F469645

General Info

Members Datasets Scaffolds Average Seq Length
617 353 599 355

Family's Representative Sequence

Representative Sequence 3300025972|Ga0207668_10087820|Ga0207668_100878203
Length 395
Sequence MVWLWFRPYDWVLSSPCFGAYVREQAAPSNHSNRTAMKILITGNMGYVGPLVVRQLRRSHPQAILAGIDTAYFAHCLTGADMLPERNLDIQHFGDVRDLSDAALAGVDAVVHLAAISNDPMGKSFEAVTYEVNHRASVGLAQRAKKAGVRSFVFASSCSMYGLADDTPRKETSPLNPLTAYAISKVRTESDLQDIADSGFRVTCLRFATACGMSDRLRLDLVVNDFVACAVSSGNISILSDGTPWRPLIHVRDMARAIDWAIDRDREQGGDFLAVNVGSNVWNYQVKELADAVAKVIPGVTISVNKNAPPDNRSYRVDFALYERLAPSHQPQVDLLTAVSELQEGLSTMGFRDPNFRVSRFMRLEVLKQLGAKGLIGEDLRWTAERSHQVRTEGQ

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
6 2842747753 Variovorax sp. R-72060 Isolate Unclassified
7 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
8 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
9 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
10 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
11 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
12 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
13 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
14 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
15 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
16 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
192 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
226 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
227 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
228 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
236 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
237 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
238 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
239 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
240 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
241 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
242 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
243 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
244 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
256 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
257 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
258 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
259 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
260 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
272 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
273 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
274 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
276 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
294 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
295 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
296 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
297 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
312 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
313 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
314 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
315 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
316 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
319 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
320 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
323 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
324 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
327 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
328 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
329 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
330 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
331 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
332 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
333 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
334 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
335 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
336 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
337 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
338 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
339 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
340 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
341 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
342 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
343 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
344 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
345 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
346 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
347 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
348 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
349 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
350 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
353 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 0.32
Isolates 2.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.81
Nodule 1.13
Rhizoplane 4.05
Rhizosphere 79.74
Stem 0
Stem Tuber 0
Unclassified 8.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_7679642 2162886012 Unclassified 1596
2 JGI24739J22299_10019237 3300001989 Bacteria 2447
3 JGI25153J46596_10004924 3300003215 Bacteria 7097
4 JGI25153J46596_10005349 3300003215 Bacteria 6743
5 rootL2_10126575 3300003322 Bacteria 6216
6 Ga0055526_1000017 3300003771 Bacteria 210613
7 Ga0055524_1006128 3300003775 Bacteria 5258
8 Ga0065712_10069472 3300005290 Bacteria 7215
9 Ga0065712_10083676 3300005290 Bacteria 2819
10 Ga0065707_10004727 3300005295 Bacteria 3262
11 Ga0070690_100005471 3300005330 Bacteria 7136
12 Ga0070670_100021623 3300005331 Bacteria 5532
13 Ga0070670_100037529 3300005331 Bacteria 4169
14 Ga0070670_100106215 3300005331 Unclassified 2419
15 Ga0068869_100008842 3300005334 Bacteria 6517
16 Ga0068869_100012376 3300005334 Bacteria 5638
17 Ga0068869_100019772 3300005334 Bacteria 4608
18 Ga0068869_100177140 3300005334 Bacteria 1670
19 Ga0070666_10027073 3300005335 Unclassified 3751
20 Ga0070680_100017881 3300005336 Bacteria 5595
21 Ga0070680_100039720 3300005336 Unclassified 3807
22 Ga0070682_100005312 3300005337 Bacteria 7167
23 Ga0070682_100052870 3300005337 Bacteria 2543
24 Ga0068868_100015499 3300005338 Bacteria 5639
25 Ga0068868_100153744 3300005338 Bacteria 1896
26 Ga0070689_100118239 3300005340 Bacteria 2115
27 Ga0070689_100237666 3300005340 Bacteria 1500
28 Ga0070691_10013261 3300005341 Bacteria 3775
29 Ga0070687_100001463 3300005343 Bacteria 8318
30 Ga0070668_100022086 3300005347 Bacteria 4810
31 Ga0070668_100050442 3300005347 Bacteria 3204
32 Ga0070668_100091091 3300005347 Unclassified 2403
33 Ga0070669_100009863 3300005353 Bacteria 6802
34 Ga0070669_100282409 3300005353 Unclassified 1330
35 Ga0070675_100058611 3300005354 Unclassified 3176
36 Ga0070675_100074553 3300005354 Bacteria 2819
37 Ga0070675_100105580 3300005354 Bacteria 2377
38 Ga0070675_100138970 3300005354 Bacteria 2075
39 Ga0070674_100000066 3300005356 Bacteria 47605
40 Ga0070674_100048107 3300005356 Bacteria 2926
41 Ga0070688_100002786 3300005365 Bacteria 8878
42 Ga0070667_100074208 3300005367 Bacteria 2901
43 Ga0070667_100158328 3300005367 Bacteria 1993
44 Ga0070709_10005175 3300005434 Bacteria 7055
45 Ga0070709_10071255 3300005434 Bacteria 2243
46 Ga0070714_100079221 3300005435 Bacteria 2856
47 Ga0070713_100032165 3300005436 Bacteria 4187
48 Ga0070711_100003347 3300005439 Bacteria 9329
49 Ga0070705_100010260 3300005440 Bacteria 4683
50 Ga0070700_100293379 3300005441 Bacteria 1184
51 Ga0070694_100011060 3300005444 Bacteria 5585
52 Ga0070694_100133710 3300005444 Bacteria 1795
53 Ga0070663_100034776 3300005455 Bacteria 3491
54 Ga0070678_100028047 3300005456 Bacteria 3833
55 Ga0070678_100111276 3300005456 Bacteria 2143
56 Ga0070662_100008235 3300005457 Bacteria 6789
57 Ga0070662_100031331 3300005457 Bacteria 3732
58 Ga0070662_100082219 3300005457 Bacteria 2402
59 Ga0070681_10002597 3300005458 Bacteria 16573
60 Ga0068867_100002648 3300005459 Bacteria 12632
61 Ga0068867_100029015 3300005459 Unclassified 3986
62 Ga0068867_100187496 3300005459 Bacteria 1648
63 Ga0070706_100044651 3300005467 Unclassified 4093
64 Ga0070707_100000358 3300005468 Bacteria 44828
65 Ga0070698_100080822 3300005471 Bacteria 3245
66 Ga0070698_100137077 3300005471 Bacteria 2401
67 Ga0070699_100006108 3300005518 Bacteria 10539
68 Ga0070699_100163289 3300005518 Bacteria 1972
69 Ga0070697_100009148 3300005536 Bacteria 7738
70 Ga0068853_100120230 3300005539 Bacteria 2342
71 Ga0068853_100227078 3300005539 Bacteria 1707
72 Ga0070672_100008669 3300005543 Bacteria 6971
73 Ga0070672_100163169 3300005543 Bacteria 1850
74 Ga0070686_100000843 3300005544 Bacteria 17764
75 Ga0070686_100261453 3300005544 Unclassified 1269
76 Ga0070695_100005437 3300005545 Bacteria 7494
77 Ga0070696_100023352 3300005546 Bacteria 4204
78 Ga0070693_100001638 3300005547 Bacteria 10126
79 Ga0070665_100000023 3300005548 Bacteria 375278
80 Ga0070665_100038696 3300005548 Bacteria 4794
81 Ga0070665_100099053 3300005548 Bacteria 2919
82 Ga0070704_100012970 3300005549 Bacteria 5156
83 Ga0070704_100289666 3300005549 Bacteria 1360
84 Ga0068855_100041475 3300005563 Bacteria 5455
85 Ga0068855_100149646 3300005563 Bacteria 2654
86 Ga0068857_100021621 3300005577 Bacteria 5661
87 Ga0068854_100194034 3300005578 Unclassified 1593
88 Ga0068856_100010813 3300005614 Bacteria 8863
89 Ga0068856_100037555 3300005614 Bacteria 4752
90 Ga0070702_100023699 3300005615 Unclassified 3265
91 Ga0070702_100146188 3300005615 Bacteria 1512
92 Ga0070702_100195130 3300005615 Bacteria 1336
93 Ga0068852_100124491 3300005616 Bacteria 2365
94 Ga0068852_100137364 3300005616 Bacteria 2258
95 Ga0068859_100002443 3300005617 Bacteria 18918
96 Ga0068859_100030510 3300005617 Bacteria 5410
97 Ga0068859_100079852 3300005617 Bacteria 3312
98 Ga0068859_100126724 3300005617 Bacteria 2622
99 Ga0068859_100169306 3300005617 Bacteria 2265
100 Ga0068859_100173518 3300005617 Bacteria 2238
101 Ga0068864_100021473 3300005618 Bacteria 5410
102 Ga0068866_10151937 3300005718 Bacteria 1342
103 Ga0068861_100002019 3300005719 Bacteria 13142
104 Ga0068861_100012886 3300005719 Bacteria 5838
105 Ga0068870_10009032 3300005840 Unclassified 4511
106 Ga0068863_100155189 3300005841 Bacteria 2191
107 Ga0068863_100468484 3300005841 Bacteria 1238
108 Ga0068858_100000397 3300005842 Bacteria 45633
109 Ga0068858_100024427 3300005842 Bacteria 5631
110 Ga0068860_100000135 3300005843 Bacteria 120265
111 Ga0068860_100030383 3300005843 Bacteria 5196
112 Ga0068860_100164456 3300005843 Bacteria 2141
113 Ga0068860_100264601 3300005843 Unclassified 1677
114 Ga0068862_100006072 3300005844 Bacteria 10058
115 Ga0068862_100022695 3300005844 Bacteria 5251
116 Ga0068862_100278844 3300005844 Unclassified 1531
117 Ga0081455_10001076 3300005937 Bacteria 34369
118 Ga0081455_10027187 3300005937 Bacteria 5244
119 Ga0081540_1000590 3300005983 Bacteria 34934
120 Ga0081540_1020469 3300005983 Bacteria 3977
121 Ga0081539_10014316 3300005985 Bacteria 5877
122 Ga0070716_100002766 3300006173 Bacteria 8147
123 Ga0070716_100005032 3300006173 Bacteria 6373
124 Ga0070716_100093545 3300006173 Unclassified 1825
125 Ga0097621_100010866 3300006237 Bacteria 6680
126 Ga0097621_100106118 3300006237 Bacteria 2369
127 Ga0097621_100185503 3300006237 Bacteria 1799
128 Ga0075370_10039963 3300006353 Bacteria 2645
129 Ga0068871_100219226 3300006358 Bacteria 1648
130 Ga0075428_100001613 3300006844 Bacteria 24108
