355 | Ga0207675_1000813553 | 347 |
| 196 | 3300026121 | Ga0207683_10086757 | Ga0207683_100867572 | 347 |
| 197 | 3300028381 | Ga0268264_10000038 | Ga0268264_10000038172 | 347 |
| 198 | 3300028381 | Ga0268264_10198098 | Ga0268264_101980982 | 347 |
| 199 | 3300030521 | Ga0307511_10123666 | Ga0307511_101236661 | 347 |
| 200 | 3300032126 | Ga0307415_100463947 | Ga0307415_1004639471 | 347 |
| 201 | 3300032168 | Ga0316593_10000965 | Ga0316593_100009655 | 347 |
| 202 | 3300033179 | Ga0307507_10053079 | Ga0307507_100530793 | 347 |
| 203 | 3300035113 | Ga0373936_0010325 | Ga0373936_0010325_56_1102 | 347 |
| 204 | 3300035116 | Ga0373945_0037585 | Ga0373945_0037585_394_1440 | 347 |
| 205 | 3300035170 | Ga0373943_0000592 | Ga0373943_0000592_2823_3869 | 347 |
| 206 | 3300035695 | Ga0373927_0021622 | Ga0373927_0021622_1058_2104 | 347 |
| 207 | 3300035695 | Ga0373927_0036631 | Ga0373927_0036631_935_1981 | 347 |
| 208 | 3300035725 | Ga0373947_0007044 | Ga0373947_0007044_4435_5481 | 347 |
| 209 | 3300037068 | Ga0373925_0069110 | Ga0373925_0069110_1143_2189 | 347 |
| 210 | 3300037068 | Ga0373925_0246348 | Ga0373925_0246348_88_1134 | 347 |
| 211 | 3300038726 | Ga0400490_10463 | Ga0400490_10463_2597_3640 | 347 |
| 212 | 3300038742 | Ga0400486_10384 | Ga0400486_10384_3135_4178 | 347 |
| 213 | 3300038742 | Ga0400486_17264 | Ga0400486_17264_5429_6472 | 347 |
| 214 | 3300041512 | Ga0451853_3003930 | Ga0451853_3003930_1003_2049 | 347 |
| 215 | 3300042876 | Ga0451577_0011700 | Ga0451577_0011700_3542_4651 | 347 |
| 216 | 3300044656 | Ga0466969_0043481 | Ga0466969_0043481_217_1263 | 347 |
| 217 | 3300044673 | Ga0453683_0008486 | Ga0453683_0008486_5251_6360 | 347 |
| 218 | 3300044712 | Ga0453684_0007497 | Ga0453684_0007497_13392_14501 | 347 |
| 219 | 3300045051 | Ga0451576_0151200 | Ga0451576_0151200_761_1870 | 347 |
| 220 | 3300046472 | Ga0495580_0001979 | Ga0495580_0001979_3216_4262 | 347 |
| 221 | 3300046507 | Ga0495606_0083994 | Ga0495606_0083994_575_1621 | 347 |
| 222 | 3300046616 | Ga0495668_0158027 | Ga0495668_0158027_18_1064 | 347 |
| 223 | 3300047472 | Ga0495686_0015635 | Ga0495686_0015635_3681_4724 | 347 |
| 224 | 3300047472 | Ga0495686_0157363 | Ga0495686_0157363_212_1255 | 347 |
| 225 | 3300048905 | Ga0496102_0025634 | Ga0496102_0025634_558_1622 | 347 |
| 226 | 3300048907 | Ga0496104_0264581 | Ga0496104_0264581_507_1550 | 347 |
| 227 | 3300048908 | Ga0496105_0003823 | Ga0496105_0003823_371_1435 | 347 |
| 228 | 3300048908 | Ga0496105_0211385 | Ga0496105_0211385_33_1076 | 347 |
| 229 | 3300048909 | Ga0496106_0000846 | Ga0496106_0000846_12631_13677 | 347 |
| 230 | 3300048909 | Ga0496106_0138482 | Ga0496106_0138482_585_1649 | 347 |
| 231 | 3300048909 | Ga0496106_0350027 | Ga0496106_0350027_89_1135 | 347 |
| 232 | 3300048915 | Ga0496112_0115905 | Ga0496112_0115905_387_1451 | 347 |
| 233 | 3300048916 | Ga0496113_0052808 | Ga0496113_0052808_1575_2639 | 347 |
| 234 | 3300048918 | Ga0496115_0064804 | Ga0496115_0064804_1021_2085 | 347 |
| 235 | 3300048920 | Ga0496117_0014005 | Ga0496117_0014005_2646_3692 | 347 |
| 236 | 3300048921 | Ga0496118_0005969 | Ga0496118_0005969_8792_9838 | 347 |
| 237 | 3300048924 | Ga0496121_0000099 | Ga0496121_0000099_107235_108281 | 347 |
| 238 | 3300048927 | Ga0496124_0004730 | Ga0496124_0004730_4227_5273 | 347 |
| 239 | 3300048928 | Ga0496125_0027424 | Ga0496125_0027424_949_1995 | 347 |
| 240 | 3300048929 | Ga0496126_0006199 | Ga0496126_0006199_7966_9012 | 347 |
| 241 | 3300049575 | Ga0501039_0030462 | Ga0501039_0030462_1351_2418 | 347 |
| 242 | 3300049679 | Ga0501249_000339 | Ga0501249_000339_9783_10829 | 347 |
| 243 | 3300050494 | nmdc:mga06z11_21431_c1 | nmdc:mga06z11_21431_c1_1528_2592 | 347 |
| 244 | 3300050496 | nmdc:mga07m45_33781_c1 | nmdc:mga07m45_33781_c1_120_1184 | 347 |
| 245 | 3300050507 | nmdc:mga05p37_2725_c1 | nmdc:mga05p37_2725_c1_15782_16828 | 347 |
| 246 | 3300053080 | Ga0500635_0020933 | Ga0500635_0020933_815_1861 | 347 |
| 247 | 3300053091 | Ga0500647_0023976 | Ga0500647_0023976_1370_2416 | 347 |
| 248 | 3300053092 | Ga0500583_0090130 | Ga0500583_0090130_112_1176 | 347 |
| 249 | 3300053104 | Ga0500556_0024720 | Ga0500556_0024720_127_1173 | 347 |