131 Ga0075430_100004646 3300006846 Bacteria 11548
132 Ga0075430_100008951 3300006846 Bacteria 8455
133 Ga0075430_100066585 3300006846 Bacteria 3025
134 Ga0075430_100125399 3300006846 Bacteria 2140
135 Ga0075431_100006287 3300006847 Bacteria 11802
136 Ga0075431_100047009 3300006847 Bacteria 4450
137 Ga0075431_100314583 3300006847 Bacteria 1580
138 Ga0075433_10003516 3300006852 Bacteria 12103
139 Ga0075433_10280394 3300006852 Bacteria 1476
140 Ga0075434_100000732 3300006871 Bacteria 25783
141 Ga0075434_100385401 3300006871 Bacteria 1422
142 Ga0075429_100000412 3300006880 Bacteria 31781
143 Ga0075429_100015697 3300006880 Bacteria 6562
144 Ga0075429_100077402 3300006880 Unclassified 2898
145 Ga0075429_100290464 3300006880 Bacteria 1431
146 Ga0068865_100005519 3300006881 Bacteria 7676
147 Ga0075436_100003338 3300006914 Bacteria 10987
148 Ga0075436_100004459 3300006914 Bacteria 9607
149 Ga0075436_100096668 3300006914 Bacteria 2055
150 Ga0097620_100002442 3300006931 Bacteria 18918
151 Ga0097620_100030510 3300006931 Bacteria 5410
152 Ga0097620_100079853 3300006931 Bacteria 3312
153 Ga0097620_100126722 3300006931 Bacteria 2622
154 Ga0097620_100169297 3300006931 Bacteria 2265
155 Ga0097620_100173509 3300006931 Bacteria 2238
156 Ga0075435_100241772 3300007076 Bacteria 1536
157 Ga0099794_10000099 3300007265 Bacteria 32049
158 Ga0105240_10001003 3300009093 Bacteria 50390
159 Ga0105240_10007009 3300009093 Bacteria 16450
160 Ga0105240_10159657 3300009093 Unclassified 2679
161 Ga0105240_10210614 3300009093 Bacteria 2272
162 Ga0111539_10003717 3300009094 Bacteria 20082
163 Ga0111539_10010980 3300009094 Bacteria 11400
164 Ga0111539_10015034 3300009094 Bacteria 9646
165 Ga0111539_10024276 3300009094 Bacteria 7444
166 Ga0111539_10220997 3300009094 Bacteria 2206
167 Ga0105245_10006486 3300009098 Bacteria 10286
168 Ga0105245_10056941 3300009098 Bacteria 3515
169 Ga0105247_10051820 3300009101 Bacteria 2529
170 Ga0105247_10066872 3300009101 Bacteria 2239
171 Ga0114129_10002654 3300009147 Bacteria 24899
172 Ga0114129_10004025 3300009147 Bacteria 20739
173 Ga0114129_10006442 3300009147 Bacteria 16645
174 Ga0114129_10010475 3300009147 Bacteria 13222
175 Ga0114129_10629056 3300009147 Bacteria 1387
176 Ga0105243_10010440 3300009148 Bacteria 7051
177 Ga0105243_10038548 3300009148 Bacteria 3721
178 Ga0105243_10113273 3300009148 Bacteria 2274
179 Ga0105243_10256907 3300009148 Bacteria 1563
180 Ga0105241_10060086 3300009174 Bacteria 2923
181 Ga0105242_10003075 3300009176 Bacteria 13016
182 Ga0105242_10599632 3300009176 Unclassified 1064
183 Ga0105248_10001248 3300009177 Bacteria 28422
184 Ga0105248_10075500 3300009177 Bacteria 3788
185 Ga0105248_10105859 3300009177 Bacteria 3171
186 Ga0105248_10188860 3300009177 Bacteria 2321
187 Ga0105248_10350741 3300009177 Bacteria 1661
188 Ga0105248_10394199 3300009177 Bacteria 1559
189 Ga0105237_10000537 3300009545 Bacteria 53507
190 Ga0105237_10003536 3300009545 Bacteria 18519
191 Ga0105237_10096528 3300009545 Bacteria 2946
192 Ga0105249_10005684 3300009553 Bacteria 10783
193 Ga0105249_10016117 3300009553 Bacteria 6625
194 Ga0105249_10148080 3300009553 Bacteria 2257
195 Ga0105239_10000037 3300010375 Bacteria 206779
196 Ga0105239_10000537 3300010375 Bacteria 54882
197 Ga0105239_10032969 3300010375 Bacteria 5690
198 Ga0105239_10044997 3300010375 Bacteria 4838
199 Ga0105239_10144619 3300010375 Bacteria 2651
200 Ga0105239_10400733 3300010375 Bacteria 1553
201 Ga0105246_10015541 3300011119 Bacteria 4810
202 Ga0157369_10138104 3300013105 Bacteria 2580
203 Ga0157374_10041905 3300013296 Bacteria 4221
204 Ga0157378_10011091 3300013297 Bacteria 7888
205 Ga0157378_10020587 3300013297 Bacteria 5801
206 Ga0157378_10030998 3300013297 Bacteria 4722
207 Ga0157378_10194596 3300013297 Bacteria 1915
208 Ga0163162_10030665 3300013306 Bacteria 5328
209 Ga0163162_10053017 3300013306 Bacteria 4076
210 Ga0157372_10132975 3300013307 Bacteria 2864
211 Ga0157372_10749871 3300013307 Bacteria 1135
212 Ga0157375_10002523 3300013308 Bacteria 15891
213 Ga0157375_10081980 3300013308 Bacteria 3267
214 Ga0157375_10115404 3300013308 Bacteria 2788
215 Ga0157375_10136156 3300013308 Bacteria 2580
216 Ga0163163_10072699 3300014325 Bacteria 3428
217 Ga0163163_10289498 3300014325 Bacteria 1690
218 Ga0157380_10000255 3300014326 Bacteria 31852
219 Ga0157380_10001701 3300014326 Bacteria 14535
220 Ga0157380_10018891 3300014326 Bacteria 5127
221 Ga0157377_10001466 3300014745 Bacteria 10209
222 Ga0157379_10020026 3300014968 Bacteria 5913
223 Ga0157379_10029505 3300014968 Bacteria 4877
224 Ga0157376_10011776 3300014969 Bacteria 6461
225 Ga0157376_10200414 3300014969 Bacteria 1836
226 Ga0163161_10036206 3300017792 Bacteria 3534
227 Ga0213873_10000018 3300021358 Bacteria 123140
228 Ga0213876_10000058 3300021384 Bacteria 134080
229 Ga0209564_1000031 3300025295 Bacteria 494703
230 Ga0209758_1000628 3300025297 Bacteria 54130
231 Ga0209758_1004855 3300025297 Bacteria 10842
232 Ga0209758_1011338 3300025297 Bacteria 5178
233 Ga0209758_1043650 3300025297 Bacteria 1649
234 Ga0209050_1003852 3300025298 Bacteria 10683
235 Ga0209256_1000071 3300025299 Bacteria 242618
236 Ga0207697_10028120 3300025315 Bacteria 2299
237 Ga0207692_10030555 3300025898 Bacteria 2570
238 Ga0207710_10031090 3300025900 Bacteria 2332
239 Ga0207680_10017535 3300025903 Unclassified 3786
240 Ga0207647_10004912 3300025904 Bacteria 9866
241 Ga0207699_10057359 3300025906 Bacteria 2325
242 Ga0207645_10080773 3300025907 Bacteria 2084
243 Ga0207643_10008018 3300025908 Bacteria 5667
244 Ga0207643_10152553 3300025908 Unclassified 1386
245 Ga0207643_10201964 3300025908 Unclassified 1211
246 Ga0207654_10102113 3300025911 Bacteria 1769
247 Ga0207707_10106187 3300025912 Bacteria 2455
248 Ga0207695_10003329 3300025913 Bacteria 22777
249 Ga0207695_10068690 3300025913 Bacteria 3630
250 Ga0207695_10109477 3300025913 Bacteria 2744
251 Ga0207671_10001619 3300025914 Bacteria 25633
252 Ga0207671_10013776 3300025914 Bacteria 6420
253 Ga0207671_10342078 3300025914 Unclassified 1185
254 Ga0207693_10014506 3300025915 Bacteria 6333
255 Ga0207660_10004041 3300025917 Bacteria 9572
256 Ga0207660_10046256 3300025917 Unclassified 3070
257 Ga0207662_10003737 3300025918 Bacteria 7892
258 Ga0207662_10103770 3300025918 Bacteria 1765
259 Ga0207652_10071205 3300025921 Bacteria 3021
260 Ga0207646_10000008 3300025922 Bacteria 457143
261 Ga0207646_10000009 3300025922 Bacteria 453146
262 Ga0207681_10070994 3300025923 Bacteria 2427
263 Ga0207681_10083712 3300025923 Bacteria 2259
264 Ga0207650_10043930 3300025925 Bacteria 3283
265 Ga0207659_10065221 3300025926 Bacteria 2638
266 Ga0207687_10007306 3300025927 Bacteria 7286
267 Ga0207700_10033917 3300025928 Bacteria 3658
268 Ga0207664_10231655 3300025929 Bacteria 1606
269 Ga0207690_10297854 3300025932 Bacteria 1261
270 Ga0207706_10013072 3300025933 Bacteria 7554
271 Ga0207706_10015911 3300025933 Bacteria 6798
272 Ga0207706_10028964 3300025933 Bacteria 4944
273 Ga0207706_10272437 3300025933 Bacteria 1477
274 Ga0207686_10008341 3300025934 Bacteria 5593
275 Ga0207686_10041322 3300025934 Bacteria 2810
276 Ga0207686_10067125 3300025934 Unclassified 2293
277 Ga0207709_10002338 3300025935 Bacteria 11964
278 Ga0207709_10170745 3300025935 Bacteria 1526
279 Ga0207670_10230723 3300025936 Bacteria 1421
280 Ga0207669_10000554 3300025937 Bacteria 16317
281 Ga0207669_10002009 3300025937 Bacteria 8629
282 Ga0207669_10127603 3300025937 Bacteria 1741
283 Ga0207704_10119569 3300025938 Bacteria 1800
284 Ga0207665_10003717 3300025939 Bacteria 10190
285 Ga0207665_10010768 3300025939 Bacteria 6004
286 Ga0207691_10061209 3300025940 Unclassified 3420
287 Ga0207691_10177190 3300025940 Bacteria 1864
288 Ga0207711_10004771 3300025941 Bacteria 11509
289 Ga0207711_10016054 3300025941 Bacteria 6213
290 Ga0207689_10001496 3300025942 Bacteria 22313
291 Ga0207689_10004614 3300025942 Bacteria 12460
292 Ga0207689_10012328 3300025942 Bacteria 7315
293 Ga0207689_10017177 3300025942 Bacteria 6124
294 Ga0207667_10054070 3300025949 Bacteria 4224
295 Ga0207668_10008963 3300025972 Bacteria 5984
296 Ga0207668_10087820 3300025972 Unclassified 2275
297 Ga0207668_10215945 3300025972 Bacteria 1537
298 Ga0207640_10009053 3300025981 Bacteria 5556
299 Ga0207640_10262019 3300025981 Unclassified 1348
300 Ga0207658_10051757 3300025986 Bacteria 3027
301 Ga0207677_10043770 3300026023 Bacteria 2978
302 Ga0207677_10123031 3300026023 Bacteria 1955
303 Ga0207677_10128562 3300026023 Bacteria 1919
304 Ga0207703_10001606 3300026035 Bacteria 20452
305 Ga0207703_10019741 3300026035 Bacteria 5269
306 Ga0207678_10022586 3300026067 Bacteria 5510
307 Ga0207678_10110380 3300026067 Bacteria 2346
308 Ga0207678_10181910 3300026067 Bacteria 1795
309 Ga0207708_10002744 3300026075 Bacteria 12933
310 Ga0207708_10014441 3300026075 Bacteria 5911
311 Ga0207708_10076058 3300026075 Bacteria 2575
312 Ga0207702_10222961 3300026078 Bacteria 1758
313 Ga0207641_10150119 3300026088 Bacteria 2110
314 Ga0207648_10002639 3300026089 Bacteria 19155
315 Ga0207648_10029681 3300026089 Bacteria 4849
316 Ga0207648_10042838 3300026089 Bacteria 3974
317 Ga0207674_10033963 3300026116 Bacteria 5335
318 Ga0207675_100000282 3300026118 Bacteria 48883
319 Ga0207675_100001855 3300026118 Bacteria 21175
320 Ga0207675_100014304 3300026118 Bacteria 7398
321 Ga0207675_100081355 3300026118 Bacteria 3037
322 Ga0207683_10018973 3300026121 Bacteria 5869
323 Ga0207683_10086757 3300026121 Bacteria 2783
324 Ga0207683_10094845 3300026121 Unclassified 2660
325 Ga0207683_10128993 3300026121 Bacteria 2274
326 Ga0207698_10190881 3300026142 Bacteria 1825
327 Ga0209588_1000276 3300027671 Bacteria 13648
328 Ga0209974_10005986 3300027876 Bacteria 4258
329 Ga0207428_10049318 3300027907 Bacteria 3374
330 Ga0207428_10092400 3300027907 Bacteria 2348
331 Ga0268266_10000002 3300028379 Bacteria 3059047
332 Ga0268265_10012036 3300028380 Bacteria 5856
333 Ga0268265_10036681 3300028380 Unclassified 3592
334 Ga0268264_10000038 3300028381 Bacteria 383623
335 Ga0268264_10082198 3300028381 Bacteria 2755
336 Ga0268264_10198098 3300028381 Bacteria 1835
337 Ga0307511_10110457 3300030521 Bacteria 1752
338 Ga0307511_10123666 3300030521 Bacteria 1588
339 Ga0265325_10004858 3300031241 Bacteria 8401
340 Ga0265339_10000109 3300031249 Bacteria 66969
341 Ga0307513_10007695 3300031456 Bacteria 13922
342 Ga0307509_10067612 3300031507 Bacteria 3742
343 Ga0265313_10000257 3300031595 Bacteria 57767
344 Ga0265314_10052549 3300031711 Bacteria 2831
345 Ga0307516_10001624 3300031730 Bacteria 30958
346 Ga0316577_10034730 3300031733 Bacteria 2818
347 Ga0307407_10057727 3300031903 Bacteria 2253
348 Ga0307409_100249371 3300031995 Bacteria 1622
349 Ga0307416_100059757 3300032002 Bacteria 3100
350 Ga0307414_10016334 3300032004 Bacteria 4510
351 Ga0307414_10085019 3300032004 Bacteria 2329
352 Ga0307414_10112891 3300032004 Bacteria 2073
353 Ga0307414_10205215 3300032004 Bacteria 1607
354 Ga0307411_10002864 3300032005 Bacteria 7796
355 Ga0307415_100153021 3300032126 Bacteria 1778
356 Ga0307415_100463947 3300032126 Bacteria 1098
357 Ga0316593_10000965 3300032168 Bacteria 5943
358 Ga0316593_10006768 3300032168 Bacteria 3115
359 Ga0307507_10053079 3300033179 Bacteria 3877
360 Ga0373926_0155562 3300035083 Bacteria 871
361 Ga0373934_0007036 3300035086 Bacteria 4173
362 Ga0373932_0007238 3300035112 Bacteria 2639
363 Ga0373936_0010325 3300035113 Unclassified 3524