| 250 | 3300053104 | Ga0500556_0028003 | Ga0500556_0028003_560_1603 | 347 |
| 251 | 3300053119 | Ga0500595_001318 | Ga0500595_001318_7632_8729 | 347 |
| 252 | 3300053119 | Ga0500595_002291 | Ga0500595_002291_2399_3496 | 347 |
| 253 | 3300053119 | Ga0500595_015008 | Ga0500595_015008_1751_2797 | 347 |
| 254 | 3300053139 | Ga0500568_0006551 | Ga0500568_0006551_3801_4898 | 347 |
| 255 | 3300053140 | Ga0500573_0005791 | Ga0500573_0005791_2225_3271 | 347 |
| 256 | 3300053147 | Ga0500589_093278 | Ga0500589_093278_205_1299 | 347 |
| 257 | 3300053148 | Ga0500590_055936 | Ga0500590_055936_48_1094 | 347 |
| 258 | 3300053150 | Ga0500603_006556 | Ga0500603_006556_227_1273 | 347 |
| 259 | 3300053153 | Ga0500616_0003160 | Ga0500616_0003160_4955_6007 | 347 |
| 260 | 3300053162 | Ga0500638_100694 | Ga0500638_100694_262_1308 | 347 |
| 261 | 3300053163 | Ga0500639_056580 | Ga0500639_056580_691_1737 | 347 |
| 262 | 3300053177 | Ga0500636_0020033 | Ga0500636_0020033_2761_3807 | 347 |
| 263 | 3300053730 | Ga0500645_024167 | Ga0500645_024167_116_1180 | 347 |
| 264 | 3300055283 | Ga0500661_004008 | Ga0500661_004008_1284_2327 | 347 |
| 265 | iso_pu_bacteria | 2721755755 | 2723847665 | 347 |
| 266 | iso_pu_bacteria | 2791355199 | 2793077808 | 347 |
| 267 | iso_pu_bacteria | 2876771140 | 2876773013 | 347 |
| 268 | iso_pu_bacteria | 2876818435 | 2876820340 | 347 |
| 269 | iso_pu_bacteria | 2879074833 | 2879076469 | 347 |
| 270 | iso_pu_bacteria | 8006984368 | 8006990061 | 347 |
| 271 | 3300003771 | Ga0055526_1000017 | Ga0055526_100001721 | 348 |
| 272 | 3300005330 | Ga0070690_100005471 | Ga0070690_1000054717 | 348 |
| 273 | 3300005334 | Ga0068869_100008842 | Ga0068869_1000088422 | 348 |
| 274 | 3300005334 | Ga0068869_100177140 | Ga0068869_1001771402 | 348 |
| 275 | 3300005335 | Ga0070666_10027073 | Ga0070666_100270733 | 348 |
| 276 | 3300005336 | Ga0070680_100017881 | Ga0070680_1000178812 | 348 |
| 277 | 3300005337 | Ga0070682_100052870 | Ga0070682_1000528701 | 348 |
| 278 | 3300005338 | Ga0068868_100015499 | Ga0068868_1000154995 | 348 |
| 279 | 3300005340 | Ga0070689_100118239 | Ga0070689_1001182392 | 348 |
| 280 | 3300005343 | Ga0070687_100001463 | Ga0070687_1000014635 | 348 |
| 281 | 3300005356 | Ga0070674_100048107 | Ga0070674_1000481072 | 348 |
| 282 | 3300005440 | Ga0070705_100010260 | Ga0070705_1000102602 | 348 |
| 283 | 3300005441 | Ga0070700_100293379 | Ga0070700_1002933791 | 348 |
| 284 | 3300005444 | Ga0070694_100133710 | Ga0070694_1001337102 | 348 |
| 285 | 3300005458 | Ga0070681_10002597 | Ga0070681_1000259715 | 348 |
| 286 | 3300005459 | Ga0068867_100002648 | Ga0068867_10000264812 | 348 |
| 287 | 3300005471 | Ga0070698_100080822 | Ga0070698_1000808222 | 348 |
| 288 | 3300005518 | Ga0070699_100163289 | Ga0070699_1001632892 | 348 |
| 289 | 3300005539 | Ga0068853_100227078 | Ga0068853_1002270782 | 348 |
| 290 | 3300005544 | Ga0070686_100000843 | Ga0070686_1000008437 | 348 |
| 291 | 3300005545 | Ga0070695_100005437 | Ga0070695_1000054373 | 348 |
| 292 | 3300005549 | Ga0070704_100012970 | Ga0070704_1000129702 | 348 |
| 293 | 3300005563 | Ga0068855_100149646 | Ga0068855_1001496462 | 348 |
| 294 | 3300005614 | Ga0068856_100037555 | Ga0068856_1000375552 | 348 |
| 295 | 3300005615 | Ga0070702_100146188 | Ga0070702_1001461881 | 348 |
| 296 | 3300005615 | Ga0070702_100195130 | Ga0070702_1001951301 | 348 |
| 297 | 3300005616 | Ga0068852_100124491 | Ga0068852_1001244912 | 348 |
| 298 | 3300005617 | Ga0068859_100030510 | Ga0068859_1000305105 | 348 |
| 299 | 3300005617 | Ga0068859_100173518 | Ga0068859_1001735182 | 348 |
| 300 | 3300005618 | Ga0068864_100021473 | Ga0068864_1000214732 | 348 |
| 301 | 3300005841 | Ga0068863_100468484 | Ga0068863_1004684841 | 348 |
| 302 | 3300005842 | Ga0068858_100024427 | Ga0068858_1000244272 | 348 |
| 303 | 3300005843 | Ga0068860_100030383 | Ga0068860_1000303832 | 348 |
| 304 | 3300005844 | Ga0068862_100006072 | Ga0068862_1000060723 | 348 |
| 305 | 3300005844 | Ga0068862_100278844 | Ga0068862_1002788442 | 348 |
| 306 | 3300006237 | Ga0097621_100010866 | Ga0097621_1000108666 | 348 |