364 Ga0373945_0037585 3300035116 Bacteria 1738
365 Ga0373953_0004717 3300035117 Bacteria 4368
366 Ga0373954_0002190 3300035118 Bacteria 8122
367 Ga0373956_0001065 3300035119 Bacteria 11292
368 Ga0373957_0001462 3300035120 Bacteria 6402
369 Ga0373943_0000592 3300035170 Bacteria 15728
370 Ga0373955_0066166 3300035172 Bacteria 2008
371 Ga0373931_0019233 3300035691 Bacteria 3407
372 Ga0373935_0144321 3300035692 Bacteria 1610
373 Ga0373935_0159320 3300035692 Unclassified 1537
374 Ga0373927_0021622 3300035695 Bacteria 4217
375 Ga0373927_0032538 3300035695 Bacteria 3396
376 Ga0373927_0036631 3300035695 Bacteria 3190
377 Ga0373933_0002728 3300035724 Bacteria 9875
378 Ga0373947_0007044 3300035725 Bacteria 6517
379 Ga0373947_0018618 3300035725 Bacteria 3998
380 Ga0373937_0041035 3300036401 Bacteria 4220
381 Ga0316582_0022433 3300036647 Bacteria 3748
382 Ga0373925_0043763 3300037068 Bacteria 3324
383 Ga0373925_0069110 3300037068 Bacteria 2667
384 Ga0373925_0180613 3300037068 Bacteria 1670
385 Ga0373925_0246348 3300037068 Bacteria 1432
386 Ga0395899_0085555 3300037312 Bacteria 2291
387 Ga0395900_0028161 3300037418 Bacteria 5754
388 Ga0395905_0103901 3300037471 Bacteria 2667
389 Ga0436364_0420422 3300037853 Bacteria 1718
390 Ga0436364_0459481 3300037853 Bacteria 4337
391 Ga0436364_1376026 3300037853 Bacteria 2499
392 Ga0395901_0016073 3300038443 Bacteria 7626
393 Ga0395901_0193283 3300038443 Bacteria 2134
394 Ga0400484_19896 3300038725 Bacteria 2116
395 Ga0400490_09372 3300038726 Bacteria 14741
396 Ga0400490_10463 3300038726 Bacteria 6199
397 Ga0400490_39904 3300038726 Bacteria 15867
398 Ga0400486_10384 3300038742 Bacteria 8720
399 Ga0400486_17264 3300038742 Bacteria 7284
400 Ga0400483_207311 3300039062 Bacteria 1684
401 Ga0400483_234344 3300039062 Bacteria 3636
402 Ga0436365_0337700 3300039437 Bacteria 40984
403 Ga0436365_1710345 3300039437 Bacteria 5598
404 Ga0436360_1061678 3300039438 Bacteria 1413
405 Ga0436360_1335800 3300039438 Unclassified 1233
406 Ga0436363_1527683 3300039450 Bacteria 3384
407 Ga0436363_1599379 3300039450 Unclassified 2867
408 Ga0436362_0011715 3300039453 Bacteria 44760
409 Ga0439453_0002669 3300041408 Bacteria 2484
410 Ga0451853_3003930 3300041512 Bacteria 3432
411 Ga0439443_007424 3300042003 Bacteria 1525
412 Ga0439449_0012140 3300042007 Bacteria 3239
413 Ga0439434_0006060 3300042435 Bacteria 3528
414 Ga0439435_0016645 3300042436 Bacteria 1847
415 Ga0439464_0028552 3300042439 Bacteria 1555
416 Ga0451577_0001797 3300042876 Bacteria 27439
417 Ga0451577_0011700 3300042876 Bacteria 8284
418 Ga0451577_0090385 3300042876 Unclassified 2733
419 Ga0466969_0043481 3300044656 Unclassified 2239
420 Ga0466973_0115202 3300044659 Bacteria 2232
421 Ga0453683_0000931 3300044673 Bacteria 27801
422 Ga0453683_0008486 3300044673 Bacteria 6892
423 Ga0453684_0000762 3300044712 Bacteria 111891
424 Ga0453684_0007497 3300044712 Bacteria 20015
425 Ga0453684_0013804 3300044712 Bacteria 13054
426 Ga0453684_0048547 3300044712 Bacteria 5610
427 Ga0453684_0070803 3300044712 Bacteria 4413
428 Ga0453684_0101103 3300044712 Bacteria 3528
429 Ga0453684_0122837 3300044712 Unclassified 3132
430 Ga0453684_0482815 3300044712 Bacteria 1374
431 Ga0451576_0002498 3300045051 Bacteria 27301
432 Ga0451576_0004796 3300045051 Bacteria 17332
433 Ga0451576_0151200 3300045051 Bacteria 2421
434 Ga0451576_0456998 3300045051 Bacteria 1341
435 Ga0495638_0082280 3300046460 Bacteria 1953
436 Ga0495641_0068483 3300046461 Bacteria 1596
437 Ga0495580_0001979 3300046472 Bacteria 18014
438 Ga0495584_0007601 3300046491 Bacteria 5648
439 Ga0495606_0083994 3300046507 Bacteria 1973
440 Ga0495608_0045480 3300046511 Bacteria 2925
441 Ga0495618_0043761 3300046514 Bacteria 2825
442 Ga0495620_0067732 3300046515 Bacteria 1468
443 Ga0495630_0085356 3300046517 Bacteria 2383
444 Ga0495632_0000506 3300046519 Bacteria 36758
445 Ga0495648_0000357 3300046524 Bacteria 50228
446 Ga0495663_0001112 3300046525 Bacteria 8690
447 Ga0495586_0097074 3300046535 Bacteria 1632
448 Ga0495622_0035633 3300046557 Bacteria 2320
449 Ga0495667_0001884 3300046559 Bacteria 13924
450 Ga0495668_0158027 3300046616 Bacteria 1242
451 Ga0495611_0099993 3300046648 Bacteria 1346
452 Ga0495625_0010682 3300046660 Bacteria 7565
453 Ga0495625_0104058 3300046660 Bacteria 1946
454 Ga0495635_0108499 3300046663 Unclassified 1897
455 Ga0495588_0135278 3300046674 Bacteria 1301
456 Ga0495658_0017873 3300046683 Bacteria 3675
457 Ga0495658_0160584 3300046683 Bacteria 1386
458 Ga0495669_0000283 3300046684 Bacteria 29078
459 Ga0495660_0018361 3300046810 Bacteria 4021
460 Ga0495604_0053150 3300047317 Bacteria 3133
461 Ga0495680_0098432 3300047322 Bacteria 2182
462 Ga0495683_0037152 3300047323 Bacteria 2470
463 Ga0495687_000240 3300047443 Bacteria 75621
464 Ga0495685_042295 3300047447 Bacteria 1555
465 Ga0495681_0005652 3300047470 Bacteria 8330
466 Ga0495684_0050570 3300047471 Bacteria 3172
467 Ga0495686_0015635 3300047472 Bacteria 5175
468 Ga0495686_0157363 3300047472 Bacteria 1330
469 Ga0496100_0006983 3300048903 Bacteria 6191
470 Ga0496101_0164562 3300048904 Bacteria 1702
471 Ga0496102_0025634 3300048905 Bacteria 5252
472 Ga0496102_0401730 3300048905 Bacteria 1288
473 Ga0496104_0264581 3300048907 Bacteria 1632
474 Ga0496104_0267881 3300048907 Bacteria 1620
475 Ga0496105_0003823 3300048908 Bacteria 11233
476 Ga0496105_0211385 3300048908 Bacteria 1581
477 Ga0496106_0000635 3300048909 Bacteria 25180
478 Ga0496106_0000846 3300048909 Bacteria 22208
479 Ga0496106_0059308 3300048909 Bacteria 2898
480 Ga0496106_0138482 3300048909 Bacteria 1913
481 Ga0496106_0350027 3300048909 Bacteria 1187
482 Ga0496107_0014595 3300048910 Bacteria 5498
483 Ga0496108_0377986 3300048911 Bacteria 1237
484 Ga0496108_0556205 3300048911 Bacteria 1001
485 Ga0496109_0046953 3300048912 Bacteria 3924
486 Ga0496109_0267695 3300048912 Bacteria 1610
487 Ga0496110_0179147 3300048913 Bacteria 1924
488 Ga0496112_0028632 3300048915 Bacteria 5379
489 Ga0496112_0115905 3300048915 Bacteria 2649
490 Ga0496113_0052808 3300048916 Bacteria 3037
491 Ga0496114_0146755 3300048917 Bacteria 2045
492 Ga0496115_0010674 3300048918 Bacteria 6868
493 Ga0496115_0064804 3300048918 Bacteria 2951
494 Ga0496117_0014005 3300048920 Bacteria 6943
495 Ga0496117_0031818 3300048920 Bacteria 4022
496 Ga0496118_0005969 3300048921 Bacteria 13587
497 Ga0496118_0010900 3300048921 Bacteria 8941
498 Ga0496118_0042422 3300048921 Bacteria 3589
499 Ga0496121_0000066 3300048924 Bacteria 267065
500 Ga0496121_0000099 3300048924 Bacteria 200160
501 Ga0496121_0000711 3300048924 Bacteria 61682
502 Ga0496124_0001203 3300048927 Bacteria 40096
503 Ga0496124_0004730 3300048927 Bacteria 15715
504 Ga0496125_0027424 3300048928 Bacteria 5162
505 Ga0496125_0031356 3300048928 Bacteria 4739
506 Ga0496126_0005951 3300048929 Bacteria 13731
507 Ga0496126_0006087 3300048929 Bacteria 13533
508 Ga0496126_0006199 3300048929 Bacteria 13378
509 Ga0496126_0014718 3300048929 Bacteria 7892
510 Ga0496126_0114840 3300048929 Bacteria 2342
511 Ga0501298_018144 3300049521 Unclassified 1291
512 Ga0501031_0049975 3300049568 Bacteria 2725
513 Ga0501034_0202121 3300049571 Unclassified 1945
514 Ga0501036_0026421 3300049572 Bacteria 4901
515 Ga0501037_0086893 3300049573 Unclassified 2263
516 Ga0501038_0147178 3300049574 Bacteria 1922
517 Ga0501038_0199948 3300049574 Bacteria 1604
518 Ga0501039_0000220 3300049575 Bacteria 41747
519 Ga0501039_0030462 3300049575 Bacteria 4161
520 Ga0501039_0134661 3300049575 Bacteria 1940
521 Ga0501039_0186886 3300049575 Bacteria 1629
522 Ga0501041_0018142 3300049577 Bacteria 4191
523 Ga0501041_0071494 3300049577 Unclassified 2130
524 Ga0501042_0002227 3300049578 Bacteria 11835
525 Ga0501043_0012347 3300049579 Bacteria 6678
526 Ga0501046_0006026 3300049580 Bacteria 10783
527 Ga0501046_0015633 3300049580 Bacteria 6373
528 Ga0501047_0000631 3300049581 Bacteria 37077
529 Ga0501048_0020880 3300049582 Unclassified 4797
530 Ga0501048_0044434 3300049582 Bacteria 3177
531 Ga0501068_0092971 3300049584 Bacteria 1863
532 Ga0501071_0031703 3300049587 Bacteria 3749
533 Ga0501071_0171677 3300049587 Bacteria 1623
534 Ga0501076_0072255 3300049592 Bacteria 2761
535 Ga0501224_000028 3300049664 Bacteria 53596
536 Ga0501249_000339 3300049679 Bacteria 12675
537 Ga0501225_0005082 3300049705 Bacteria 3878
538 Ga0501081_0106738 3300049743 Bacteria 1985
539 Ga0501035_0000923 3300049822 Bacteria 31113
540 Ga0501035_0015693 3300049822 Bacteria 6991
541 Ga0501035_0036200 3300049822 Bacteria 4474
542 Ga0501226_000128 3300049853 Bacteria 15003
543 nmdc:mga06z11_21431_c1 3300050494 Bacteria 3003
544 nmdc:mga07m45_33781_c1 3300050496 Bacteria 2841
545 nmdc:mga05p37_1800_c1 3300050507 Bacteria 25037
546 nmdc:mga05p37_2725_c1 3300050507 Bacteria 20523
547 nmdc:mga05p37_319259_c1 3300050507 Bacteria 1839
548 nmdc:mga05p37_97139_c1 3300050507 Bacteria 3629
549 nmdc:mga09592_106430_c1 3300050508 Unclassified 2405
550 nmdc:mga09592_266161_c1 3300050508 Bacteria 1487
551 nmdc:mga09592_2740_c1 3300050508 Bacteria 14239
552 nmdc:mga0qj67_19373_c1 3300050509 Bacteria 5198
553 nmdc:mga0qj67_4545_c1 3300050509 Bacteria 10054
554 nmdc:mga0qj67_8376_c1 3300050509 Bacteria 7665
555 nmdc:mga06r32_275077_c1 3300050510 Unclassified 1671
556 nmdc:mga08y16_10425_c1 3300050511 Bacteria 9749
557 nmdc:mga08y16_11655_c1 3300050511 Bacteria 9237
558 nmdc:mga08y16_161938_c1 3300050511 Bacteria 2325
559 nmdc:mga08y16_164498_c1 3300050511 Bacteria 2305
560 nmdc:mga08y16_47350_c1 3300050511 Bacteria 4500
561 nmdc:mga08y16_57501_c1 3300050511 Bacteria 4064
562 nmdc:mga08y16_91004_c1 3300050511 Bacteria 3180
563 nmdc:mga0n895_216016_c1 3300050512 Bacteria 1947
564 nmdc:mga0n895_3487_c1 3300050512 Bacteria 12698
565 nmdc:mga08x19_1584_c2 3300050514 Bacteria 10787
566 nmdc:mga08x19_3752_c1 3300050514 Bacteria 9042
567 nmdc:mga0a205_6621_c1 3300050515 Bacteria 10485
568 Ga0495601_0114222 3300053077 Bacteria 1751
569 Ga0500635_0020933 3300053080 Bacteria 2009
570 Ga0500635_0079914 3300053080 Bacteria 1173
571 Ga0495619_0197753 3300053085 Bacteria 1392
572 Ga0500647_0023976 3300053091 Bacteria 2867
573 Ga0500583_0090130 3300053092 Bacteria 1492
574 Ga0500648_163790 3300053097 Bacteria 1166
575 Ga0500556_0024720 3300053104 Unclassified 1977
576 Ga0500556_0028003 3300053104 Bacteria 1888
577 Ga0500595_001318 3300053119 Bacteria 13452
578 Ga0500595_002291 3300053119 Bacteria 9607
579 Ga0500595_015008 3300053119 Bacteria 2922
580 Ga0500597_062864 3300053120 Bacteria 1597
581 Ga0500642_0002173 3300053130 Bacteria 5697
582 Ga0500568_0006551 3300053139 Bacteria 5829
583 Ga0500573_0005791 3300053140 Bacteria 6632
584 Ga0500573_0045984 3300053140 Bacteria 2515
585 Ga0500589_093278 3300053147 Bacteria 1321
586 Ga0500590_055936 3300053148 Bacteria 1995
587 Ga0500603_006556 3300053150 Bacteria 2533
588 Ga0500604_0000202 3300053151 Bacteria 16991
589 Ga0500616_0003160 3300053153 Bacteria 12846
590 Ga0500638_025950 3300053162 Bacteria 2804
591 Ga0500638_100694 3300053162 Bacteria 1348
592 Ga0500639_056580 3300053163 Bacteria 2031
593 Ga0500636_0020033 3300053177 Bacteria 3956
594 Ga0500636_0088668 3300053177 Bacteria 1774
595 Ga0500645_000134 3300053730 Bacteria 58275
596 Ga0500645_024167 3300053730 Bacteria 1859
597 Ga0500661_004008 3300055283 Bacteria 2756
598 Ga0501082_0000073 3300060353 Bacteria 73297
599 Ga0501082_0119558 3300060353 Bacteria 2283