| 307 | 3300006358 | Ga0068871_100219226 | Ga0068871_1002192262 | 348 |
| 308 | 3300006844 | Ga0075428_100001613 | Ga0075428_1000016138 | 348 |
| 309 | 3300006852 | Ga0075433_10003516 | Ga0075433_100035163 | 348 |
| 310 | 3300006871 | Ga0075434_100000732 | Ga0075434_1000007327 | 348 |
| 311 | 3300006871 | Ga0075434_100385401 | Ga0075434_1003854012 | 348 |
| 312 | 3300006880 | Ga0075429_100000412 | Ga0075429_10000041211 | 348 |
| 313 | 3300006881 | Ga0068865_100005519 | Ga0068865_1000055195 | 348 |
| 314 | 3300006914 | Ga0075436_100003338 | Ga0075436_1000033382 | 348 |
| 315 | 3300006931 | Ga0097620_100030510 | Ga0097620_1000305105 | 348 |
| 316 | 3300006931 | Ga0097620_100173509 | Ga0097620_1001735092 | 348 |
| 317 | 3300009094 | Ga0111539_10003717 | Ga0111539_100037178 | 348 |
| 318 | 3300009094 | Ga0111539_10024276 | Ga0111539_100242762 | 348 |
| 319 | 3300009147 | Ga0114129_10002654 | Ga0114129_1000265410 | 348 |
| 320 | 3300009148 | Ga0105243_10010440 | Ga0105243_100104406 | 348 |
| 321 | 3300009553 | Ga0105249_10005684 | Ga0105249_1000568413 | 348 |
| 322 | 3300010375 | Ga0105239_10032969 | Ga0105239_100329695 | 348 |
| 323 | 3300013297 | Ga0157378_10011091 | Ga0157378_100110912 | 348 |
| 324 | 3300014969 | Ga0157376_10011776 | Ga0157376_100117766 | 348 |
| 325 | 3300021358 | Ga0213873_10000018 | Ga0213873_10000018134 | 348 |
| 326 | 3300021384 | Ga0213876_10000058 | Ga0213876_10000058139 | 348 |
| 327 | 3300025295 | Ga0209564_1000031 | Ga0209564_1000031187 | 348 |
| 328 | 3300025903 | Ga0207680_10017535 | Ga0207680_100175352 | 348 |
| 329 | 3300025917 | Ga0207660_10004041 | Ga0207660_100040416 | 348 |
| 330 | 3300025918 | Ga0207662_10003737 | Ga0207662_100037372 | 348 |
| 331 | 3300025921 | Ga0207652_10071205 | Ga0207652_100712053 | 348 |
| 332 | 3300025927 | Ga0207687_10007306 | Ga0207687_100073063 | 348 |
| 333 | 3300025935 | Ga0207709_10002338 | Ga0207709_100023387 | 348 |
| 334 | 3300025937 | Ga0207669_10127603 | Ga0207669_101276032 | 348 |
| 335 | 3300025938 | Ga0207704_10119569 | Ga0207704_101195692 | 348 |
| 336 | 3300025942 | Ga0207689_10012328 | Ga0207689_100123283 | 348 |
| 337 | 3300025981 | Ga0207640_10009053 | Ga0207640_100090535 | 348 |
| 338 | 3300026023 | Ga0207677_10043770 | Ga0207677_100437702 | 348 |
| 339 | 3300026035 | Ga0207703_10019741 | Ga0207703_100197412 | 348 |
| 340 | 3300026075 | Ga0207708_10002744 | Ga0207708_100027444 | 348 |
| 341 | 3300026078 | Ga0207702_10222961 | Ga0207702_102229612 | 348 |
| 342 | 3300026089 | Ga0207648_10002639 | Ga0207648_1000263919 | 348 |
| 343 | 3300026142 | Ga0207698_10190881 | Ga0207698_101908812 | 348 |
| 344 | 3300028380 | Ga0268265_10012036 | Ga0268265_100120363 | 348 |
| 345 | 3300028381 | Ga0268264_10082198 | Ga0268264_100821982 | 348 |
| 346 | 3300035112 | Ga0373932_0007238 | Ga0373932_0007238_417_1541 | 348 |
| 347 | 3300035691 | Ga0373931_0019233 | Ga0373931_0019233_2060_3157 | 348 |
| 348 | 3300036647 | Ga0316582_0022433 | Ga0316582_0022433_2230_3276 | 348 |
| 349 | 3300037853 | Ga0436364_0420422 | Ga0436364_0420422_308_1360 | 348 |
| 350 | 3300038443 | Ga0395901_0193283 | Ga0395901_0193283_700_1785 | 348 |
| 351 | 3300038725 | Ga0400484_19896 | Ga0400484_19896_446_1492 | 348 |
| 352 | 3300039062 | Ga0400483_207311 | Ga0400483_207311_401_1450 | 348 |
| 353 | 3300039437 | Ga0436365_0337700 | Ga0436365_0337700_38079_39125 | 348 |
| 354 | 3300039437 | Ga0436365_1710345 | Ga0436365_1710345_1973_3025 | 348 |
| 355 | 3300039450 | Ga0436363_1527683 | Ga0436363_1527683_370_1422 | 348 |
| 356 | 3300039453 | Ga0436362_0011715 | Ga0436362_0011715_41480_42526 | 348 |
| 357 | 3300042876 | Ga0451577_0090385 | Ga0451577_0090385_438_1484 | 348 |
| 358 | 3300044712 | Ga0453684_0013804 | Ga0453684_0013804_6025_7071 | 348 |
| 359 | 3300044712 | Ga0453684_0048547 | Ga0453684_0048547_1730_2827 | 348 |
| 360 | 3300044712 | Ga0453684_0070803 | Ga0453684_0070803_1635_2681 | 348 |
| 361 | 3300044712 | Ga0453684_0101103 | Ga0453684_0101103_43_1089 | 348 |
| 362 | 3300044712 | Ga0453684_0122837 | Ga0453684_0122837_1658_2704 | 348 |
| 363 | 3300044712 | Ga0453684_0482815 | Ga0453684_0482815_73_1119 | 348 |
| 364 | 3300045051 | Ga0451576_0002498 | Ga0451576_0002498_17815_18912 | 348 |
| 365 | 3300045051 | Ga0451576_0004796 | Ga0451576_0004796_6823_7920 | 348 |
| 366 | 3300049587 | Ga0501071_0171677 | Ga0501071_0171677_325_1410 | 348 |
| 367 | 3300049822 | Ga0501035_0000923 | Ga0501035_0000923_27362_28411 | 348 |
| 368 | 3300050507 | nmdc:mga05p37_1800_c1 | nmdc:mga05p37_1800_c1_8512_9609 | 348 |
| 369 | 3300050508 | nmdc:mga09592_2740_c1 | nmdc:mga09592_2740_c1_10988_12085 | 348 |
| 370 | 3300050511 | nmdc:mga08y16_10425_c1 | nmdc:mga08y16_10425_c1_2155_3252 | 348 |
| 371 | 3300050511 | nmdc:mga08y16_164498_c1 | nmdc:mga08y16_164498_c1_338_1435 | 348 |
| 372 | 3300050512 | nmdc:mga0n895_3487_c1 | nmdc:mga0n895_3487_c1_4137_5234 | 348 |
| 373 | 3300050514 | nmdc:mga08x19_3752_c1 | nmdc:mga08x19_3752_c1_854_1951 | 348 |
| 374 | 3300050515 | nmdc:mga0a205_6621_c1 | nmdc:mga0a205_6621_c1_4317_5414 | 348 |
| 375 | 3300001989 | JGI24739J22299_10019237 | JGI24739J22299_100192372 | 349 |
| 376 | 3300003322 | rootL2_10126575 | rootL2_101265755 | 349 |
| 377 | 3300005331 | Ga0070670_100037529 | Ga0070670_1000375293 | 349 |
| 378 | 3300005347 | Ga0070668_100050442 | Ga0070668_1000504421 | 349 |
| 379 | 3300005434 | Ga0070709_10005175 | Ga0070709_100051755 | 349 |
| 380 | 3300005435 | Ga0070714_100079221 | Ga0070714_1000792212 | 349 |
| 381 | 3300005436 | Ga0070713_100032165 | Ga0070713_1000321653 | 349 |
| 382 | 3300005439 | Ga0070711_100003347 | Ga0070711_1000033475 | 349 |
| 383 | 3300005444 | Ga0070694_100011060 | Ga0070694_1000110603 | 349 |
| 384 | 3300005457 | Ga0070662_100008235 | Ga0070662_1000082352 | 349 |
| 385 | 3300005457 | Ga0070662_100031331 | Ga0070662_1000313312 | 349 |
| 386 | 3300005544 | Ga0070686_100261453 | Ga0070686_1002614531 | 349 |
| 387 | 3300005546 | Ga0070696_100023352 | Ga0070696_1000233522 | 349 |
| 388 | 3300005547 | Ga0070693_100001638 | Ga0070693_1000016382 | 349 |
| 389 | 3300005548 | Ga0070665_100000023 | Ga0070665_100000023265 | 349 |
| 390 | 3300005617 | Ga0068859_100079852 | Ga0068859_1000798522 | 349 |
| 391 | 3300005842 | Ga0068858_100000397 | Ga0068858_1000003975 | 349 |
| 392 | 3300005937 | Ga0081455_10027187 | Ga0081455_100271872 | 349 |
| 393 | 3300006173 | Ga0070716_100005032 | Ga0070716_1000050322 | 349 |
| 394 | 3300006846 | Ga0075430_100125399 | Ga0075430_1001253992 | 349 |
| 395 | 3300006880 | Ga0075429_100290464 | Ga0075429_1002904642 | 349 |
| 396 | 3300006931 | Ga0097620_100079853 | Ga0097620_1000798532 | 349 |
| 397 | 3300009093 | Ga0105240_10007009 | Ga0105240_1000700916 | 349 |
| 398 | 3300009093 | Ga0105240_10210614 | Ga0105240_102106142 | 349 |
| 399 | 3300009094 | Ga0111539_10220997 | Ga0111539_102209972 | 349 |
| 400 | 3300009098 | Ga0105245_10056941 | Ga0105245_100569413 | 349 |
| 401 | 3300009147 | Ga0114129_10006442 | Ga0114129_1000644212 | 349 |
| 402 | 3300009148 | Ga0105243_10038548 | Ga0105243_100385483 | 349 |
| 403 | 3300009148 | Ga0105243_10256907 | Ga0105243_102569071 | 349 |
| 404 | 3300009174 | Ga0105241_10060086 | Ga0105241_100600863 | 349 |
| 405 | 3300009177 | Ga0105248_10350741 | Ga0105248_103507412 | 349 |
| 406 | 3300009177 | Ga0105248_10394199 | Ga0105248_103941991 | 349 |
| 407 | 3300009545 | Ga0105237_10000537 | Ga0105237_1000053735 | 349 |
| 408 | 3300010375 | Ga0105239_10000037 | Ga0105239_1000003755 | 349 |
| 409 | 3300017792 | Ga0163161_10036206 | Ga0163161_100362062 | 349 |
| 410 | 3300025898 | Ga0207692_10030555 | Ga0207692_100305552 | 349 |
| 411 | 3300025904 | Ga0207647_10004912 | Ga0207647_100049129 | 349 |
| 412 | 3300025911 | Ga0207654_10102113 | Ga0207654_101021132 | 349 |
| 413 | 3300025913 | Ga0207695_10068690 | Ga0207695_100686902 | 349 |
| 414 | 3300025913 | Ga0207695_10109477 | Ga0207695_101094772 | 349 |
| 415 | 3300025914 | Ga0207671_10001619 | Ga0207671_1000161913 | 349 |
| 416 | 3300025915 | Ga0207693_10014506 | Ga0207693_100145066 | 349 |
| 417 | 3300025928 | Ga0207700_10033917 | Ga0207700_100339172 | 349 |
| 418 | 3300025929 | Ga0207664_10231655 | Ga0207664_102316552 | 349 |
| 419 | 3300025932 | Ga0207690_10297854 | Ga0207690_102978542 | 349 |