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035083 Ga0373926_0155562 Ga0373926_0155562_19_861 280
2 3300049574 Ga0501038_0199948 Ga0501038_0199948_714_1580 287
3 3300048911 Ga0496108_0556205 Ga0496108_0556205_78_986 302
4 3300049577 Ga0501041_0071494 Ga0501041_0071494_54_971 304
5 3300050509 nmdc:mga0qj67_8376_c1 nmdc:mga0qj67_8376_c1_6281_7309 317
6 3300050510 nmdc:mga06r32_275077_c1 nmdc:mga06r32_275077_c1_551_1579 317
7 3300006173 Ga0070716_100093545 Ga0070716_1000935453 319
8 3300009148 Ga0105243_10113273 Ga0105243_101132732 327
9 3300009176 Ga0105242_10599632 Ga0105242_105996321 327
10 3300009177 Ga0105248_10188860 Ga0105248_101888602 327
11 3300009553 Ga0105249_10148080 Ga0105249_101480802 327
12 3300013297 Ga0157378_10194596 Ga0157378_101945961 327
13 3300050511 nmdc:mga08y16_161938_c1 nmdc:mga08y16_161938_c1_1105_2088 327
14 3300032168 Ga0316593_10006768 Ga0316593_100067682 328
15 3300050508 nmdc:mga09592_266161_c1 nmdc:mga09592_266161_c1_402_1445 331
16 3300026118 Ga0207675_100014304 Ga0207675_1000143042 333
17 3300049571 Ga0501034_0202121 Ga0501034_0202121_329_1369 334
18 3300049572 Ga0501036_0026421 Ga0501036_0026421_2194_3234 334
19 3300049574 Ga0501038_0147178 Ga0501038_0147178_831_1871 334
20 3300049575 Ga0501039_0000220 Ga0501039_0000220_900_1940 334
21 3300049577 Ga0501041_0018142 Ga0501041_0018142_2441_3481 334
22 3300049578 Ga0501042_0002227 Ga0501042_0002227_5150_6190 334
23 3300049580 Ga0501046_0006026 Ga0501046_0006026_2783_3823 334
24 3300049582 Ga0501048_0020880 Ga0501048_0020880_3245_4285 334
25 3300049587 Ga0501071_0031703 Ga0501071_0031703_608_1648 334
26 3300049822 Ga0501035_0015693 Ga0501035_0015693_5134_6174 334
27 3300032004 Ga0307414_10016334 Ga0307414_100163342 335
28 3300049664 Ga0501224_000028 Ga0501224_000028_18887_19936 336
29 3300049705 Ga0501225_0005082 Ga0501225_0005082_1039_2088 336
30 3300049853 Ga0501226_000128 Ga0501226_000128_9019_10068 336
31 3300060353 Ga0501082_0000073 Ga0501082_0000073_51453_52487 336
32 3300009545 Ga0105237_10096528 Ga0105237_100965282 338
33 3300010375 Ga0105239_10144619 Ga0105239_101446192 338
34 3300010375 Ga0105239_10400733 Ga0105239_104007332 338
35 3300035692 Ga0373935_0144321 Ga0373935_0144321_264_1280 338
36 3300035695 Ga0373927_0032538 Ga0373927_0032538_234_1250 338
37 3300037068 Ga0373925_0043763 Ga0373925_0043763_961_1977 338
38 3300046557 Ga0495622_0035633 Ga0495622_0035633_558_1574 338
39 3300046683 Ga0495658_0160584 Ga0495658_0160584_114_1130 338
40 3300048909 Ga0496106_0000635 Ga0496106_0000635_18166_19182 338
41 3300048921 Ga0496118_0010900 Ga0496118_0010900_5258_6274 338
42 3300048924 Ga0496121_0000711 Ga0496121_0000711_8006_9022 338
43 3300048927 Ga0496124_0001203 Ga0496124_0001203_13201_14217 338
44 3300048928 Ga0496125_0031356 Ga0496125_0031356_3322_4338 338
45 3300048929 Ga0496126_0006087 Ga0496126_0006087_124_1140 338
46 3300053077 Ga0495601_0114222 Ga0495601_0114222_539_1555 338
47 3300053080 Ga0500635_0079914 Ga0500635_0079914_46_1062 338
48 3300053097 Ga0500648_163790 Ga0500648_163790_95_1111 338
49 3300053120 Ga0500597_062864 Ga0500597_062864_433_1449 338
50 3300053140 Ga0500573_0045984 Ga0500573_0045984_674_1690 338
51 3300053162 Ga0500638_025950 Ga0500638_025950_1743_2759 338
52 3300031733 Ga0316577_10034730 Ga0316577_100347303 339
53 3300048929 Ga0496126_0005951 Ga0496126_0005951_1923_2942 339
54 3300048929 Ga0496126_0114840 Ga0496126_0114840_767_1789 339
55 3300053177 Ga0500636_0088668 Ga0500636_0088668_159_1181 339
56 3300037853 Ga0436364_1376026 Ga0436364_1376026_221_1249 340
57 3300039438 Ga0436360_1335800 Ga0436360_1335800_145_1173 340
58 3300037312 Ga0395899_0085555 Ga0395899_0085555_921_1955 341
59 3300037418 Ga0395900_0028161 Ga0395900_0028161_4074_5108 341
60 3300037471 Ga0395905_0103901 Ga0395905_0103901_925_2010 341
61 3300038443 Ga0395901_0016073 Ga0395901_0016073_2870_3904 341
62 3300050507 nmdc:mga05p37_97139_c1 nmdc:mga05p37_97139_c1_1413_2447 341
63 3300005290 Ga0065712_10069472 Ga0065712_100694724 342
64 3300005331 Ga0070670_100021623 Ga0070670_1000216232 342
65 3300005354 Ga0070675_100074553 Ga0070675_1000745533 342
66 3300005543 Ga0070672_100163169 Ga0070672_1001631692 342
67 3300009098 Ga0105245_10006486 Ga0105245_100064867 342
68 3300025908 Ga0207643_10201964 Ga0207643_102019641 342
69 3300025925 Ga0207650_10043930 Ga0207650_100439302 342
70 3300025926 Ga0207659_10065221 Ga0207659_100652213 342
71 iso_pu_bacteria 8055431914 8055434398 342
72 iso_pu_bacteria 2507262055 2507506958 343
73 iso_pu_bacteria 2876808645 2876815078 343
74 iso_pu_bacteria 2879110137 2879117845 343
75 iso_pu_bacteria 2889033259 2889042407 343
76 3300005367 Ga0070667_100074208 Ga0070667_1000742083 344
77 3300005617 Ga0068859_100126724 Ga0068859_1001267244 344
78 3300006931 Ga0097620_100126722 Ga0097620_1001267224 344
79 3300009177 Ga0105248_10075500 Ga0105248_100755002 344
80 3300025986 Ga0207658_10051757 Ga0207658_100517572 344
81 3300038726 Ga0400490_09372 Ga0400490_09372_8626_9660 344
82 3300039062 Ga0400483_234344 Ga0400483_234344_579_1613 344
83 iso_pu_bacteria 2842747753 2842748060 344
84 iso_pu_bacteria 2885429604 2885429766 344
85 iso_pu_bacteria 3007252601 3007256540 344
86 iso_pu_bacteria 3007315729 3007319228 344
87 3300009093 Ga0105240_10001003 Ga0105240_100010039 345
88 3300025913 Ga0207695_10003329 Ga0207695_100033299 345
89 3300047447 Ga0495685_042295 Ga0495685_042295_144_1181 345
90 iso_pu_bacteria 2513237104 2513723875 345
91 iso_pu_bacteria 2643221605 2644037657 345
92 iso_pu_bacteria 3005409236 3005413437 345
93 3300005459 Ga0068867_100187496 Ga0068867_1001874962 346
94 3300005617 Ga0068859_100002443 Ga0068859_10000244313 346
95 3300005718 Ga0068866_10151937 Ga0068866_101519371 346
96 3300005719 Ga0068861_100002019 Ga0068861_1000020197 346
97 3300006173 Ga0070716_100002766 Ga0070716_1000027665 346
98 3300006237 Ga0097621_100185503 Ga0097621_1001855032 346
99 3300006914 Ga0075436_100004459 Ga0075436_1000044596 346
100 3300006931 Ga0097620_100002442 Ga0097620_10000244213 346
101 3300007265 Ga0099794_10000099 Ga0099794_100000993 346
102 3300009177 Ga0105248_10001248 Ga0105248_1000124814 346
103 3300013297 Ga0157378_10030998 Ga0157378_100309985 346
104 3300014968 Ga0157379_10020026 Ga0157379_100200262 346
105 3300025934 Ga0207686_10067125 Ga0207686_100671251 346
106 3300025939 Ga0207665_10010768 Ga0207665_100107682 346
107 3300025941 Ga0207711_10004771 Ga0207711_100047717 346
108 3300026075 Ga0207708_10076058 Ga0207708_100760582 346
109 3300026118 Ga0207675_100001855 Ga0207675_1000018556 346
110 3300027671 Ga0209588_1000276 Ga0209588_100027610 346
111 3300030521 Ga0307511_10110457 Ga0307511_101104572 346
112 3300031241 Ga0265325_10004858 Ga0265325_100048587 346
113 3300031249 Ga0265339_10000109 Ga0265339_1000010933 346
114 3300031507 Ga0307509_10067612 Ga0307509_100676122 346
115 3300031595 Ga0265313_10000257 Ga0265313_1000025722 346
116 3300031730 Ga0307516_10001624 Ga0307516_100016248 346
117 3300035086 Ga0373934_0007036 Ga0373934_0007036_3019_4077 346
118 3300035117 Ga0373953_0004717 Ga0373953_0004717_1087_2145 346
119 3300035118 Ga0373954_0002190 Ga0373954_0002190_6374_7432 346
120 3300035119 Ga0373956_0001065 Ga0373956_0001065_4741_5799 346
121 3300035120 Ga0373957_0001462 Ga0373957_0001462_790_1848 346
122 3300035172 Ga0373955_0066166 Ga0373955_0066166_469_1527 346
123 3300035724 Ga0373933_0002728 Ga0373933_0002728_2225_3283 346
124 3300036401 Ga0373937_0041035 Ga0373937_0041035_2408_3466 346
125 3300046511 Ga0495608_0045480 Ga0495608_0045480_787_1845 346
126 3300046514 Ga0495618_0043761 Ga0495618_0043761_469_1527 346
127 3300046517 Ga0495630_0085356 Ga0495630_0085356_147_1205 346
128 3300046535 Ga0495586_0097074 Ga0495586_0097074_469_1527 346
129 3300046559 Ga0495667_0001884 Ga0495667_0001884_4695_5753 346
130 3300046683 Ga0495658_0017873 Ga0495658_0017873_1788_2846 346
131 3300047317 Ga0495604_0053150 Ga0495604_0053150_790_1848 346
132 3300047322 Ga0495680_0098432 Ga0495680_0098432_375_1433 346
133 3300047471 Ga0495684_0050570 Ga0495684_0050570_423_1481 346
134 3300050514 nmdc:mga08x19_1584_c2 nmdc:mga08x19_1584_c2_4806_5852 346
135 3300053151 Ga0500604_0000202 Ga0500604_0000202_14336_15376 346
136 3300003215 JGI25153J46596_10005349 JGI25153J46596_100053496 347
137 3300005334 Ga0068869_100019772 Ga0068869_1000197724 347
138 3300005338 Ga0068868_100153744 Ga0068868_1001537442 347
139 3300005347 Ga0070668_100091091 Ga0070668_1000910913 347
140 3300005354 Ga0070675_100105580 Ga0070675_1001055803 347
141 3300005367 Ga0070667_100158328 Ga0070667_1001583281 347
142 3300005455 Ga0070663_100034776 Ga0070663_1000347764 347
143 3300005456 Ga0070678_100111276 Ga0070678_1001112762 347
144 3300005539 Ga0068853_100120230 Ga0068853_1001202302 347
145 3300005548 Ga0070665_100038696 Ga0070665_1000386963 347
146 3300005548 Ga0070665_100099053 Ga0070665_1000990533 347
147 3300005563 Ga0068855_100041475 Ga0068855_1000414754 347
148 3300005577 Ga0068857_100021621 Ga0068857_1000216214 347
149 3300005614 Ga0068856_100010813 Ga0068856_1000108135 347
150 3300005616 Ga0068852_100137364 Ga0068852_1001373641 347
151 3300005841 Ga0068863_100155189 Ga0068863_1001551892 347
152 3300005843 Ga0068860_100000135 Ga0068860_10000013596 347
153 3300005843 Ga0068860_100164456 Ga0068860_1001644562 347
154 3300005937 Ga0081455_10001076 Ga0081455_1000107622 347
155 3300005983 Ga0081540_1020469 Ga0081540_10204697 347