| 420 | 3300025933 | Ga0207706_10015911 | Ga0207706_100159117 | 349 |
| 421 | 3300025933 | Ga0207706_10028964 | Ga0207706_100289644 | 349 |
| 422 | 3300025934 | Ga0207686_10041322 | Ga0207686_100413222 | 349 |
| 423 | 3300025935 | Ga0207709_10170745 | Ga0207709_101707452 | 349 |
| 424 | 3300025939 | Ga0207665_10003717 | Ga0207665_100037172 | 349 |
| 425 | 3300026035 | Ga0207703_10001606 | Ga0207703_100016062 | 349 |
| 426 | 3300026075 | Ga0207708_10014441 | Ga0207708_100144414 | 349 |
| 427 | 3300026121 | Ga0207683_10018973 | Ga0207683_100189735 | 349 |
| 428 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000021216 | 349 |
| 429 | 3300031456 | Ga0307513_10007695 | Ga0307513_100076953 | 349 |
| 430 | 3300031711 | Ga0265314_10052549 | Ga0265314_100525493 | 349 |
| 431 | 3300031903 | Ga0307407_10057727 | Ga0307407_100577273 | 349 |
| 432 | 3300031995 | Ga0307409_100249371 | Ga0307409_1002493712 | 349 |
| 433 | 3300032002 | Ga0307416_100059757 | Ga0307416_1000597573 | 349 |
| 434 | 3300032005 | Ga0307411_10002864 | Ga0307411_100028646 | 349 |
| 435 | 3300038726 | Ga0400490_39904 | Ga0400490_39904_2336_3385 | 349 |
| 436 | 3300042007 | Ga0439449_0012140 | Ga0439449_0012140_379_1470 | 349 |
| 437 | 3300042435 | Ga0439434_0006060 | Ga0439434_0006060_1991_3082 | 349 |
| 438 | 3300044659 | Ga0466973_0115202 | Ga0466973_0115202_979_2049 | 349 |
| 439 | 3300046460 | Ga0495638_0082280 | Ga0495638_0082280_188_1276 | 349 |
| 440 | 3300046461 | Ga0495641_0068483 | Ga0495641_0068483_60_1127 | 349 |
| 441 | 3300046491 | Ga0495584_0007601 | Ga0495584_0007601_527_1615 | 349 |
| 442 | 3300046515 | Ga0495620_0067732 | Ga0495620_0067732_367_1455 | 349 |
| 443 | 3300046519 | Ga0495632_0000506 | Ga0495632_0000506_9898_10971 | 349 |
| 444 | 3300046524 | Ga0495648_0000357 | Ga0495648_0000357_36286_37374 | 349 |
| 445 | 3300046525 | Ga0495663_0001112 | Ga0495663_0001112_599_1687 | 349 |
| 446 | 3300046648 | Ga0495611_0099993 | Ga0495611_0099993_58_1146 | 349 |
| 447 | 3300046660 | Ga0495625_0010682 | Ga0495625_0010682_146_1234 | 349 |
| 448 | 3300046660 | Ga0495625_0104058 | Ga0495625_0104058_539_1627 | 349 |
| 449 | 3300046684 | Ga0495669_0000283 | Ga0495669_0000283_2092_3180 | 349 |
| 450 | 3300046810 | Ga0495660_0018361 | Ga0495660_0018361_527_1615 | 349 |
| 451 | 3300047323 | Ga0495683_0037152 | Ga0495683_0037152_789_1877 | 349 |
| 452 | 3300047443 | Ga0495687_000240 | Ga0495687_000240_44568_45656 | 349 |
| 453 | 3300047470 | Ga0495681_0005652 | Ga0495681_0005652_455_1543 | 349 |
| 454 | 3300048903 | Ga0496100_0006983 | Ga0496100_0006983_4864_5949 | 349 |
| 455 | 3300048904 | Ga0496101_0164562 | Ga0496101_0164562_66_1151 | 349 |
| 456 | 3300048905 | Ga0496102_0401730 | Ga0496102_0401730_40_1125 | 349 |
| 457 | 3300048909 | Ga0496106_0059308 | Ga0496106_0059308_111_1196 | 349 |
| 458 | 3300048910 | Ga0496107_0014595 | Ga0496107_0014595_656_1741 | 349 |
| 459 | 3300048912 | Ga0496109_0046953 | Ga0496109_0046953_2254_3339 | 349 |
| 460 | 3300048913 | Ga0496110_0179147 | Ga0496110_0179147_512_1597 | 349 |
| 461 | 3300048918 | Ga0496115_0010674 | Ga0496115_0010674_5156_6241 | 349 |
| 462 | 3300048920 | Ga0496117_0031818 | Ga0496117_0031818_266_1354 | 349 |
| 463 | 3300048921 | Ga0496118_0042422 | Ga0496118_0042422_1856_2944 | 349 |
| 464 | 3300048924 | Ga0496121_0000066 | Ga0496121_0000066_146366_147454 | 349 |
| 465 | 3300048929 | Ga0496126_0014718 | Ga0496126_0014718_4656_5744 | 349 |
| 466 | 3300049568 | Ga0501031_0049975 | Ga0501031_0049975_1422_2474 | 349 |
| 467 | 3300049573 | Ga0501037_0086893 | Ga0501037_0086893_1168_2220 | 349 |
| 468 | 3300049575 | Ga0501039_0134661 | Ga0501039_0134661_724_1773 | 349 |
| 469 | 3300049575 | Ga0501039_0186886 | Ga0501039_0186886_193_1245 | 349 |
| 470 | 3300049579 | Ga0501043_0012347 | Ga0501043_0012347_4017_5087 | 349 |
| 471 | 3300049580 | Ga0501046_0015633 | Ga0501046_0015633_4933_5985 | 349 |
| 472 | 3300049581 | Ga0501047_0000631 | Ga0501047_0000631_29114_30184 | 349 |
| 473 | 3300049582 | Ga0501048_0044434 | Ga0501048_0044434_561_1631 | 349 |
| 474 | 3300049822 | Ga0501035_0036200 | Ga0501035_0036200_2738_3790 | 349 |
| 475 | 3300053130 | Ga0500642_0002173 | Ga0500642_0002173_4270_5358 | 349 |
| 476 | 3300053730 | Ga0500645_000134 | Ga0500645_000134_31591_32679 | 349 |
| 477 | 2162886012 | MBSR1b_contig_7679642 | MBSR1b_0142.00003770 | 350 |
| 478 | 3300003215 | JGI25153J46596_10004924 | JGI25153J46596_100049247 | 350 |
| 479 | 3300003775 | Ga0055524_1006128 | Ga0055524_10061282 | 350 |
| 480 | 3300005290 | Ga0065712_10083676 | Ga0065712_100836762 | 350 |
| 481 | 3300005295 | Ga0065707_10004727 | Ga0065707_100047272 | 350 |
| 482 | 3300005331 | Ga0070670_100106215 | Ga0070670_1001062152 | 350 |
| 483 | 3300005334 | Ga0068869_100012376 | Ga0068869_1000123762 | 350 |
| 484 | 3300005336 | Ga0070680_100039720 | Ga0070680_1000397202 | 350 |
| 485 | 3300005337 | Ga0070682_100005312 | Ga0070682_1000053125 | 350 |
| 486 | 3300005340 | Ga0070689_100237666 | Ga0070689_1002376662 | 350 |
| 487 | 3300005341 | Ga0070691_10013261 | Ga0070691_100132613 | 350 |
| 488 | 3300005347 | Ga0070668_100022086 | Ga0070668_1000220862 | 350 |
| 489 | 3300005353 | Ga0070669_100009863 | Ga0070669_1000098632 | 350 |
| 490 | 3300005353 | Ga0070669_100282409 | Ga0070669_1002824091 | 350 |
| 491 | 3300005354 | Ga0070675_100058611 | Ga0070675_1000586113 | 350 |
| 492 | 3300005354 | Ga0070675_100138970 | Ga0070675_1001389702 | 350 |
| 493 | 3300005356 | Ga0070674_100000066 | Ga0070674_10000006629 | 350 |
| 494 | 3300005365 | Ga0070688_100002786 | Ga0070688_1000027865 | 350 |
| 495 | 3300005434 | Ga0070709_10071255 | Ga0070709_100712552 | 350 |
| 496 | 3300005456 | Ga0070678_100028047 | Ga0070678_1000280473 | 350 |
| 497 | 3300005457 | Ga0070662_100082219 | Ga0070662_1000822192 | 350 |
| 498 | 3300005459 | Ga0068867_100029015 | Ga0068867_1000290152 | 350 |
| 499 | 3300005467 | Ga0070706_100044651 | Ga0070706_1000446514 | 350 |
| 500 | 3300005468 | Ga0070707_100000358 | Ga0070707_10000035830 | 350 |
| 501 | 3300005471 | Ga0070698_100137077 | Ga0070698_1001370772 | 350 |
| 502 | 3300005518 | Ga0070699_100006108 | Ga0070699_1000061087 | 350 |
| 503 | 3300005536 | Ga0070697_100009148 | Ga0070697_1000091484 | 350 |
| 504 | 3300005543 | Ga0070672_100008669 | Ga0070672_1000086696 | 350 |
| 505 | 3300005549 | Ga0070704_100289666 | Ga0070704_1002896662 | 350 |
| 506 | 3300005578 | Ga0068854_100194034 | Ga0068854_1001940342 | 350 |
| 507 | 3300005615 | Ga0070702_100023699 | Ga0070702_1000236993 | 350 |
| 508 | 3300005617 | Ga0068859_100169306 | Ga0068859_1001693062 | 350 |
| 509 | 3300005719 | Ga0068861_100012886 | Ga0068861_1000128865 | 350 |
| 510 | 3300005840 | Ga0068870_10009032 | Ga0068870_100090324 | 350 |
| 511 | 3300005843 | Ga0068860_100264601 | Ga0068860_1002646012 | 350 |
| 512 | 3300005844 | Ga0068862_100022695 | Ga0068862_1000226954 | 350 |
| 513 | 3300005983 | Ga0081540_1000590 | Ga0081540_100059012 | 350 |
| 514 | 3300006846 | Ga0075430_100004646 | Ga0075430_1000046463 | 350 |
| 515 | 3300006846 | Ga0075430_100008951 | Ga0075430_1000089512 | 350 |
| 516 | 3300006846 | Ga0075430_100066585 | Ga0075430_1000665853 | 350 |
| 517 | 3300006847 | Ga0075431_100006287 | Ga0075431_1000062878 | 350 |
| 518 | 3300006847 | Ga0075431_100047009 | Ga0075431_1000470094 | 350 |
| 519 | 3300006847 | Ga0075431_100314583 | Ga0075431_1003145831 | 350 |
| 520 | 3300006852 | Ga0075433_10280394 | Ga0075433_102803942 | 350 |
| 521 | 3300006880 | Ga0075429_100015697 | Ga0075429_1000156972 | 350 |
| 522 | 3300006880 | Ga0075429_100077402 | Ga0075429_1000774023 | 350 |
| 523 | 3300006914 | Ga0075436_100096668 | Ga0075436_1000966683 | 350 |
| 524 | 3300006931 | Ga0097620_100169297 | Ga0097620_1001692972 | 350 |
| 525 | 3300007076 | Ga0075435_100241772 | Ga0075435_1002417722 | 350 |
| 526 | 3300009094 | Ga0111539_10010980 | Ga0111539_100109803 | 350 |
| 527 | 3300009094 | Ga0111539_10015034 | Ga0111539_100150344 | 350 |
| 528 | 3300009147 | Ga0114129_10010475 | Ga0114129_100104758 | 350 |
| 529 | 3300009147 | Ga0114129_10629056 | Ga0114129_106290562 | 350 |
| 530 | 3300009176 | Ga0105242_10003075 | Ga0105242_100030755 | 350 |
| 531 | 3300009553 | Ga0105249_10016117 | Ga0105249_100161173 | 350 |