156 3300005985 Ga0081539_10014316 Ga0081539_100143165 347
157 3300006237 Ga0097621_100106118 Ga0097621_1001061182 347
158 3300006353 Ga0075370_10039963 Ga0075370_100399632 347
159 3300009093 Ga0105240_10159657 Ga0105240_101596574 347
160 3300009101 Ga0105247_10051820 Ga0105247_100518202 347
161 3300009101 Ga0105247_10066872 Ga0105247_100668722 347
162 3300009147 Ga0114129_10004025 Ga0114129_100040256 347
163 3300009177 Ga0105248_10105859 Ga0105248_101058592 347
164 3300009545 Ga0105237_10003536 Ga0105237_1000353618 347
165 3300010375 Ga0105239_10044997 Ga0105239_100449975 347
166 3300011119 Ga0105246_10015541 Ga0105246_100155413 347
167 3300013296 Ga0157374_10041905 Ga0157374_100419052 347
168 3300013297 Ga0157378_10020587 Ga0157378_100205875 347
169 3300013306 Ga0163162_10030665 Ga0163162_100306652 347
170 3300013306 Ga0163162_10053017 Ga0163162_100530174 347
171 3300013308 Ga0157375_10081980 Ga0157375_100819802 347
172 3300013308 Ga0157375_10115404 Ga0157375_101154043 347
173 3300013308 Ga0157375_10136156 Ga0157375_101361562 347
174 3300014325 Ga0163163_10072699 Ga0163163_100726993 347
175 3300014968 Ga0157379_10029505 Ga0157379_100295055 347
176 3300014969 Ga0157376_10200414 Ga0157376_102004142 347
177 3300025297 Ga0209758_1004855 Ga0209758_10048553 347
178 3300025297 Ga0209758_1011338 Ga0209758_10113385 347
179 3300025900 Ga0207710_10031090 Ga0207710_100310902 347
180 3300025907 Ga0207645_10080773 Ga0207645_100807732 347
181 3300025914 Ga0207671_10013776 Ga0207671_100137763 347
182 3300025914 Ga0207671_10342078 Ga0207671_103420782 347
183 3300025933 Ga0207706_10272437 Ga0207706_102724372 347
184 3300025942 Ga0207689_10001496 Ga0207689_1000149620 347
185 3300025942 Ga0207689_10004614 Ga0207689_100046143 347
186 3300025949 Ga0207667_10054070 Ga0207667_100540704 347
187 3300025972 Ga0207668_10087820 Ga0207668_100878203 347
188 3300025972 Ga0207668_10215945 Ga0207668_102159452 347
189 3300026023 Ga0207677_10123031 Ga0207677_101230313 347
190 3300026023 Ga0207677_10128562 Ga0207677_101285622 347
191 3300026067 Ga0207678_10022586 Ga0207678_100225862 347
192 3300026067 Ga0207678_10181910 Ga0207678_101819102 347
193 3300026088 Ga0207641_10150119 Ga0207641_101501191 347
194 3300026116 Ga0207674_10033963 Ga0207674_100339634 347
195 3300026118 Ga0207675_100081355 Ga0207675_1000813553 347
196 3300026121 Ga0207683_10086757 Ga0207683_100867572 347
197 3300028381 Ga0268264_10000038 Ga0268264_10000038172 347
198 3300028381 Ga0268264_10198098 Ga0268264_101980982 347
199 3300030521 Ga0307511_10123666 Ga0307511_101236661 347
200 3300032126 Ga0307415_100463947 Ga0307415_1004639471 347
201 3300032168 Ga0316593_10000965 Ga0316593_100009655 347
202 3300033179 Ga0307507_10053079 Ga0307507_100530793 347
203 3300035113 Ga0373936_0010325 Ga0373936_0010325_56_1102 347
204 3300035116 Ga0373945_0037585 Ga0373945_0037585_394_1440 347
205 3300035170 Ga0373943_0000592 Ga0373943_0000592_2823_3869 347
206 3300035695 Ga0373927_0021622 Ga0373927_0021622_1058_2104 347
207 3300035695 Ga0373927_0036631 Ga0373927_0036631_935_1981 347
208 3300035725 Ga0373947_0007044 Ga0373947_0007044_4435_5481 347
209 3300037068 Ga0373925_0069110 Ga0373925_0069110_1143_2189 347
210 3300037068 Ga0373925_0246348 Ga0373925_0246348_88_1134 347
211 3300038726 Ga0400490_10463 Ga0400490_10463_2597_3640 347
212 3300038742 Ga0400486_10384 Ga0400486_10384_3135_4178 347
213 3300038742 Ga0400486_17264 Ga0400486_17264_5429_6472 347
214 3300041512 Ga0451853_3003930 Ga0451853_3003930_1003_2049 347
215 3300042876 Ga0451577_0011700 Ga0451577_0011700_3542_4651 347
216 3300044656 Ga0466969_0043481 Ga0466969_0043481_217_1263 347
217 3300044673 Ga0453683_0008486 Ga0453683_0008486_5251_6360 347
218 3300044712 Ga0453684_0007497 Ga0453684_0007497_13392_14501 347
219 3300045051 Ga0451576_0151200 Ga0451576_0151200_761_1870 347
220 3300046472 Ga0495580_0001979 Ga0495580_0001979_3216_4262 347
221 3300046507 Ga0495606_0083994 Ga0495606_0083994_575_1621 347
222 3300046616 Ga0495668_0158027 Ga0495668_0158027_18_1064 347
223 3300047472 Ga0495686_0015635 Ga0495686_0015635_3681_4724 347
224 3300047472 Ga0495686_0157363 Ga0495686_0157363_212_1255 347
225 3300048905 Ga0496102_0025634 Ga0496102_0025634_558_1622 347
226 3300048907 Ga0496104_0264581 Ga0496104_0264581_507_1550 347
227 3300048908 Ga0496105_0003823 Ga0496105_0003823_371_1435 347
228 3300048908 Ga0496105_0211385 Ga0496105_0211385_33_1076 347
229 3300048909 Ga0496106_0000846 Ga0496106_0000846_12631_13677 347
230 3300048909 Ga0496106_0138482 Ga0496106_0138482_585_1649 347
231 3300048909 Ga0496106_0350027 Ga0496106_0350027_89_1135 347
232 3300048915 Ga0496112_0115905 Ga0496112_0115905_387_1451 347
233 3300048916 Ga0496113_0052808 Ga0496113_0052808_1575_2639 347
234 3300048918 Ga0496115_0064804 Ga0496115_0064804_1021_2085 347
235 3300048920 Ga0496117_0014005 Ga0496117_0014005_2646_3692 347
236 3300048921 Ga0496118_0005969 Ga0496118_0005969_8792_9838 347
237 3300048924 Ga0496121_0000099 Ga0496121_0000099_107235_108281 347
238 3300048927 Ga0496124_0004730 Ga0496124_0004730_4227_5273 347
239 3300048928 Ga0496125_0027424 Ga0496125_0027424_949_1995 347
240 3300048929 Ga0496126_0006199 Ga0496126_0006199_7966_9012 347
241 3300049575 Ga0501039_0030462 Ga0501039_0030462_1351_2418 347
242 3300049679 Ga0501249_000339 Ga0501249_000339_9783_10829 347
243 3300050494 nmdc:mga06z11_21431_c1 nmdc:mga06z11_21431_c1_1528_2592 347
244 3300050496 nmdc:mga07m45_33781_c1 nmdc:mga07m45_33781_c1_120_1184 347
245 3300050507 nmdc:mga05p37_2725_c1 nmdc:mga05p37_2725_c1_15782_16828 347
246 3300053080 Ga0500635_0020933 Ga0500635_0020933_815_1861 347
247 3300053091 Ga0500647_0023976 Ga0500647_0023976_1370_2416 347
248 3300053092 Ga0500583_0090130 Ga0500583_0090130_112_1176 347
249 3300053104 Ga0500556_0024720 Ga0500556_0024720_127_1173 347
250 3300053104 Ga0500556_0028003 Ga0500556_0028003_560_1603 347
251 3300053119 Ga0500595_001318 Ga0500595_001318_7632_8729 347
252 3300053119 Ga0500595_002291 Ga0500595_002291_2399_3496 347
253 3300053119 Ga0500595_015008 Ga0500595_015008_1751_2797 347
254 3300053139 Ga0500568_0006551 Ga0500568_0006551_3801_4898 347
255 3300053140 Ga0500573_0005791 Ga0500573_0005791_2225_3271 347
256 3300053147 Ga0500589_093278 Ga0500589_093278_205_1299 347
257 3300053148 Ga0500590_055936 Ga0500590_055936_48_1094 347
258 3300053150 Ga0500603_006556 Ga0500603_006556_227_1273 347
259 3300053153 Ga0500616_0003160 Ga0500616_0003160_4955_6007 347
260 3300053162 Ga0500638_100694 Ga0500638_100694_262_1308 347
261 3300053163 Ga0500639_056580 Ga0500639_056580_691_1737 347
262 3300053177 Ga0500636_0020033 Ga0500636_0020033_2761_3807 347
263 3300053730 Ga0500645_024167 Ga0500645_024167_116_1180 347
264 3300055283 Ga0500661_004008 Ga0500661_004008_1284_2327 347
265 iso_pu_bacteria 2721755755 2723847665 347
266 iso_pu_bacteria 2791355199 2793077808 347
267 iso_pu_bacteria 2876771140 2876773013 347
268 iso_pu_bacteria 2876818435 2876820340 347
269 iso_pu_bacteria 2879074833 2879076469 347
270 iso_pu_bacteria 8006984368 8006990061 347
271 3300003771 Ga0055526_1000017 Ga0055526_100001721 348
272 3300005330 Ga0070690_100005471 Ga0070690_1000054717 348
273 3300005334 Ga0068869_100008842 Ga0068869_1000088422 348
274 3300005334 Ga0068869_100177140 Ga0068869_1001771402 348
275 3300005335 Ga0070666_10027073 Ga0070666_100270733 348
276 3300005336 Ga0070680_100017881 Ga0070680_1000178812 348
277 3300005337 Ga0070682_100052870 Ga0070682_1000528701 348
278 3300005338 Ga0068868_100015499 Ga0068868_1000154995 348
279 3300005340 Ga0070689_100118239 Ga0070689_1001182392 348
280 3300005343 Ga0070687_100001463 Ga0070687_1000014635 348
281 3300005356 Ga0070674_100048107 Ga0070674_1000481072 348
282 3300005440 Ga0070705_100010260 Ga0070705_1000102602 348
283 3300005441 Ga0070700_100293379 Ga0070700_1002933791 348
284 3300005444 Ga0070694_100133710 Ga0070694_1001337102 348
285 3300005458 Ga0070681_10002597 Ga0070681_1000259715 348
286 3300005459 Ga0068867_100002648 Ga0068867_10000264812 348
287 3300005471 Ga0070698_100080822 Ga0070698_1000808222 348
288 3300005518 Ga0070699_100163289 Ga0070699_1001632892 348
289 3300005539 Ga0068853_100227078 Ga0068853_1002270782 348
290 3300005544 Ga0070686_100000843 Ga0070686_1000008437 348
291 3300005545 Ga0070695_100005437 Ga0070695_1000054373 348
292 3300005549 Ga0070704_100012970 Ga0070704_1000129702 348
293 3300005563 Ga0068855_100149646 Ga0068855_1001496462 348
294 3300005614 Ga0068856_100037555 Ga0068856_1000375552 348
295 3300005615 Ga0070702_100146188 Ga0070702_1001461881 348
296 3300005615 Ga0070702_100195130 Ga0070702_1001951301 348
297 3300005616 Ga0068852_100124491 Ga0068852_1001244912 348
298 3300005617 Ga0068859_100030510 Ga0068859_1000305105 348
299 3300005617 Ga0068859_100173518 Ga0068859_1001735182 348
300 3300005618 Ga0068864_100021473 Ga0068864_1000214732 348
301 3300005841 Ga0068863_100468484 Ga0068863_1004684841 348
302 3300005842 Ga0068858_100024427 Ga0068858_1000244272 348
303 3300005843 Ga0068860_100030383 Ga0068860_1000303832 348
304 3300005844 Ga0068862_100006072 Ga0068862_1000060723 348
305 3300005844 Ga0068862_100278844 Ga0068862_1002788442 348
306 3300006237 Ga0097621_100010866 Ga0097621_1000108666 348
307 3300006358 Ga0068871_100219226 Ga0068871_1002192262 348
308 3300006844 Ga0075428_100001613 Ga0075428_1000016138 348
309 3300006852 Ga0075433_10003516 Ga0075433_100035163 348
310 3300006871 Ga0075434_100000732 Ga0075434_1000007327 348
311 3300006871 Ga0075434_100385401 Ga0075434_1003854012 348
312 3300006880 Ga0075429_100000412 Ga0075429_10000041211 348
313 3300006881 Ga0068865_100005519 Ga0068865_1000055195 348
314 3300006914 Ga0075436_100003338 Ga0075436_1000033382 348
315 3300006931 Ga0097620_100030510 Ga0097620_1000305105 348
316 3300006931 Ga0097620_100173509 Ga0097620_1001735092 348
317 3300009094 Ga0111539_10003717 Ga0111539_100037178 348
318 3300009094 Ga0111539_10024276 Ga0111539_100242762 348
319 3300009147 Ga0114129_10002654 Ga0114129_1000265410 348
320 3300009148 Ga0105243_10010440 Ga0105243_100104406 348
321 3300009553 Ga0105249_10005684 Ga0105249_1000568413 348
322 3300010375 Ga0105239_10032969 Ga0105239_100329695 348
323 3300013297 Ga0157378_10011091 Ga0157378_100110912 348
324 3300014969 Ga0157376_10011776 Ga0157376_100117766 348
325 3300021358 Ga0213873_10000018 Ga0213873_10000018134 348
326 3300021384 Ga0213876_10000058 Ga0213876_10000058139 348
327 3300025295 Ga0209564_1000031 Ga0209564_1000031187 348
328 3300025903 Ga0207680_10017535 Ga0207680_100175352 348
329 3300025917 Ga0207660_10004041 Ga0207660_100040416 348
330 3300025918 Ga0207662_10003737 Ga0207662_100037372 348
331 3300025921 Ga0207652_10071205 Ga0207652_100712053 348
332 3300025927 Ga0207687_10007306 Ga0207687_100073063 348
333 3300025935 Ga0207709_10002338 Ga0207709_100023387 348
334 3300025937 Ga0207669_10127603 Ga0207669_101276032 348
335 3300025938 Ga0207704_10119569 Ga0207704_101195692 348
336 3300025942 Ga0207689_10012328 Ga0207689_100123283 348
337 3300025981 Ga0207640_10009053 Ga0207640_100090535 348
338 3300026023 Ga0207677_10043770 Ga0207677_100437702 348
339 3300026035 Ga0207703_10019741 Ga0207703_100197412 348
340 3300026075 Ga0207708_10002744 Ga0207708_100027444 348
341 3300026078 Ga0207702_10222961 Ga0207702_102229612 348
342 3300026089 Ga0207648_10002639 Ga0207648_1000263919 348
343 3300026142 Ga0207698_10190881 Ga0207698_101908812 348
344 3300028380 Ga0268265_10012036 Ga0268265_100120363 348
345 3300028381 Ga0268264_10082198 Ga0268264_100821982 348
346 3300035112 Ga0373932_0007238 Ga0373932_0007238_417_1541 348
347 3300035691 Ga0373931_0019233 Ga0373931_0019233_2060_3157 348
348 3300036647 Ga0316582_0022433 Ga0316582_0022433_2230_3276 348
349 3300037853 Ga0436364_0420422 Ga0436364_0420422_308_1360 348
350 3300038443 Ga0395901_0193283 Ga0395901_0193283_700_1785 348
351 3300038725 Ga0400484_19896 Ga0400484_19896_446_1492 348
352 3300039062 Ga0400483_207311 Ga0400483_207311_401_1450 348
353 3300039437 Ga0436365_0337700 Ga0436365_0337700_38079_39125 348
354 3300039437 Ga0436365_1710345 Ga0436365_1710345_1973_3025 348
355 3300039450 Ga0436363_1527683 Ga0436363_1527683_370_1422 348
356 3300039453 Ga0436362_0011715 Ga0436362_0011715_41480_42526 348
357 3300042876 Ga0451577_0090385 Ga0451577_0090385_438_1484 348
358 3300044712 Ga0453684_0013804 Ga0453684_0013804_6025_7071 348
359 3300044712 Ga0453684_0048547 Ga0453684_0048547_1730_2827 348
360 3300044712 Ga0453684_0070803 Ga0453684_0070803_1635_2681 348
361 3300044712 Ga0453684_0101103 Ga0453684_0101103_43_1089 348
362 3300044712 Ga0453684_0122837 Ga0453684_0122837_1658_2704 348
363 3300044712 Ga0453684_0482815 Ga0453684_0482815_73_1119 348
364 3300045051 Ga0451576_0002498 Ga0451576_0002498_17815_18912 348
365 3300045051 Ga0451576_0004796 Ga0451576_0004796_6823_7920 348
366 3300049587 Ga0501071_0171677 Ga0501071_0171677_325_1410 348
367 3300049822 Ga0501035_0000923 Ga0501035_0000923_27362_28411 348
368 3300050507 nmdc:mga05p37_1800_c1 nmdc:mga05p37_1800_c1_8512_9609 348
369 3300050508 nmdc:mga09592_2740_c1 nmdc:mga09592_2740_c1_10988_12085 348
370 3300050511 nmdc:mga08y16_10425_c1 nmdc:mga08y16_10425_c1_2155_3252 348
371 3300050511 nmdc:mga08y16_164498_c1 nmdc:mga08y16_164498_c1_338_1435 348
372 3300050512 nmdc:mga0n895_3487_c1 nmdc:mga0n895_3487_c1_4137_5234 348
373 3300050514 nmdc:mga08x19_3752_c1 nmdc:mga08x19_3752_c1_854_1951 348
374 3300050515 nmdc:mga0a205_6621_c1 nmdc:mga0a205_6621_c1_4317_5414 348
375 3300001989 JGI24739J22299_10019237 JGI24739J22299_100192372 349
376 3300003322 rootL2_10126575 rootL2_101265755 349
377 3300005331 Ga0070670_100037529 Ga0070670_1000375293 349
378 3300005347 Ga0070668_100050442 Ga0070668_1000504421 349
379 3300005434 Ga0070709_10005175 Ga0070709_100051755 349
380 3300005435 Ga0070714_100079221 Ga0070714_1000792212 349
381 3300005436 Ga0070713_100032165 Ga0070713_1000321653 349
382 3300005439 Ga0070711_100003347 Ga0070711_1000033475 349
383 3300005444 Ga0070694_100011060 Ga0070694_1000110603 349
384 3300005457 Ga0070662_100008235 Ga0070662_1000082352 349
385 3300005457 Ga0070662_100031331 Ga0070662_1000313312 349
386 3300005544 Ga0070686_100261453 Ga0070686_1002614531 349
387 3300005546 Ga0070696_100023352 Ga0070696_1000233522 349
388 3300005547 Ga0070693_100001638 Ga0070693_1000016382 349
389 3300005548 Ga0070665_100000023 Ga0070665_100000023265 349
390 3300005617 Ga0068859_100079852 Ga0068859_1000798522 349
391 3300005842 Ga0068858_100000397 Ga0068858_1000003975 349
392 3300005937 Ga0081455_10027187 Ga0081455_100271872 349
393 3300006173 Ga0070716_100005032 Ga0070716_1000050322 349
394 3300006846 Ga0075430_100125399 Ga0075430_1001253992 349
395 3300006880 Ga0075429_100290464 Ga0075429_1002904642 349
396 3300006931 Ga0097620_100079853 Ga0097620_1000798532 349
397 3300009093 Ga0105240_10007009 Ga0105240_1000700916 349
398 3300009093 Ga0105240_10210614 Ga0105240_102106142 349
399 3300009094 Ga0111539_10220997 Ga0111539_102209972 349
400 3300009098 Ga0105245_10056941 Ga0105245_100569413 349
401 3300009147 Ga0114129_10006442 Ga0114129_1000644212 349
402 3300009148 Ga0105243_10038548 Ga0105243_100385483 349
403 3300009148 Ga0105243_10256907 Ga0105243_102569071 349
404 3300009174 Ga0105241_10060086 Ga0105241_100600863 349
405 3300009177 Ga0105248_10350741 Ga0105248_103507412 349
406 3300009177 Ga0105248_10394199 Ga0105248_103941991 349
407 3300009545 Ga0105237_10000537 Ga0105237_1000053735 349
408 3300010375 Ga0105239_10000037 Ga0105239_1000003755 349
409 3300017792 Ga0163161_10036206 Ga0163161_100362062 349
410 3300025898 Ga0207692_10030555 Ga0207692_100305552 349
411 3300025904 Ga0207647_10004912 Ga0207647_100049129 349
412 3300025911 Ga0207654_10102113 Ga0207654_101021132 349
413 3300025913 Ga0207695_10068690 Ga0207695_100686902 349
414 3300025913 Ga0207695_10109477 Ga0207695_101094772 349
415 3300025914 Ga0207671_10001619 Ga0207671_1000161913 349
416 3300025915 Ga0207693_10014506 Ga0207693_100145066 349
417 3300025928 Ga0207700_10033917 Ga0207700_100339172 349
418 3300025929 Ga0207664_10231655 Ga0207664_102316552 349
419 3300025932 Ga0207690_10297854 Ga0207690_102978542 349
420 3300025933 Ga0207706_10015911 Ga0207706_100159117 349
421 3300025933 Ga0207706_10028964 Ga0207706_100289644 349
422 3300025934 Ga0207686_10041322 Ga0207686_100413222 349
423 3300025935 Ga0207709_10170745 Ga0207709_101707452 349
424 3300025939 Ga0207665_10003717 Ga0207665_100037172 349
425 3300026035 Ga0207703_10001606 Ga0207703_100016062 349
426 3300026075 Ga0207708_10014441 Ga0207708_100144414 349
427 3300026121 Ga0207683_10018973 Ga0207683_100189735 349
428 3300028379 Ga0268266_10000002 Ga0268266_100000021216 349
429 3300031456 Ga0307513_10007695 Ga0307513_100076953 349
430 3300031711 Ga0265314_10052549 Ga0265314_100525493 349
431 3300031903 Ga0307407_10057727 Ga0307407_100577273 349
432 3300031995 Ga0307409_100249371 Ga0307409_1002493712 349
433 3300032002 Ga0307416_100059757 Ga0307416_1000597573 349
434 3300032005 Ga0307411_10002864 Ga0307411_100028646 349
435 3300038726 Ga0400490_39904 Ga0400490_39904_2336_3385 349
436 3300042007 Ga0439449_0012140 Ga0439449_0012140_379_1470 349
437 3300042435 Ga0439434_0006060 Ga0439434_0006060_1991_3082 349
438 3300044659 Ga0466973_0115202 Ga0466973_0115202_979_2049 349
439 3300046460 Ga0495638_0082280 Ga0495638_0082280_188_1276 349
440 3300046461 Ga0495641_0068483 Ga0495641_0068483_60_1127 349
441 3300046491 Ga0495584_0007601 Ga0495584_0007601_527_1615 349
442 3300046515 Ga0495620_0067732 Ga0495620_0067732_367_1455 349
443 3300046519 Ga0495632_0000506 Ga0495632_0000506_9898_10971 349
444 3300046524 Ga0495648_0000357 Ga0495648_0000357_36286_37374 349
445 3300046525 Ga0495663_0001112 Ga0495663_0001112_599_1687 349
446 3300046648 Ga0495611_0099993 Ga0495611_0099993_58_1146 349
447 3300046660 Ga0495625_0010682 Ga0495625_0010682_146_1234 349
448 3300046660 Ga0495625_0104058 Ga0495625_0104058_539_1627 349
449 3300046684 Ga0495669_0000283 Ga0495669_0000283_2092_3180 349
450 3300046810 Ga0495660_0018361 Ga0495660_0018361_527_1615 349
451 3300047323 Ga0495683_0037152 Ga0495683_0037152_789_1877 349
452 3300047443 Ga0495687_000240 Ga0495687_000240_44568_45656 349
453 3300047470 Ga0495681_0005652 Ga0495681_0005652_455_1543 349
454 3300048903 Ga0496100_0006983 Ga0496100_0006983_4864_5949 349
455 3300048904 Ga0496101_0164562 Ga0496101_0164562_66_1151 349
456 3300048905 Ga0496102_0401730 Ga0496102_0401730_40_1125 349
457 3300048909 Ga0496106_0059308 Ga0496106_0059308_111_1196 349
458 3300048910 Ga0496107_0014595 Ga0496107_0014595_656_1741 349
459 3300048912 Ga0496109_0046953 Ga0496109_0046953_2254_3339 349
460 3300048913 Ga0496110_0179147 Ga0496110_0179147_512_1597 349
461 3300048918 Ga0496115_0010674 Ga0496115_0010674_5156_6241 349
462 3300048920 Ga0496117_0031818 Ga0496117_0031818_266_1354 349
463 3300048921 Ga0496118_0042422 Ga0496118_0042422_1856_2944 349
464 3300048924 Ga0496121_0000066 Ga0496121_0000066_146366_147454 349
465 3300048929 Ga0496126_0014718 Ga0496126_0014718_4656_5744 349
466 3300049568 Ga0501031_0049975 Ga0501031_0049975_1422_2474 349
467 3300049573 Ga0501037_0086893 Ga0501037_0086893_1168_2220 349
468 3300049575 Ga0501039_0134661 Ga0501039_0134661_724_1773 349
469 3300049575 Ga0501039_0186886 Ga0501039_0186886_193_1245 349
470 3300049579 Ga0501043_0012347 Ga0501043_0012347_4017_5087 349
471 3300049580 Ga0501046_0015633 Ga0501046_0015633_4933_5985 349
472 3300049581 Ga0501047_0000631 Ga0501047_0000631_29114_30184 349
473 3300049582 Ga0501048_0044434 Ga0501048_0044434_561_1631 349
474 3300049822 Ga0501035_0036200 Ga0501035_0036200_2738_3790 349
475 3300053130 Ga0500642_0002173 Ga0500642_0002173_4270_5358 349
476 3300053730 Ga0500645_000134 Ga0500645_000134_31591_32679 349
477 2162886012 MBSR1b_contig_7679642 MBSR1b_0142.00003770 350
478 3300003215 JGI25153J46596_10004924 JGI25153J46596_100049247 350
479 3300003775 Ga0055524_1006128 Ga0055524_10061282 350
480 3300005290 Ga0065712_10083676 Ga0065712_100836762 350
481 3300005295 Ga0065707_10004727 Ga0065707_100047272 350
482 3300005331 Ga0070670_100106215 Ga0070670_1001062152 350
483 3300005334 Ga0068869_100012376 Ga0068869_1000123762 350
484 3300005336 Ga0070680_100039720 Ga0070680_1000397202 350
485 3300005337 Ga0070682_100005312 Ga0070682_1000053125 350
486 3300005340 Ga0070689_100237666 Ga0070689_1002376662 350
487 3300005341 Ga0070691_10013261 Ga0070691_100132613 350
488 3300005347 Ga0070668_100022086 Ga0070668_1000220862 350
489 3300005353 Ga0070669_100009863 Ga0070669_1000098632 350
490 3300005353 Ga0070669_100282409 Ga0070669_1002824091 350
491 3300005354 Ga0070675_100058611 Ga0070675_1000586113 350
492 3300005354 Ga0070675_100138970 Ga0070675_1001389702 350
493 3300005356 Ga0070674_100000066 Ga0070674_10000006629 350
494 3300005365 Ga0070688_100002786 Ga0070688_1000027865 350
495 3300005434 Ga0070709_10071255 Ga0070709_100712552 350
496 3300005456 Ga0070678_100028047 Ga0070678_1000280473 350
497 3300005457 Ga0070662_100082219 Ga0070662_1000822192 350
498 3300005459 Ga0068867_100029015 Ga0068867_1000290152 350
499 3300005467 Ga0070706_100044651 Ga0070706_1000446514 350
500 3300005468 Ga0070707_100000358 Ga0070707_10000035830 350
501 3300005471 Ga0070698_100137077 Ga0070698_1001370772 350
502 3300005518 Ga0070699_100006108 Ga0070699_1000061087 350
503 3300005536 Ga0070697_100009148 Ga0070697_1000091484 350
504 3300005543 Ga0070672_100008669 Ga0070672_1000086696 350
505 3300005549 Ga0070704_100289666 Ga0070704_1002896662 350
506 3300005578 Ga0068854_100194034 Ga0068854_1001940342 350
507 3300005615 Ga0070702_100023699 Ga0070702_1000236993 350
508 3300005617 Ga0068859_100169306 Ga0068859_1001693062 350
509 3300005719 Ga0068861_100012886 Ga0068861_1000128865 350
510 3300005840 Ga0068870_10009032 Ga0068870_100090324 350
511 3300005843 Ga0068860_100264601 Ga0068860_1002646012 350
512 3300005844 Ga0068862_100022695 Ga0068862_1000226954 350
513 3300005983 Ga0081540_1000590 Ga0081540_100059012 350
514 3300006846 Ga0075430_100004646 Ga0075430_1000046463 350
515 3300006846 Ga0075430_100008951 Ga0075430_1000089512 350
516 3300006846 Ga0075430_100066585 Ga0075430_1000665853 350
517 3300006847 Ga0075431_100006287 Ga0075431_1000062878 350
518 3300006847 Ga0075431_100047009 Ga0075431_1000470094 350
519 3300006847 Ga0075431_100314583 Ga0075431_1003145831 350
520 3300006852 Ga0075433_10280394 Ga0075433_102803942 350
521 3300006880 Ga0075429_100015697 Ga0075429_1000156972 350
522 3300006880 Ga0075429_100077402 Ga0075429_1000774023 350
523 3300006914 Ga0075436_100096668 Ga0075436_1000966683 350
524 3300006931 Ga0097620_100169297 Ga0097620_1001692972 350
525 3300007076 Ga0075435_100241772 Ga0075435_1002417722 350
526 3300009094 Ga0111539_10010980 Ga0111539_100109803 350
527 3300009094 Ga0111539_10015034 Ga0111539_100150344 350
528 3300009147 Ga0114129_10010475 Ga0114129_100104758 350
529 3300009147 Ga0114129_10629056 Ga0114129_106290562 350
530 3300009176 Ga0105242_10003075 Ga0105242_100030755 350
531 3300009553 Ga0105249_10016117 Ga0105249_100161173 350
532 3300010375 Ga0105239_10000537 Ga0105239_1000053715 350
533 3300013105 Ga0157369_10138104 Ga0157369_101381041 350
534 3300013307 Ga0157372_10132975 Ga0157372_101329752 350
535 3300013307 Ga0157372_10749871 Ga0157372_107498711 350
536 3300013308 Ga0157375_10002523 Ga0157375_100025237 350
537 3300014325 Ga0163163_10289498 Ga0163163_102894982 350
538 3300014326 Ga0157380_10000255 Ga0157380_1000025526 350
539 3300014326 Ga0157380_10001701 Ga0157380_100017014 350
540 3300014326 Ga0157380_10018891 Ga0157380_100188913 350
541 3300014745 Ga0157377_10001466 Ga0157377_100014666 350
542 3300025297 Ga0209758_1000628 Ga0209758_100062849 350
543 3300025297 Ga0209758_1043650 Ga0209758_10436502 350
544 3300025298 Ga0209050_1003852 Ga0209050_100385211 350
545 3300025299 Ga0209256_1000071 Ga0209256_1000071223 350
546 3300025315 Ga0207697_10028120 Ga0207697_100281202 350
547 3300025906 Ga0207699_10057359 Ga0207699_100573592 350
548 3300025908 Ga0207643_10008018 Ga0207643_100080182 350
549 3300025908 Ga0207643_10152553 Ga0207643_101525532 350
550 3300025912 Ga0207707_10106187 Ga0207707_101061872 350
551 3300025917 Ga0207660_10046256 Ga0207660_100462564 350
552 3300025918 Ga0207662_10103770 Ga0207662_101037702 350
553 3300025922 Ga0207646_10000008 Ga0207646_10000008438 350
554 3300025922 Ga0207646_10000009 Ga0207646_1000000918 350
555 3300025923 Ga0207681_10070994 Ga0207681_100709942 350
556 3300025923 Ga0207681_10083712 Ga0207681_100837122 350
557 3300025933 Ga0207706_10013072 Ga0207706_100130724 350
558 3300025934 Ga0207686_10008341 Ga0207686_100083412 350
559 3300025936 Ga0207670_10230723 Ga0207670_102307232 350
560 3300025937 Ga0207669_10000554 Ga0207669_100005542 350
561 3300025937 Ga0207669_10002009 Ga0207669_100020093 350
562 3300025940 Ga0207691_10061209 Ga0207691_100612092 350
563 3300025940 Ga0207691_10177190 Ga0207691_101771902 350
564 3300025941 Ga0207711_10016054 Ga0207711_100160542 350
565 3300025942 Ga0207689_10017177 Ga0207689_100171774 350
566 3300025972 Ga0207668_10008963 Ga0207668_100089636 350
567 3300025981 Ga0207640_10262019 Ga0207640_102620192 350
568 3300026067 Ga0207678_10110380 Ga0207678_101103802 350
569 3300026089 Ga0207648_10029681 Ga0207648_100296814 350
570 3300026089 Ga0207648_10042838 Ga0207648_100428382 350
571 3300026118 Ga0207675_100000282 Ga0207675_10000028221 350
572 3300026121 Ga0207683_10094845 Ga0207683_100948452 350
573 3300026121 Ga0207683_10128993 Ga0207683_101289932 350
574 3300027876 Ga0209974_10005986 Ga0209974_100059862 350
575 3300027907 Ga0207428_10049318 Ga0207428_100493184 350
576 3300027907 Ga0207428_10092400 Ga0207428_100924002 350
577 3300028380 Ga0268265_10036681 Ga0268265_100366813 350
578 3300032004 Ga0307414_10085019 Ga0307414_100850193 350
579 3300032004 Ga0307414_10112891 Ga0307414_101128911 350
580 3300032004 Ga0307414_10205215 Ga0307414_102052152 350
581 3300032126 Ga0307415_100153021 Ga0307415_1001530212 350
582 3300035692 Ga0373935_0159320 Ga0373935_0159320_401_1465 350
583 3300035725 Ga0373947_0018618 Ga0373947_0018618_1944_3008 350
584 3300037068 Ga0373925_0180613 Ga0373925_0180613_437_1501 350
585 3300037853 Ga0436364_0459481 Ga0436364_0459481_524_1633 350
586 3300039438 Ga0436360_1061678 Ga0436360_1061678_267_1361 350
587 3300039450 Ga0436363_1599379 Ga0436363_1599379_477_1592 350
588 3300041408 Ga0439453_0002669 Ga0439453_0002669_582_1649 350
589 3300042003 Ga0439443_007424 Ga0439443_007424_243_1310 350
590 3300042436 Ga0439435_0016645 Ga0439435_0016645_158_1225 350
591 3300042439 Ga0439464_0028552 Ga0439464_0028552_16_1116 350
592 3300042876 Ga0451577_0001797 Ga0451577_0001797_1064_2116 350
593 3300044673 Ga0453683_0000931 Ga0453683_0000931_16290_17378 350
594 3300044712 Ga0453684_0000762 Ga0453684_0000762_85499_86551 350
595 3300045051 Ga0451576_0456998 Ga0451576_0456998_210_1271 350
596 3300046663 Ga0495635_0108499 Ga0495635_0108499_825_1880 350
597 3300046674 Ga0495588_0135278 Ga0495588_0135278_233_1285 350
598 3300048907 Ga0496104_0267881 Ga0496104_0267881_395_1495 350
599 3300048911 Ga0496108_0377986 Ga0496108_0377986_98_1210 350
600 3300048912 Ga0496109_0267695 Ga0496109_0267695_115_1206 350
601 3300048915 Ga0496112_0028632 Ga0496112_0028632_3201_4301 350
602 3300048917 Ga0496114_0146755 Ga0496114_0146755_692_1750 350
603 3300049521 Ga0501298_018144 Ga0501298_018144_171_1232 350
604 3300049584 Ga0501068_0092971 Ga0501068_0092971_663_1727 350
605 3300049592 Ga0501076_0072255 Ga0501076_0072255_836_1954 350
606 3300049743 Ga0501081_0106738 Ga0501081_0106738_231_1349 350
607 3300050507 nmdc:mga05p37_319259_c1 nmdc:mga05p37_319259_c1_245_1345 350
608 3300050508 nmdc:mga09592_106430_c1 nmdc:mga09592_106430_c1_137_1198 350
609 3300050509 nmdc:mga0qj67_19373_c1 nmdc:mga0qj67_19373_c1_3232_4332 350
610 3300050509 nmdc:mga0qj67_4545_c1 nmdc:mga0qj67_4545_c1_4851_5912 350
611 3300050511 nmdc:mga08y16_11655_c1 nmdc:mga08y16_11655_c1_7245_8351 350
612 3300050511 nmdc:mga08y16_47350_c1 nmdc:mga08y16_47350_c1_2546_3649 350
613 3300050511 nmdc:mga08y16_57501_c1 nmdc:mga08y16_57501_c1_1276_2343 350
614 3300050511 nmdc:mga08y16_91004_c1 nmdc:mga08y16_91004_c1_988_2040 350
615 3300050512 nmdc:mga0n895_216016_c1 nmdc:mga0n895_216016_c1_394_1458 350
616 3300053085 Ga0495619_0197753 Ga0495619_0197753_141_1196 350
617 3300060353 Ga0501082_0119558 Ga0501082_0119558_800_1918 350

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

39

278

0.87

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

39

161

0.84

PF04321

RmlD_sub_bind

RmlD substrate binding domain

37

305

0.81

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

40

221

0.8

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

40

324

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vo8-assembly1.cif.gz_B-2 x-ray structure of the cj1427 in the presence of nadh and gdp-d-glycero-d-mannoheptose, an essential nad-dependent dehydrogenase from campylobacter jejuni 0.8987 2 312
6vo6-assembly1.cif.gz_C crystal structure of cj1427, an essential nad-dependent dehydrogenase from campylobacter jejuni, in the presence of nadh and gdp 0.8878 2 317
6vo8-assembly1.cif.gz_B-2 x-ray structure of the cj1427 in the presence of nadh and gdp-d-glycero-d-mannoheptose, an essential nad-dependent dehydrogenase from campylobacter jejuni 0.8873 2 312
6b58-assembly1.cif.gz_A frda-sdhe assembly intermediate 0.8829 2 34
3vps-assembly1.cif.gz_A structure of a novel nad dependent-ndp-hexosamine 5,6-dehydratase, tuna, involved in tunicamycin biosynthesis 0.8809 2 319
ID Description Score Start End Superfamily
af_Q9VCA1_7_417_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8927 3 34 3.50.50.60
af_Q2FXA5_5_464_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8874 4 34 3.50.50.60
af_Q10062_1_488_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8858 1 35 3.50.50.60
3lovA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8788 2 35 3.50.50.60
af_Q9N4Z0_27_318_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8509 3 32 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3M0XKG4-F1-model_v4 SDR family oxidoreductase 0.9916 58 348
AF-A0A524KUS2-F1-model_v4 SDR family oxidoreductase 0.9915 52 349
AF-S0FWY1-F1-model_v4 PutativeUDP-glucose 4-epimerase GalE 0.9889 1 349
AF-A0A0N1C9C3-F1-model_v4 NAD-dependent epimerase 0.9884 1 346
AF-A0A3M0XKG4-F1-model_v4 SDR family oxidoreductase 0.9882 58 348

Feature Viewer

pLDDT pTM Quality
94.89 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map