| 532 | 3300010375 | Ga0105239_10000537 | Ga0105239_1000053715 | 350 |
| 533 | 3300013105 | Ga0157369_10138104 | Ga0157369_101381041 | 350 |
| 534 | 3300013307 | Ga0157372_10132975 | Ga0157372_101329752 | 350 |
| 535 | 3300013307 | Ga0157372_10749871 | Ga0157372_107498711 | 350 |
| 536 | 3300013308 | Ga0157375_10002523 | Ga0157375_100025237 | 350 |
| 537 | 3300014325 | Ga0163163_10289498 | Ga0163163_102894982 | 350 |
| 538 | 3300014326 | Ga0157380_10000255 | Ga0157380_1000025526 | 350 |
| 539 | 3300014326 | Ga0157380_10001701 | Ga0157380_100017014 | 350 |
| 540 | 3300014326 | Ga0157380_10018891 | Ga0157380_100188913 | 350 |
| 541 | 3300014745 | Ga0157377_10001466 | Ga0157377_100014666 | 350 |
| 542 | 3300025297 | Ga0209758_1000628 | Ga0209758_100062849 | 350 |
| 543 | 3300025297 | Ga0209758_1043650 | Ga0209758_10436502 | 350 |
| 544 | 3300025298 | Ga0209050_1003852 | Ga0209050_100385211 | 350 |
| 545 | 3300025299 | Ga0209256_1000071 | Ga0209256_1000071223 | 350 |
| 546 | 3300025315 | Ga0207697_10028120 | Ga0207697_100281202 | 350 |
| 547 | 3300025906 | Ga0207699_10057359 | Ga0207699_100573592 | 350 |
| 548 | 3300025908 | Ga0207643_10008018 | Ga0207643_100080182 | 350 |
| 549 | 3300025908 | Ga0207643_10152553 | Ga0207643_101525532 | 350 |
| 550 | 3300025912 | Ga0207707_10106187 | Ga0207707_101061872 | 350 |
| 551 | 3300025917 | Ga0207660_10046256 | Ga0207660_100462564 | 350 |
| 552 | 3300025918 | Ga0207662_10103770 | Ga0207662_101037702 | 350 |
| 553 | 3300025922 | Ga0207646_10000008 | Ga0207646_10000008438 | 350 |
| 554 | 3300025922 | Ga0207646_10000009 | Ga0207646_1000000918 | 350 |
| 555 | 3300025923 | Ga0207681_10070994 | Ga0207681_100709942 | 350 |
| 556 | 3300025923 | Ga0207681_10083712 | Ga0207681_100837122 | 350 |
| 557 | 3300025933 | Ga0207706_10013072 | Ga0207706_100130724 | 350 |
| 558 | 3300025934 | Ga0207686_10008341 | Ga0207686_100083412 | 350 |
| 559 | 3300025936 | Ga0207670_10230723 | Ga0207670_102307232 | 350 |
| 560 | 3300025937 | Ga0207669_10000554 | Ga0207669_100005542 | 350 |
| 561 | 3300025937 | Ga0207669_10002009 | Ga0207669_100020093 | 350 |
| 562 | 3300025940 | Ga0207691_10061209 | Ga0207691_100612092 | 350 |
| 563 | 3300025940 | Ga0207691_10177190 | Ga0207691_101771902 | 350 |
| 564 | 3300025941 | Ga0207711_10016054 | Ga0207711_100160542 | 350 |
| 565 | 3300025942 | Ga0207689_10017177 | Ga0207689_100171774 | 350 |
| 566 | 3300025972 | Ga0207668_10008963 | Ga0207668_100089636 | 350 |
| 567 | 3300025981 | Ga0207640_10262019 | Ga0207640_102620192 | 350 |
| 568 | 3300026067 | Ga0207678_10110380 | Ga0207678_101103802 | 350 |
| 569 | 3300026089 | Ga0207648_10029681 | Ga0207648_100296814 | 350 |
| 570 | 3300026089 | Ga0207648_10042838 | Ga0207648_100428382 | 350 |
| 571 | 3300026118 | Ga0207675_100000282 | Ga0207675_10000028221 | 350 |
| 572 | 3300026121 | Ga0207683_10094845 | Ga0207683_100948452 | 350 |
| 573 | 3300026121 | Ga0207683_10128993 | Ga0207683_101289932 | 350 |
| 574 | 3300027876 | Ga0209974_10005986 | Ga0209974_100059862 | 350 |
| 575 | 3300027907 | Ga0207428_10049318 | Ga0207428_100493184 | 350 |
| 576 | 3300027907 | Ga0207428_10092400 | Ga0207428_100924002 | 350 |
| 577 | 3300028380 | Ga0268265_10036681 | Ga0268265_100366813 | 350 |
| 578 | 3300032004 | Ga0307414_10085019 | Ga0307414_100850193 | 350 |
| 579 | 3300032004 | Ga0307414_10112891 | Ga0307414_101128911 | 350 |
| 580 | 3300032004 | Ga0307414_10205215 | Ga0307414_102052152 | 350 |
| 581 | 3300032126 | Ga0307415_100153021 | Ga0307415_1001530212 | 350 |
| 582 | 3300035692 | Ga0373935_0159320 | Ga0373935_0159320_401_1465 | 350 |
| 583 | 3300035725 | Ga0373947_0018618 | Ga0373947_0018618_1944_3008 | 350 |
| 584 | 3300037068 | Ga0373925_0180613 | Ga0373925_0180613_437_1501 | 350 |
| 585 | 3300037853 | Ga0436364_0459481 | Ga0436364_0459481_524_1633 | 350 |
| 586 | 3300039438 | Ga0436360_1061678 | Ga0436360_1061678_267_1361 | 350 |
| 587 | 3300039450 | Ga0436363_1599379 | Ga0436363_1599379_477_1592 | 350 |
| 588 | 3300041408 | Ga0439453_0002669 | Ga0439453_0002669_582_1649 | 350 |
| 589 | 3300042003 | Ga0439443_007424 | Ga0439443_007424_243_1310 | 350 |
| 590 | 3300042436 | Ga0439435_0016645 | Ga0439435_0016645_158_1225 | 350 |
| 591 | 3300042439 | Ga0439464_0028552 | Ga0439464_0028552_16_1116 | 350 |
| 592 | 3300042876 | Ga0451577_0001797 | Ga0451577_0001797_1064_2116 | 350 |
| 593 | 3300044673 | Ga0453683_0000931 | Ga0453683_0000931_16290_17378 | 350 |
| 594 | 3300044712 | Ga0453684_0000762 | Ga0453684_0000762_85499_86551 | 350 |
| 595 | 3300045051 | Ga0451576_0456998 | Ga0451576_0456998_210_1271 | 350 |
| 596 | 3300046663 | Ga0495635_0108499 | Ga0495635_0108499_825_1880 | 350 |
| 597 | 3300046674 | Ga0495588_0135278 | Ga0495588_0135278_233_1285 | 350 |
| 598 | 3300048907 | Ga0496104_0267881 | Ga0496104_0267881_395_1495 | 350 |
| 599 | 3300048911 | Ga0496108_0377986 | Ga0496108_0377986_98_1210 | 350 |
| 600 | 3300048912 | Ga0496109_0267695 | Ga0496109_0267695_115_1206 | 350 |
| 601 | 3300048915 | Ga0496112_0028632 | Ga0496112_0028632_3201_4301 | 350 |
| 602 | 3300048917 | Ga0496114_0146755 | Ga0496114_0146755_692_1750 | 350 |
| 603 | 3300049521 | Ga0501298_018144 | Ga0501298_018144_171_1232 | 350 |
| 604 | 3300049584 | Ga0501068_0092971 | Ga0501068_0092971_663_1727 | 350 |
| 605 | 3300049592 | Ga0501076_0072255 | Ga0501076_0072255_836_1954 | 350 |
| 606 | 3300049743 | Ga0501081_0106738 | Ga0501081_0106738_231_1349 | 350 |
| 607 | 3300050507 | nmdc:mga05p37_319259_c1 | nmdc:mga05p37_319259_c1_245_1345 | 350 |
| 608 | 3300050508 | nmdc:mga09592_106430_c1 | nmdc:mga09592_106430_c1_137_1198 | 350 |
| 609 | 3300050509 | nmdc:mga0qj67_19373_c1 | nmdc:mga0qj67_19373_c1_3232_4332 | 350 |
| 610 | 3300050509 | nmdc:mga0qj67_4545_c1 | nmdc:mga0qj67_4545_c1_4851_5912 | 350 |
| 611 | 3300050511 | nmdc:mga08y16_11655_c1 | nmdc:mga08y16_11655_c1_7245_8351 | 350 |
| 612 | 3300050511 | nmdc:mga08y16_47350_c1 | nmdc:mga08y16_47350_c1_2546_3649 | 350 |
| 613 | 3300050511 | nmdc:mga08y16_57501_c1 | nmdc:mga08y16_57501_c1_1276_2343 | 350 |
| 614 | 3300050511 | nmdc:mga08y16_91004_c1 | nmdc:mga08y16_91004_c1_988_2040 | 350 |
| 615 | 3300050512 | nmdc:mga0n895_216016_c1 | nmdc:mga0n895_216016_c1_394_1458 | 350 |
| 616 | 3300053085 | Ga0495619_0197753 | Ga0495619_0197753_141_1196 | 350 |
| 617 | 3300060353 | Ga0501082_0119558 | Ga0501082_0119558_800_1918 | 350 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6vo8-assembly1.cif.gz_B-2 | x-ray structure of the cj1427 in the presence of nadh and gdp-d-glycero-d-mannoheptose, an essential nad-dependent dehydrogenase from campylobacter jejuni | 0.8987 | 2 | 312 |
| 6vo6-assembly1.cif.gz_C | crystal structure of cj1427, an essential nad-dependent dehydrogenase from campylobacter jejuni, in the presence of nadh and gdp | 0.8878 | 2 | 317 |
| 6vo8-assembly1.cif.gz_B-2 | x-ray structure of the cj1427 in the presence of nadh and gdp-d-glycero-d-mannoheptose, an essential nad-dependent dehydrogenase from campylobacter jejuni | 0.8873 | 2 | 312 |
| 6b58-assembly1.cif.gz_A | frda-sdhe assembly intermediate | 0.8829 | 2 | 34 |
| 3vps-assembly1.cif.gz_A | structure of a novel nad dependent-ndp-hexosamine 5,6-dehydratase, tuna, involved in tunicamycin biosynthesis | 0.8809 | 2 | 319 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VCA1_7_417_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8927 | 3 | 34 | 3.50.50.60 |
| af_Q2FXA5_5_464_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8874 | 4 | 34 | 3.50.50.60 |
| af_Q10062_1_488_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8858 | 1 | 35 | 3.50.50.60 |
| 3lovA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8788 | 2 | 35 | 3.50.50.60 |
| af_Q9N4Z0_27_318_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8509 | 3 | 32 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M0XKG4-F1-model_v4 | SDR family oxidoreductase | 0.9916 | 58 | 348 |
|
| AF-A0A524KUS2-F1-model_v4 | SDR family oxidoreductase | 0.9915 | 52 | 349 |
|
| AF-S0FWY1-F1-model_v4 | PutativeUDP-glucose 4-epimerase GalE | 0.9889 | 1 | 349 |
|
| AF-A0A0N1C9C3-F1-model_v4 | NAD-dependent epimerase | 0.9884 | 1 | 346 |
|
| AF-A0A3M0XKG4-F1-model_v4 | SDR family oxidoreductase | 0.9882 | 58 | 348 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar