F469650

General Info

Members Datasets Scaffolds Average Seq Length
617 339 566 222

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100475219|Ga0307416_1004752192
Length 225
Sequence MISAAGTGAVLFDLDGTLIDSAPELGAAADQMRTARGLASLPMERYRPMAGAGARGMLGVAFGITPDAPDFPPLREEFFLNYEARMMHTRVFEGVAELVAALCAHGLQWGVVTNKSVRFTEPLTRAMPLFATARAIVSGDTTPYAKPHPEPLFEAARRLGVPPERCIYVGDDERDIIAARAAGMVSIVALWGYRLDEDDPVAWQGDAMFDSPHDLLDTAAWPRRA

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
12 2643221658 Variovorax sp. Root411 Isolate Unclassified
13 2643221672 Variovorax sp. Root434 Isolate Unclassified
14 2643221683 Variovorax sp. Root473 Isolate Unclassified
15 2643221717 Acidovorax sp. Root267 Isolate Unclassified
16 2721755523 Delftia sp. HK171 Isolate Unclassified
17 2738541277 Variovorax sp. GV051 Isolate Unclassified
18 2738541307 Variovorax sp. GV008 Isolate Unclassified
19 2738543012 Acidovorax sp. CF301 Isolate Unclassified
20 2738543013 Variovorax sp. BT01 Isolate Unclassified
21 2738543019 Variovorax sp. GV040 Isolate Unclassified
22 2816332133 Acidovorax radicis 2721A Isolate Unclassified
23 2818991446 Variovorax sp. 1180 Isolate Unclassified
24 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
25 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
26 2842677519 Variovorax sp. R-72495 Isolate Unclassified
27 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
28 2842733646 Variovorax sp. R-72446 Isolate Unclassified
29 2842747753 Variovorax sp. R-72060 Isolate Unclassified
30 2885198086 Variovorax sp. 679 Isolate Unclassified
31 2885211737 Variovorax sp. 553 Isolate Unclassified
32 2899924645 Variovorax sp. 369 Isolate Unclassified
33 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
34 2904456579 Variovorax sp. 2002 Isolate Unclassified
35 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
36 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
37 2928037797 Variovorax sp. 1126 Isolate Unclassified
38 2928044640 Variovorax sp. 1128 Isolate Unclassified
39 2928051484 Variovorax sp. 1133 Isolate Unclassified
40 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
41 2928070936 Variovorax gossypii 1167 Isolate Unclassified
42 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
43 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
44 2929520902 Variovorax beijingensis 502 Isolate Unclassified
45 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
46 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
47 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
48 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
49 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
50 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
51 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
52 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
53 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
54 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
55 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
56 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
57 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
58 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
59 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
60 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
61 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
62 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
63 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
64 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
65 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
66 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
67 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
68 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
69 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
70 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
71 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
72 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
73 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
74 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
75 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
76 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
77 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
78 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
79 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
80 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
81 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
82 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
83 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
84 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
85 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
86 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
87 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
88 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
89 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
90 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
91 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
92 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
93 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
94 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
95 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
96 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
97 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
101 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
102 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
106 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
112 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
113 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
122 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
143 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
144 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
145 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
149 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
150 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
151 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
153 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
154 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
162 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
189 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
191 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
195 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
196 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
197 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
198 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
199 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
200 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
201 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
202 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
207 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
208 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
226 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
227 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
228 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
229 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
230 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
231 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
232 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
233 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
234 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
235 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
236 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
237 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
238 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
239 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
240 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
241 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
242 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
245 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
246 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
247 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
252 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
255 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
256 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
257 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
258 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
259 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
260 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
261 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
262 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
263 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
264 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
265 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
280 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
281 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
284 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
294 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
295 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
299 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
300 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
301 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
302 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
303 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
304 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
305 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
306 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
307 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
308 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
309 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
310 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
311 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
312 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
313 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
314 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
315 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
316 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
317 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
318 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
319 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
320 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
321 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
322 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
323 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
324 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
325 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
326 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
327 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
328 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
329 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
330 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
331 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
332 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
333 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
334 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
335 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
336 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
337 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
338 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
339 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.73
Metatranscriptomes 0
Isolates 8.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 39.71
Nodule 1.3
Rhizoplane 2.59
Rhizosphere 43.44
Stem 0
Stem Tuber 0
Unclassified 12.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10004773 3300001989 Bacteria 5177
2 JGI25155J39150_1000071 3300002704 Bacteria 64384
3 JGI25156J39149_1000071 3300002705 Bacteria 80446
4 JGI25156J39149_1000097 3300002705 Bacteria 64372
5 JGI25154J39366_1000093 3300002738 Bacteria 80476
6 JGI25157J39369_1000088 3300002741 Bacteria 80446
7 JGI25152J39213_1010201 3300002773 Bacteria 2170
8 JGI25150J39212_1008486 3300002774 Bacteria 2007
9 JGI25150J39212_1008525 3300002774 Bacteria 2002
10 JGI25150J39212_1009749 3300002774 Bacteria 1815
11 JGI25150J39212_1011626 3300002774 Bacteria 1587
12 JGI25159J45721_1011197 3300002987 Bacteria 2220
13 JGI25159J45721_1011223 3300002987 Bacteria 2216
14 JGI25159J45721_1012607 3300002987 Bacteria 2007
15 JGI25159J45721_1012612 3300002987 Bacteria 2006
16 JGI25151J46595_10023585 3300003187 Bacteria 2531
17 JGI25151J46595_10036524 3300003187 Bacteria 1853
18 JGI25151J46595_10036575 3300003187 Bacteria 1851
19 JGI25151J46595_10037463 3300003187 Bacteria 1818
20 JGI25151J46595_10044266 3300003187 Bacteria 1583
21 JGI25151J46595_10057314 3300003187 Bacteria 1271
22 JGI25153J46596_10027171 3300003215 Bacteria 2010
23 JGI25153J46596_10027229 3300003215 Bacteria 2007
24 rootH2_10184100 3300003320 Bacteria 1578
25 rootL2_10047727 3300003322 Bacteria 2035
26 rootH1_10051051 3300003323 Bacteria 1325
27 JGI25160J50197_1000059 3300003354 Bacteria 116962
28 JGI25160J50197_1020294 3300003354 Bacteria 2010
29 JGI25160J50197_1020324 3300003354 Bacteria 2007
30 JGI25161J50226_1000008 3300003374 Bacteria 239245
31 JGI25161J50226_1005909 3300003374 Bacteria 2290
32 JGI25161J50226_1007313 3300003374 Bacteria 1869
33 Ga0055535_1000086 3300003761 Bacteria 104327
34 Ga0055542_1000009 3300003762 Bacteria 416550
35 Ga0055526_1021396 3300003771 Bacteria 2252
36 Ga0055526_1021480 3300003771 Bacteria 2244
37 Ga0055526_1024058 3300003771 Bacteria 2007
38 Ga0055526_1024086 3300003771 Bacteria 2006
39 Ga0055537_1010103 3300003773 Bacteria 2016
40 Ga0055537_1010151 3300003773 Bacteria 2007
41 Ga0055537_1012818 3300003773 Bacteria 1612
42 Ga0055524_1000057 3300003775 Bacteria 139566
43 Ga0055524_1023155 3300003775 Bacteria 2007
44 Ga0055536_1003380 3300003781 Bacteria 8610
45 Ga0055536_1023787 3300003781 Bacteria 1792
46 Ga0055534_1008443 3300003784 Bacteria 2332
47 Ga0055534_1008485 3300003784 Bacteria 2321
48 Ga0055534_1008504 3300003784 Bacteria 2317
49 Ga0055534_1008787 3300003784 Bacteria 2256
50 Ga0055528_1000196 3300003790 Bacteria 51284
51 Ga0055528_1023827 3300003790 Bacteria 1853
52 Ga0055528_1023984 3300003790 Bacteria 1843
53 Ga0055528_1024590 3300003790 Bacteria 1801
54 Ga0055530_10003391 3300003791 Bacteria 9100
55 Ga0055530_10022659 3300003791 Bacteria 1822
56 Ga0055530_10030298 3300003791 Bacteria 1435
57 Ga0055540_1000021 3300003792 Bacteria 208733
58 Ga0055540_1000158 3300003792 Bacteria 67050
59 Ga0055540_1001126 3300003792 Bacteria 16702
60 Ga0055540_1005699 3300003792 Bacteria 5146
61 Ga0055540_1015739 3300003792 Bacteria 2184
62 Ga0055540_1020369 3300003792 Bacteria 1755
63 Ga0055540_1037217 3300003792 Bacteria 1074
64 Ga0055531_10000721 3300003794 Bacteria 28144
65 Ga0055531_10001401 3300003794 Bacteria 17848
66 Ga0055531_10030096 3300003794 Bacteria 1833
67 Ga0055531_10030341 3300003794 Bacteria 1818
68 Ga0055531_10034333 3300003794 Bacteria 1612
69 Ga0055543_1000377 3300004625 Bacteria 29295
70 Ga0055543_1005542 3300004625 Bacteria 3204
71 Ga0065165_1021205 3300005262 Bacteria 2263
72 Ga0065165_1027620 3300005262 Bacteria 1845
73 Ga0065165_1027665 3300005262 Bacteria 1843
74 Ga0065165_1035071 3300005262 Bacteria 1544
75 Ga0065165_1051405 3300005262 Bacteria 1168
76 Ga0065165_1068233 3300005262 Bacteria 952
77 Ga0065704_10260257 3300005289 Bacteria 967
78 Ga0068869_100050757 3300005334 Bacteria 3007
79 Ga0068869_100321142 3300005334 Bacteria 1256
80 Ga0070666_10028546 3300005335 Bacteria 3662
81 Ga0070680_100375166 3300005336 Bacteria 1211
82 Ga0068868_100085519 3300005338 Bacteria 2534
83 Ga0070669_100324616 3300005353 Bacteria 1244
84 Ga0070674_100045696 3300005356 Bacteria 2992
85 Ga0070673_100484022 3300005364 Bacteria 1117
86 Ga0070659_100359627 3300005366 Bacteria 1223
87 Ga0070667_100129361 3300005367 Bacteria 2203
88 Ga0070663_100561729 3300005455 Bacteria 955
89 Ga0070678_100041498 3300005456 Bacteria 3262
90 Ga0070678_100454246 3300005456 Bacteria 1123
91 Ga0070662_100213547 3300005457 Bacteria 1536
92 Ga0068867_100211301 3300005459 Bacteria 1558
93 Ga0070706_100357598 3300005467 Bacteria 1361
94 Ga0070679_100200019 3300005530 Bacteria 1965
95 Ga0070679_100364300 3300005530 Bacteria 1393
96 Ga0068853_100143636 3300005539 Bacteria 2143
97 Ga0068853_100147200 3300005539 Bacteria 2117
98 Ga0068853_100270192 3300005539 Bacteria 1565
99 Ga0070665_100145355 3300005548 Bacteria 2374
100 Ga0070665_100661725 3300005548 Bacteria 1057
101 Ga0070665_100742750 3300005548 Bacteria 994
102 Ga0068855_100093597 3300005563 Bacteria 3465
103 Ga0068855_100484772 3300005563 Bacteria 1345
104 Ga0070664_100008915 3300005564 Bacteria 8130
105 Ga0068857_100097172 3300005577 Bacteria 2640
106 Ga0068854_100123927 3300005578 Bacteria 1966
107 Ga0068856_100293805 3300005614 Bacteria 1642
108 Ga0068852_100240902 3300005616 Bacteria 1728
109 Ga0068852_100277879 3300005616 Bacteria 1613
110 Ga0068852_100991902 3300005616 Bacteria 858
111 Ga0068852_101017247 3300005616 Bacteria 847
112 Ga0068859_100314908 3300005617 Bacteria 1659
113 Ga0068851_10004387 3300005834 Bacteria 6356
114 Ga0068863_100052072 3300005841 Bacteria 3880
115 Ga0075365_10015827 3300006038 Bacteria 4570
116 Ga0075365_10103091 3300006038 Bacteria 1955
117 Ga0075368_10038318 3300006042 Bacteria 1876
118 Ga0075363_100047690 3300006048 Bacteria 2276
119 Ga0075363_100071774 3300006048 Bacteria 1882
120 Ga0075363_100146716 3300006048 Bacteria 1330
121 Ga0075364_10020590 3300006051 Bacteria 4149
122 Ga0075432_10002489 3300006058 Bacteria 6121
123 Ga0075432_10031986 3300006058 Bacteria 1822
124 Ga0075362_10033186 3300006177 Bacteria 2244
125 Ga0075362_10059798 3300006177 Bacteria 1721
126 Ga0075362_10119547 3300006177 Bacteria 1246
127 Ga0075362_10126361 3300006177 Bacteria 1213
128 Ga0075367_10130567 3300006178 Bacteria 1553
129 Ga0075367_10306290 3300006178 Bacteria 1000
130 Ga0075366_10055877 3300006195 Bacteria 2344
131 Ga0075366_10071043 3300006195 Bacteria 2074
132 Ga0075366_10083644 3300006195 Bacteria 1907
133 Ga0075366_10096620 3300006195 Bacteria 1771
134 Ga0075366_10167092 3300006195 Bacteria 1334
135 Ga0097621_100107778 3300006237 Bacteria 2351
136 Ga0075370_10075365 3300006353 Bacteria 1934
137 Ga0075370_10085660 3300006353 Bacteria 1814
138 Ga0075370_10085962 3300006353 Bacteria 1811
139 Ga0075370_10273712 3300006353 Bacteria 1002
140 Ga0068871_100021411 3300006358 Bacteria 4968
141 Ga0075428_100110925 3300006844 Bacteria 2989
142 Ga0075436_100560806 3300006914 Bacteria 839
143 Ga0097620_100314920 3300006931 Bacteria 1659
144 Ga0079104_1000277 3300006946 Bacteria 66604
145 Ga0079104_1012759 3300006946 Bacteria 2621
146 Ga0099826_10068528 3300006948 Bacteria 2265
147 Ga0099826_10083338 3300006948 Bacteria 1983
148 Ga0105244_10003432 3300009036 Bacteria 11300
149 Ga0105244_10073700 3300009036 Bacteria 1699
150 Ga0105244_10092187 3300009036 Bacteria 1489
151 Ga0105250_10005094 3300009092 Bacteria 5936
152 Ga0105240_10066401 3300009093 Bacteria 4475
153 Ga0105240_10731554 3300009093 Bacteria 1077
154 Ga0105243_10000420 3300009148 Bacteria 44548
155 Ga0105243_10187185 3300009148 Bacteria 1805
156 Ga0105243_10188577 3300009148 Bacteria 1799
157 Ga0105243_10740708 3300009148 Bacteria 962
158 Ga0105242_10026567 3300009176 Bacteria 4589
159 Ga0105237_10107552 3300009545 Bacteria 2781
160 Ga0105238_10032469 3300009551 Bacteria 5313
161 Ga0105238_10236473 3300009551 Bacteria 1804
162 Ga0105238_10621044 3300009551 Bacteria 1089
163 Ga0105239_10206817 3300010375 Bacteria 2199
164 Ga0105246_10065745 3300011119 Bacteria 2536
165 Ga0157347_1000279 3300012502 Bacteria 3063
166 Ga0157370_10130997 3300013104 Bacteria 2339
167 Ga0157370_10459401 3300013104 Bacteria 1170
168 Ga0157370_10534820 3300013104 Bacteria 1075
169 Ga0157369_10003332 3300013105 Bacteria 19084
170 Ga0157372_10013606 3300013307 Bacteria 8696
171 Ga0157375_10107530 3300013308 Bacteria 2883
172 Ga0182008_10041583 3300014497 Bacteria 2293
173 Ga0182008_10042610 3300014497 Bacteria 2261
174 Ga0182008_10050245 3300014497 Bacteria 2070
175 Ga0182008_10061592 3300014497 Bacteria 1850
176 Ga0157376_10549073 3300014969 Bacteria 1143
177 Ga0157376_10867548 3300014969 Bacteria 919
178 Ga0182006_1011600 3300015261 Bacteria 3875
179 Ga0182006_1028707 3300015261 Bacteria 2260
180 Ga0182006_1118276 3300015261 Bacteria 923
181 Ga0182007_10001722 3300015262 Bacteria 11538
182 Ga0182007_10022270 3300015262 Bacteria 2240
183 Ga0163161_10105183 3300017792 Bacteria 2105
184 Ga0163161_10139317 3300017792 Bacteria 1836
185 Ga0163161_10142490 3300017792 Bacteria 1816
186 Ga0163161_10435890 3300017792 Bacteria 1057
187 Ga0213872_10188579 3300021361 Bacteria 888
188 Ga0209435_100014 3300025206 Bacteria 322129
189 Ga0209436_103641 3300025208 Bacteria 4023
190 Ga0209436_103884 3300025208 Bacteria 3818
191 Ga0209436_111233 3300025208 Bacteria 1585
192 Ga0209672_100400 3300025228 Bacteria 25897
193 Ga0209147_100731 3300025229 Bacteria 16420
194 Ga0209258_100009 3300025242 Bacteria 996276
195 Ga0207425_1001197 3300025245 Bacteria 11498
196 Ga0207425_1002120 3300025245 Bacteria 7296
197 Ga0207425_1011817 3300025245 Bacteria 2067
198 Ga0209646_1000001 3300025246 Bacteria 3092932
199 Ga0209026_1000073 3300025250 Bacteria 205399
200 Ga0209148_1000007 3300025254 Bacteria 1592273
201 Ga0209759_1000013 3300025256 Bacteria 399300
202 Ga0209129_1000013 3300025258 Bacteria 524874
203 Ga0209129_1010585 3300025258 Bacteria 2288
204 Ga0209129_1011213 3300025258 Bacteria 2160
205 Ga0209129_1012606 3300025258 Bacteria 1926
206 Ga0209565_1000028 3300025263 Bacteria 348536
207 Ga0209565_1000058 3300025263 Bacteria 194126
208 Ga0209565_1009358 3300025263 Bacteria 2494
209 Ga0209565_1010542 3300025263 Bacteria 2286
210 Ga0209673_1000035 3300025273 Bacteria 328411
211 Ga0209673_1000053 3300025273 Bacteria 279449
212 Ga0209673_1016945 3300025273 Bacteria 2703
213 Ga0209673_1020946 3300025273 Bacteria 2300
214 Ga0209673_1028270 3300025273 Bacteria 1808
215 Ga0209130_1000052 3300025284 Bacteria 216971
216 Ga0209130_1003992 3300025284 Bacteria 5886
217 Ga0209130_1011012 3300025284 Bacteria 2446
218 Ga0209130_1011519 3300025284 Bacteria 2364
219 Ga0209130_1013186 3300025284 Bacteria 2128
220 Ga0209130_1019487 3300025284 Bacteria 1571
221 Ga0209675_1000584 3300025291 Bacteria 26307
222 Ga0209675_1001521 3300025291 Bacteria 13241
223 Ga0209675_1013839 3300025291 Bacteria 2494
224 Ga0209676_1000069 3300025292 Bacteria 312462
225 Ga0209676_1000368 3300025292 Bacteria 83764
226 Ga0209676_1008144 3300025292 Bacteria 4743
227 Ga0209676_1020687 3300025292 Bacteria 2227
228 Ga0209676_1025459 3300025292 Bacteria 1897
229 Ga0209676_1027699 3300025292 Bacteria 1778
230 Ga0209025_1000910 3300025294 Bacteria 45574
231 Ga0209025_1001889 3300025294 Bacteria 24471
232 Ga0209025_1005670 3300025294 Bacteria 10059
233 Ga0209025_1034454 3300025294 Bacteria 2311
234 Ga0209025_1041583 3300025294 Bacteria 1966
235 Ga0209025_1051918 3300025294 Bacteria 1623
236 Ga0209025_1079744 3300025294 Bacteria 1118
237 Ga0209025_1084400 3300025294 Bacteria 1064
238 Ga0209025_1089845 3300025294 Bacteria 1008
239 Ga0209564_1002752 3300025295 Bacteria 13217
240 Ga0209564_1003199 3300025295 Bacteria 11502
241 Ga0209564_1021583 3300025295 Bacteria 2308
242 Ga0209564_1027362 3300025295 Bacteria 1854
243 Ga0209758_1000067 3300025297 Bacteria 288575
244 Ga0209758_1032763 3300025297 Bacteria 2102
245 Ga0209758_1042571 3300025297 Bacteria 1682
246 Ga0209050_1000002 3300025298 Bacteria 1792849
247 Ga0209050_1000023 3300025298 Bacteria 537172
248 Ga0209050_1003087 3300025298 Bacteria 12799
249 Ga0209050_1023283 3300025298 Bacteria 2185
250 Ga0209050_1029087 3300025298 Bacteria 1776
251 Ga0209050_1055966 3300025298 Bacteria 963
252 Ga0209256_1000003 3300025299 Bacteria 1661127
253 Ga0209256_1000685 3300025299 Bacteria 45616
254 Ga0209256_1000708 3300025299 Bacteria 44349
255 Ga0209256_1028229 3300025299 Bacteria 1587
256 Ga0207426_1000101 3300025302 Bacteria 262096
257 Ga0207426_1000129 3300025302 Bacteria 210930
258 Ga0207426_1000153 3300025302 Bacteria 182839
259 Ga0207426_1024683 3300025302 Bacteria 2037
260 Ga0209051_1000002 3300025303 Bacteria 1631846
261 Ga0209051_1000017 3300025303 Bacteria 537172
262 Ga0209051_1000136 3300025303 Bacteria 138015
263 Ga0209051_1005102 3300025303 Bacteria 7799
264 Ga0209051_1024301 3300025303 Bacteria 2494
265 Ga0209051_1026880 3300025303 Bacteria 2307
266 Ga0209051_1026998 3300025303 Bacteria 2299
267 Ga0209051_1027758 3300025303 Bacteria 2249
268 Ga0209051_1032154 3300025303 Bacteria 2006
269 Ga0209051_1057174 3300025303 Bacteria 1252
270 Ga0209257_1000002 3300025304 Bacteria 1767052
271 Ga0209257_1000041 3300025304 Bacteria 537172
272 Ga0209257_1000055 3300025304 Bacteria 415534
273 Ga0209257_1003692 3300025304 Bacteria 12746
274 Ga0209257_1023043 3300025304 Bacteria 2201
275 Ga0209257_1051966 3300025304 Bacteria 1152
276 Ga0209257_1065362 3300025304 Bacteria 975
277 Ga0207696_1022764 3300025711 Bacteria 1985
278 Ga0207655_1002304 3300025728 Bacteria 15688
279 Ga0207645_10105139 3300025907 Bacteria 1824
280 Ga0207695_10030788 3300025913 Bacteria 5903
281 Ga0207694_10021796 3300025924 Bacteria 4855
282 Ga0207694_10081197 3300025924 Bacteria 2546
283 Ga0207694_10319667 3300025924 Bacteria 1281
284 Ga0207690_10317499 3300025932 Bacteria 1224
285 Ga0207706_10011048 3300025933 Bacteria 8230
286 Ga0207706_10203604 3300025933 Bacteria 1736
287 Ga0207686_10012024 3300025934 Bacteria 4753
288 Ga0207709_10000129 3300025935 Bacteria 111395
289 Ga0207709_10113951 3300025935 Bacteria 1813
290 Ga0207709_10512778 3300025935 Bacteria 938
291 Ga0207669_10308258 3300025937 Bacteria 1206
292 Ga0207689_10225538 3300025942 Bacteria 1549
293 Ga0207689_10250889 3300025942 Bacteria 1463
294 Ga0207679_10060526 3300025945 Bacteria 2814
295 Ga0207667_10411148 3300025949 Bacteria 1377
296 Ga0207667_10616576 3300025949 Bacteria 1093
297 Ga0207677_10138216 3300026023 Bacteria 1861
298 Ga0207639_10072976 3300026041 Bacteria 2689
299 Ga0207639_10235979 3300026041 Bacteria 1588
300 Ga0207641_10041415 3300026088 Bacteria 3860
301 Ga0207648_10194325 3300026089 Bacteria 1799
302 Ga0207676_10127325 3300026095 Bacteria 2159
303 Ga0207674_10495336 3300026116 Bacteria 1181
304 Ga0207683_10099576 3300026121 Bacteria 2594
305 Ga0207683_10926264 3300026121 Bacteria 809
306 Ga0207698_10390935 3300026142 Bacteria 1326
307 Ga0207698_10459656 3300026142 Bacteria 1231
308 Ga0209281_1000067 3300027111 Bacteria 284517
309 Ga0209973_1000995 3300027252 Bacteria 2342
310 Ga0209282_1000719 3300027666 Bacteria 16587
311 Ga0209282_1213601 3300027666 Bacteria 879
312 Ga0209974_10010965 3300027876 Bacteria 3050
313 Ga0268266_10017357 3300028379 Bacteria 6141
314 Ga0268266_10419900 3300028379 Bacteria 1267
315 Ga0268265_10087653 3300028380 Bacteria 2477
316 Ga0307515_10000433 3300028794 Bacteria 100295
317 Ga0307515_10279796 3300028794 Bacteria 1377
318 Ga0307515_10385938 3300028794 Bacteria 1031
319 Ga0307512_10095391 3300030522 Bacteria 2047
320 Ga0316177_1077523 3300030731 Bacteria 1724
321 Ga0316176_1202841 3300030732 Bacteria 4177
322 Ga0314311_1066159 3300030733 Bacteria 2281
323 Ga0316183_1154266 3300030742 Bacteria 1652
324 Ga0316182_1065183 3300030745 Bacteria 1025
325 Ga0316182_1137785 3300030745 Bacteria 2260
326 Ga0265330_10027322 3300031235 Bacteria 2579
327 Ga0265327_10003665 3300031251 Bacteria 14407
328 Ga0307513_10000776 3300031456 Bacteria 46244
329 Ga0307513_10000915 3300031456 Bacteria 42641
330 Ga0307513_10074199 3300031456 Bacteria 3539
331 Ga0307509_10005169 3300031507 Bacteria 18309
332 Ga0307509_10201282 3300031507 Bacteria 1828
333 Ga0307408_100002355 3300031548 Bacteria 13342
334 Ga0307408_100020424 3300031548 Bacteria 4471
335 Ga0307408_100065419 3300031548 Bacteria 2666
336 Ga0307408_100143198 3300031548 Bacteria 1878
337 Ga0307408_100357334 3300031548 Bacteria 1241
338 Ga0307408_100461300 3300031548 Bacteria 1104
339 Ga0307408_100510031 3300031548 Bacteria 1054
340 Ga0307408_100839052 3300031548 Bacteria 837
341 Ga0307508_10299213 3300031616 Bacteria 1202
342 Ga0307514_10000593 3300031649 Bacteria 67957
343 Ga0307514_10037604 3300031649 Bacteria 3836
344 Ga0307514_10160100 3300031649 Bacteria 1492
345 Ga0265314_10001118 3300031711 Bacteria 30992
346 Ga0307516_10383189 3300031730 Bacteria 1067
347 Ga0307516_10472726 3300031730 Bacteria 909
348 Ga0307405_10438418 3300031731 Bacteria 1032
349 Ga0307410_10477739 3300031852 Bacteria 1022
350 Ga0307406_10017052 3300031901 Bacteria 4227
351 Ga0307406_10055509 3300031901 Bacteria 2532
352 Ga0307406_10082572 3300031901 Bacteria 2140
353 Ga0307406_10348354 3300031901 Bacteria 1156
354 Ga0307407_10129719 3300031903 Bacteria 1611
355 Ga0307412_10031418 3300031911 Bacteria 3353
356 Ga0307412_10074369 3300031911 Bacteria 2327
357 Ga0307412_10136335 3300031911 Bacteria 1791
358 Ga0307412_10161613 3300031911 Bacteria 1665
359 Ga0307412_10176028 3300031911 Bacteria 1604
360 Ga0307412_10417833 3300031911 Bacteria 1096
361 Ga0307412_10473117 3300031911 Bacteria 1037
362 Ga0307412_10569239 3300031911 Bacteria 954
363 Ga0307412_10593923 3300031911 Bacteria 936
364 Ga0307412_10878139 3300031911 Bacteria 784
365 Ga0307409_101053518 3300031995 Bacteria 833
366 Ga0307416_100075670 3300032002 Bacteria 2818
367 Ga0307416_100101067 3300032002 Bacteria 2510
368 Ga0307416_100220798 3300032002 Bacteria 1817
369 Ga0307416_100475219 3300032002 Bacteria 1309
370 Ga0307414_10156551 3300032004 Bacteria 1804
371 Ga0307411_10181879 3300032005 Bacteria 1596
372 Ga0307510_10074139 3300033180 Bacteria 3365
373 Ga0395899_0000597 3300037312 Bacteria 37919
374 Ga0395899_0007968 3300037312 Bacteria 8159
375 Ga0395899_0038225 3300037312 Bacteria 3596
376 Ga0395900_0001875 3300037418 Bacteria 23890
377 Ga0395900_0004015 3300037418 Bacteria 15711
378 Ga0395900_0011587 3300037418 Bacteria 9024
379 Ga0395900_0105100 3300037418 Bacteria 2901
380 Ga0395898_0002051 3300037466 Bacteria 25179
381 Ga0395898_0043724 3300037466 Bacteria 4413
382 Ga0395898_0170981 3300037466 Bacteria 2077
383 Ga0395905_0000712 3300037471 Bacteria 43953
384 Ga0395905_0007632 3300037471 Bacteria 10735
385 Ga0395905_0018355 3300037471 Bacteria 6639
386 Ga0395905_0021601 3300037471 Bacteria 6087
387 Ga0395905_0059900 3300037471 Bacteria 3559
388 Ga0395905_0071191 3300037471 Bacteria 3260
389 Ga0395905_0094257 3300037471 Bacteria 2808
390 Ga0395901_0001458 3300038443 Bacteria 24618
391 Ga0395901_0024422 3300038443 Bacteria 6203
392 Ga0395901_0073890 3300038443 Bacteria 3556
393 Ga0395901_0121000 3300038443 Bacteria 2751
394 Ga0395901_0465788 3300038443 Bacteria 1291
395 Ga0395901_0954246 3300038443 Bacteria 836
396 Ga0436361_0911356 3300039447 Bacteria 18775
397 Ga0451789_0923441 3300041443 Bacteria 1265
398 Ga0451791_1344885 3300041451 Bacteria 2554
399 Ga0451797_0383833 3300041453 Bacteria 970
400 Ga0451800_0107670 3300041459 Bacteria 996
401 Ga0439431_0025199 3300041997 Bacteria 1451
402 Ga0439437_002922 3300042000 Bacteria 1841
403 Ga0439442_027650 3300042002 Bacteria 1182
404 Ga0439449_0044121 3300042007 Bacteria 1654
405 Ga0450912_002059 3300042116 Bacteria 1313
406 Ga0450921_000797 3300042123 Bacteria 1676
407 Ga0450923_011658 3300042125 Bacteria 1585
408 Ga0450898_003794 3300042134 Bacteria 2193
409 Ga0450898_027310 3300042134 Bacteria 1032
410 Ga0450906_005736 3300042145 Bacteria 2534
411 Ga0450906_008567 3300042145 Bacteria 1972
412 Ga0439446_0082945 3300042156 Bacteria 995
413 Ga0450908_003269 3300042184 Bacteria 3157
414 Ga0439434_0030202 3300042435 Bacteria 1644
415 Ga0439434_0076402 3300042435 Bacteria 1059
416 Ga0439464_0043800 3300042439 Bacteria 1281
417 Ga0451577_0002278 3300042876 Bacteria 23215
418 Ga0451577_0017221 3300042876 Bacteria 6679
419 Ga0451577_0175528 3300042876 Bacteria 1931
420 Ga0453683_0008743 3300044673 Bacteria 6789
421 Ga0453683_0070019 3300044673 Bacteria 2193
422 Ga0466966_0040194 3300044684 Bacteria 3010
423 Ga0466966_0403673 3300044684 Bacteria 821
424 Ga0466961_0036862 3300044693 Bacteria 3138
425 Ga0453684_0000126 3300044712 Bacteria 336395
426 Ga0453684_0021294 3300044712 Bacteria 9698
427 Ga0453684_0142910 3300044712 Bacteria 2854
428 Ga0451576_0002831 3300045051 Bacteria 24945
429 Ga0451576_1543205 3300045051 Bacteria 689
430 Ga0495627_037615 3300046453 Bacteria 1500
431 Ga0495638_0056719 3300046460 Bacteria 2430
432 Ga0495651_0172320 3300046462 Bacteria 1540
433 Ga0495610_0015672 3300046512 Bacteria 4395
434 Ga0495616_0010987 3300046513 Bacteria 5210
435 Ga0495620_0006458 3300046515 Bacteria 6442
436 Ga0495631_0005311 3300046518 Bacteria 6764
437 Ga0495637_0013010 3300046520 Bacteria 3963
438 Ga0495643_0044115 3300046522 Bacteria 2424
439 Ga0495654_0180836 3300046530 Bacteria 913
440 Ga0495587_0195748 3300046536 Bacteria 1144
441 Ga0495609_0058888 3300046538 Bacteria 1699
442 Ga0495621_0006938 3300046539 Bacteria 3332
443 Ga0495656_0237472 3300046615 Bacteria 917
444 Ga0495668_0057898 3300046616 Bacteria 2139
445 Ga0495625_0033877 3300046660 Bacteria 3772
446 Ga0495625_0071244 3300046660 Bacteria 2439
447 Ga0495625_0110885 3300046660 Bacteria 1875
448 Ga0495661_0058548 3300046665 Bacteria 2296
449 Ga0495588_0095571 3300046674 Bacteria 1558
450 Ga0495588_0097411 3300046674 Bacteria 1543
451 Ga0495588_0175568 3300046674 Bacteria 1132
452 Ga0495588_0178191 3300046674 Bacteria 1123
453 Ga0495670_0039890 3300046691 Bacteria 2342
454 Ga0495671_0020535 3300046692 Bacteria 3479
455 Ga0495593_0009008 3300047673 Bacteria 5792
456 Ga0496101_0237324 3300048904 Bacteria 1418
457 Ga0496102_0008041 3300048905 Bacteria 9019
458 Ga0496103_0026420 3300048906 Bacteria 3515
459 Ga0496105_0032618 3300048908 Bacteria 4275
460 Ga0496106_0356769 3300048909 Bacteria 1174
461 Ga0496107_0072647 3300048910 Bacteria 2501
462 Ga0496110_0294029 3300048913 Bacteria 1479
463 Ga0496111_0042709 3300048914 Bacteria 3256
464 Ga0496114_0030109 3300048917 Bacteria 4464
465 Ga0496116_0071393 3300048919 Bacteria 2198
466 Ga0496116_0086471 3300048919 Bacteria 1923
467 Ga0496116_0239387 3300048919 Bacteria 913
468 Ga0496117_0017623 3300048920 Bacteria 5958
469 Ga0496117_0097847 3300048920 Bacteria 1867
470 Ga0496118_0015823 3300048921 Bacteria 6957
471 Ga0496118_0050127 3300048921 Bacteria 3207
472 Ga0496118_0322062 3300048921 Bacteria 838
473 Ga0496121_0064030 3300048924 Bacteria 3000
474 Ga0496122_0005247 3300048925 Bacteria 15531
475 Ga0496122_0100293 3300048925 Bacteria 1938
476 Ga0496122_0306790 3300048925 Bacteria 852
477 Ga0496123_0064882 3300048926 Bacteria 2324
478 Ga0496123_0181637 3300048926 Bacteria 1098
479 Ga0496123_0213380 3300048926 Bacteria 979
480 Ga0496124_0014526 3300048927 Bacteria 7608
481 Ga0496124_0323830 3300048927 Bacteria 1102
482 Ga0496124_0442147 3300048927 Bacteria 889
483 Ga0496125_0092709 3300048928 Bacteria 2257
484 Ga0496125_0108265 3300048928 Bacteria 2022
485 Ga0501032_0451052 3300049569 Bacteria 824
486 Ga0501034_0044675 3300049571 Bacteria 4479
487 Ga0501038_0154020 3300049574 Bacteria 1873
488 Ga0501043_0179231 3300049579 Bacteria 1651
489 Ga0501046_0047891 3300049580 Bacteria 3387
490 Ga0501047_0050483 3300049581 Bacteria 4017
491 Ga0501238_014219 3300049671 Bacteria 1090
492 Ga0501249_002672 3300049679 Bacteria 3590
493 Ga0501262_000478 3300049759 Bacteria 4771
494 Ga0501035_0060542 3300049822 Bacteria 3370
495 Ga0501035_0759555 3300049822 Bacteria 777
496 Ga0501044_0154695 3300049823 Bacteria 2273
497 nmdc:mga03683_166629_c1 3300050489 Bacteria 1000
498 nmdc:mga03683_33903_c1 3300050489 Bacteria 2064
499 nmdc:mga03683_351109_c1 3300050489 Bacteria 698
500 nmdc:mga03683_99306_c1 3300050489 Bacteria 1278
501 nmdc:mga03n38_12891_c1 3300050490 Bacteria 3161
502 nmdc:mga03n38_260340_c1 3300050490 Bacteria 919
503 nmdc:mga03n38_3046_c1 3300050490 Bacteria 5310
504 nmdc:mga03n38_313132_c1 3300050490 Bacteria 846
505 nmdc:mga03n38_445535_c1 3300050490 Bacteria 719
506 nmdc:mga00v17_9026_c1 3300050491 Bacteria 5380
507 nmdc:mga0yw44_216680_c1 3300050492 Bacteria 1268
508 nmdc:mga0yw44_22583_c1 3300050492 Bacteria 3530
509 nmdc:mga0yw44_98986_c1 3300050492 Bacteria 1855
510 nmdc:mga0k408_107210_c1 3300050493 Bacteria 1650
511 nmdc:mga0k408_11649_c1 3300050493 Bacteria 4793
512 nmdc:mga0k408_12397_c1 3300050493 Bacteria 4660
513 nmdc:mga0k408_134524_c1 3300050493 Bacteria 1468
514 nmdc:mga0k408_43329_c1 3300050493 Bacteria 2593
515 nmdc:mga06z11_233034_c1 3300050494 Bacteria 1079
516 nmdc:mga07m45_18322_c1 3300050496 Bacteria 3777
517 nmdc:mga07m45_193293_c1 3300050496 Bacteria 1184
518 nmdc:mga07m45_53095_c1 3300050496 Bacteria 2290
519 nmdc:mga07m45_90492_c1 3300050496 Bacteria 1753
520 nmdc:mga0sz30_97803_c1 3300050516 Bacteria 1280
521 Ga0500610_0090291 3300053079 Bacteria 1591
522 Ga0500643_008961 3300053087 Bacteria 3870
523 Ga0500644_0005224 3300053088 Bacteria 3270
524 Ga0500651_0001983 3300053093 Bacteria 10616
525 Ga0500651_0018753 3300053093 Bacteria 4286
526 Ga0500566_0040684 3300053094 Bacteria 2687
527 Ga0500650_0084110 3300053098 Bacteria 1488
528 Ga0500660_130803 3300053100 Bacteria 1021
529 Ga0500562_001229 3300053108 Bacteria 6309
530 Ga0500569_065226 3300053109 Bacteria 1134
531 Ga0500571_000029 3300053110 Bacteria 48504
532 Ga0500593_000868 3300053117 Bacteria 11245
533 Ga0500593_001800 3300053117 Bacteria 7701
534 Ga0500594_0006072 3300053118 Bacteria 2701
535 Ga0500594_0017749 3300053118 Bacteria 1745
536 Ga0500607_007923 3300053121 Bacteria 6497
537 Ga0500607_033813 3300053121 Bacteria 2801
538 Ga0500608_028035 3300053122 Bacteria 2656
539 Ga0500626_121724 3300053128 Bacteria 1115
540 Ga0500628_004569 3300053129 Bacteria 2293
541 Ga0500655_000756 3300053133 Bacteria 6410
542 Ga0500658_0001017 3300053134 Bacteria 11442
543 Ga0500559_0011530 3300053136 Bacteria 3775
544 Ga0500559_0018006 3300053136 Bacteria 2985
545 Ga0500559_0076455 3300053136 Bacteria 1515
546 Ga0500559_0088686 3300053136 Bacteria 1414
547 Ga0500561_0011796 3300053137 Bacteria 1847
548 Ga0500564_050435 3300053138 Bacteria 1904
549 Ga0500568_0008663 3300053139 Bacteria 4883
550 Ga0500574_065029 3300053141 Bacteria 1063
551 Ga0500604_0021296 3300053151 Bacteria 1832
552 Ga0500616_0065280 3300053153 Bacteria 1872
553 Ga0500619_041985 3300053154 Bacteria 1449
554 Ga0500627_0001629 3300053158 Bacteria 6341
555 Ga0500633_0051222 3300053160 Bacteria 1425
556 Ga0500634_0005862 3300053161 Bacteria 5886
557 Ga0500634_0050403 3300053161 Bacteria 2242
558 Ga0500638_005007 3300053162 Bacteria 5212
559 Ga0500636_0192398 3300053177 Bacteria 1086
560 Ga0500645_025700 3300053730 Bacteria 1795
561 Ga0500645_026384 3300053730 Bacteria 1767
562 Ga0500645_026978 3300053730 Bacteria 1744
563 Ga0500645_029481 3300053730 Bacteria 1656
564 Ga0500645_079122 3300053730 Bacteria 939
565 Ga0500596_009607 3300053735 Bacteria 1507
566 Ga0500661_005868 3300055283 Bacteria 2288

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050489 nmdc:mga03683_351109_c1 nmdc:mga03683_351109_c1_139_681 180
2 3300045051 Ga0451576_1543205 Ga0451576_1543205_55_633 192
3 3300003322 rootL2_10047727 rootL2_100477272 197
4 iso_pu_bacteria 2838054893 2838055988 210
5 iso_pu_bacteria 2928037797 2928041679 210
6 iso_pu_bacteria 2928044640 2928049243 210
7 iso_pu_bacteria 2928084124 2928089197 210
8 iso_pu_bacteria 2929520902 2929520998 210
9 3300041443 Ga0451789_0923441 Ga0451789_0923441_176_835 214
10 3300046522 Ga0495643_0044115 Ga0495643_0044115_1219_1863 214
11 3300046674 Ga0495588_0095571 Ga0495588_0095571_10_654 214
12 3300053136 Ga0500559_0018006 Ga0500559_0018006_1289_1933 214
13 iso_pu_bacteria 2904479285 2904479761 216
14 3300032002 Ga0307416_100075670 Ga0307416_1000756703 217
15 3300038443 Ga0395901_0954246 Ga0395901_0954246_163_825 217
16 3300049679 Ga0501249_002672 Ga0501249_002672_2322_2975 217
17 3300049759 Ga0501262_000478 Ga0501262_000478_3180_3833 217
18 iso_pu_bacteria 2511231002 2511245148 217
19 iso_pu_bacteria 2547132374 2548501066 217
20 iso_pu_bacteria 2643221717 2644645840 217
21 iso_pu_bacteria 2721755523 2722882810 217
22 iso_pu_bacteria 2831265667 2831271459 217
23 3300005563 Ga0068855_100484772 Ga0068855_1004847722 218
24 3300005614 Ga0068856_100293805 Ga0068856_1002938053 218
25 3300025949 Ga0207667_10616576 Ga0207667_106165762 218
26 iso_pu_bacteria 2513020051 2513227204 218
27 iso_pu_bacteria 2599185214 2599627301 218
28 iso_pu_bacteria 2599185226 2599676716 218
29 iso_pu_bacteria 2599185227 2599679990 218
30 iso_pu_bacteria 2599185229 2599692006 218
31 iso_pu_bacteria 2643221628 2644160390 218
32 iso_pu_bacteria 2643221658 2644324770 218
33 iso_pu_bacteria 2643221672 2644396642 218
34 iso_pu_bacteria 2738541277 2738719677 218
35 iso_pu_bacteria 2738541307 2738879887 218
36 iso_pu_bacteria 2738543013 2739249962 218
37 iso_pu_bacteria 2738543019 2739278876 218
38 iso_pu_bacteria 2818991446 2819599327 218
39 iso_pu_bacteria 2842677519 2842678017 218
40 iso_pu_bacteria 2842733646 2842734517 218
41 iso_pu_bacteria 2842747753 2842749251 218
42 iso_pu_bacteria 2885198086 2885200449 218
43 iso_pu_bacteria 2885211737 2885214768 218
44 iso_pu_bacteria 2899924645 2899925933 218
45 iso_pu_bacteria 2904449895 2904450294 218
46 iso_pu_bacteria 2904456579 2904456884 218
47 iso_pu_bacteria 2919462493 2919463267 218
48 iso_pu_bacteria 2928051484 2928052149 218
49 iso_pu_bacteria 2928064002 2928065171 218
50 iso_pu_bacteria 2928070936 2928076697 218
51 iso_pu_bacteria 2945909444 2945913401 218
52 iso_pu_bacteria 2945945610 2945949029 218
53 iso_pu_bacteria 2945972063 2945973068 218
54 iso_pu_bacteria 2945984333 2945991205 218
55 iso_pu_bacteria 2954767861 2954773081 218
56 3300031548 Ga0307408_100839052 Ga0307408_1008390521 219
57 3300031911 Ga0307412_10176028 Ga0307412_101760282 219
58 3300032002 Ga0307416_100475219 Ga0307416_1004752192 219
59 3300009176 Ga0105242_10026567 Ga0105242_100265671 220
60 3300025934 Ga0207686_10012024 Ga0207686_100120242 220
61 3300037312 Ga0395899_0000597 Ga0395899_0000597_31861_32532 220
62 3300037418 Ga0395900_0001875 Ga0395900_0001875_192_863 220
63 3300037418 Ga0395900_0105100 Ga0395900_0105100_1342_2013 220
64 3300037466 Ga0395898_0002051 Ga0395898_0002051_558_1229 220
65 3300037471 Ga0395905_0018355 Ga0395905_0018355_3568_4239 220
66 3300037471 Ga0395905_0071191 Ga0395905_0071191_1811_2473 220
67 3300038443 Ga0395901_0001458 Ga0395901_0001458_1798_2469 220
68 3300038443 Ga0395901_0121000 Ga0395901_0121000_1050_1721 220
69 3300049822 Ga0501035_0759555 Ga0501035_0759555_52_726 220
70 iso_pu_bacteria 2643221596 2643993486 220
71 iso_pu_bacteria 2643221609 2644062671 220
72 iso_pu_bacteria 2643221611 2644076316 220
73 iso_pu_bacteria 2643221683 2644468860 220
74 iso_pu_bacteria 2842718218 2842719640 220
75 iso_pu_bacteria 2928115317 2928120417 220
76 iso_pu_bacteria 2974320154 2974323708 220
77 iso_pu_bacteria 2990710928 2990712723 220
78 3300002704 JGI25155J39150_1000071 JGI25155J39150_100007114 221
79 3300002705 JGI25156J39149_1000071 JGI25156J39149_100007147 221
80 3300002705 JGI25156J39149_1000097 JGI25156J39149_100009714 221
81 3300002738 JGI25154J39366_1000093 JGI25154J39366_100009347 221
82 3300002741 JGI25157J39369_1000088 JGI25157J39369_100008847 221
83 3300002774 JGI25150J39212_1009749 JGI25150J39212_10097492 221
84 3300002774 JGI25150J39212_1011626 JGI25150J39212_10116262 221
85 3300002987 JGI25159J45721_1011197 JGI25159J45721_10111973 221
86 3300002987 JGI25159J45721_1011223 JGI25159J45721_10112233 221
87 3300003187 JGI25151J46595_10023585 JGI25151J46595_100235853 221
88 3300003187 JGI25151J46595_10044266 JGI25151J46595_100442662 221
89 3300003187 JGI25151J46595_10057314 JGI25151J46595_100573142 221
90 3300003354 JGI25160J50197_1000059 JGI25160J50197_1000059106 221
91 3300003374 JGI25161J50226_1000008 JGI25161J50226_100000852 221
92 3300003771 Ga0055526_1021396 Ga0055526_10213963 221
93 3300003771 Ga0055526_1021480 Ga0055526_10214803 221
94 3300003773 Ga0055537_1012818 Ga0055537_10128181 221
95 3300003775 Ga0055524_1000057 Ga0055524_100005795 221
96 3300003781 Ga0055536_1003380 Ga0055536_10033807 221
97 3300003790 Ga0055528_1000196 Ga0055528_100019632 221
98 3300003791 Ga0055530_10003391 Ga0055530_100033913 221
99 3300003792 Ga0055540_1000021 Ga0055540_100002122 221
100 3300003792 Ga0055540_1000158 Ga0055540_100015842 221
101 3300003792 Ga0055540_1005699 Ga0055540_10056993 221
102 3300003794 Ga0055531_10000721 Ga0055531_100007214 221
103 3300003794 Ga0055531_10001401 Ga0055531_100014011 221
104 3300004625 Ga0055543_1000377 Ga0055543_100037711 221
105 3300005262 Ga0065165_1027620 Ga0065165_10276203 221
106 3300005262 Ga0065165_1027665 Ga0065165_10276653 221
107 3300005262 Ga0065165_1035071 Ga0065165_10350712 221
108 3300005262 Ga0065165_1051405 Ga0065165_10514052 221
109 3300005334 Ga0068869_100050757 Ga0068869_1000507572 221
110 3300005336 Ga0070680_100375166 Ga0070680_1003751662 221
111 3300005338 Ga0068868_100085519 Ga0068868_1000855194 221
112 3300005366 Ga0070659_100359627 Ga0070659_1003596271 221
113 3300005467 Ga0070706_100357598 Ga0070706_1003575982 221
114 3300005530 Ga0070679_100200019 Ga0070679_1002000192 221
115 3300005530 Ga0070679_100364300 Ga0070679_1003643001 221
116 3300005539 Ga0068853_100147200 Ga0068853_1001472001 221
117 3300005548 Ga0070665_100742750 Ga0070665_1007427501 221
118 3300005563 Ga0068855_100093597 Ga0068855_1000935974 221
119 3300005617 Ga0068859_100314908 Ga0068859_1003149082 221
120 3300005841 Ga0068863_100052072 Ga0068863_1000520722 221
121 3300006038 Ga0075365_10103091 Ga0075365_101030913 221
122 3300006051 Ga0075364_10020590 Ga0075364_100205901 221
123 3300006058 Ga0075432_10002489 Ga0075432_100024896 221
124 3300006177 Ga0075362_10119547 Ga0075362_101195471 221
125 3300006195 Ga0075366_10083644 Ga0075366_100836441 221
126 3300006195 Ga0075366_10167092 Ga0075366_101670922 221
127 3300006353 Ga0075370_10273712 Ga0075370_102737121 221
128 3300006844 Ga0075428_100110925 Ga0075428_1001109252 221
129 3300006931 Ga0097620_100314920 Ga0097620_1003149202 221
130 3300006946 Ga0079104_1000277 Ga0079104_100027740 221
131 3300006946 Ga0079104_1012759 Ga0079104_10127593 221
132 3300009092 Ga0105250_10005094 Ga0105250_100050945 221
133 3300009093 Ga0105240_10066401 Ga0105240_100664011 221
134 3300009093 Ga0105240_10731554 Ga0105240_107315542 221
135 3300009148 Ga0105243_10000420 Ga0105243_1000042034 221
136 3300009551 Ga0105238_10032469 Ga0105238_100324694 221
137 3300014969 Ga0157376_10867548 Ga0157376_108675481 221
138 3300021361 Ga0213872_10188579 Ga0213872_101885791 221
139 3300025206 Ga0209435_100014 Ga0209435_100014159 221
140 3300025208 Ga0209436_103641 Ga0209436_1036412 221
141 3300025245 Ga0207425_1002120 Ga0207425_10021204 221
142 3300025246 Ga0209646_1000001 Ga0209646_1000001159 221
143 3300025250 Ga0209026_1000073 Ga0209026_1000073159 221
144 3300025256 Ga0209759_1000013 Ga0209759_1000013159 221
145 3300025258 Ga0209129_1010585 Ga0209129_10105853 221
146 3300025263 Ga0209565_1000028 Ga0209565_1000028187 221
147 3300025263 Ga0209565_1010542 Ga0209565_10105421 221
148 3300025273 Ga0209673_1000035 Ga0209673_1000035148 221
149 3300025273 Ga0209673_1020946 Ga0209673_10209462 221
150 3300025284 Ga0209130_1000052 Ga0209130_100005298 221
151 3300025284 Ga0209130_1011519 Ga0209130_10115191 221
152 3300025291 Ga0209675_1000584 Ga0209675_10005841 221
153 3300025292 Ga0209676_1000069 Ga0209676_1000069275 221
154 3300025292 Ga0209676_1025459 Ga0209676_10254593 221
155 3300025294 Ga0209025_1005670 Ga0209025_10056701 221
156 3300025294 Ga0209025_1041583 Ga0209025_10415833 221
157 3300025294 Ga0209025_1051918 Ga0209025_10519182 221
158 3300025294 Ga0209025_1084400 Ga0209025_10844001 221
159 3300025294 Ga0209025_1089845 Ga0209025_10898452 221
160 3300025295 Ga0209564_1002752 Ga0209564_100275210 221
161 3300025295 Ga0209564_1027362 Ga0209564_10273623 221
162 3300025297 Ga0209758_1042571 Ga0209758_10425711 221
163 3300025298 Ga0209050_1000023 Ga0209050_1000023450 221
164 3300025298 Ga0209050_1023283 Ga0209050_10232831 221
165 3300025298 Ga0209050_1029087 Ga0209050_10290871 221
166 3300025298 Ga0209050_1055966 Ga0209050_10559662 221
167 3300025299 Ga0209256_1000003 Ga0209256_10000031165 221
168 3300025299 Ga0209256_1028229 Ga0209256_10282291 221
169 3300025302 Ga0207426_1000153 Ga0207426_10001532 221
170 3300025302 Ga0207426_1024683 Ga0207426_10246832 221
171 3300025303 Ga0209051_1000017 Ga0209051_1000017450 221
172 3300025303 Ga0209051_1000136 Ga0209051_100013685 221
173 3300025303 Ga0209051_1057174 Ga0209051_10571742 221
174 3300025304 Ga0209257_1000041 Ga0209257_1000041450 221
175 3300025304 Ga0209257_1000055 Ga0209257_1000055268 221
176 3300025304 Ga0209257_1051966 Ga0209257_10519662 221
177 3300025711 Ga0207696_1022764 Ga0207696_10227643 221
178 3300025913 Ga0207695_10030788 Ga0207695_100307885 221
179 3300025932 Ga0207690_10317499 Ga0207690_103174991 221
180 3300025935 Ga0207709_10000129 Ga0207709_1000012948 221
181 3300025942 Ga0207689_10225538 Ga0207689_102255382 221
182 3300025949 Ga0207667_10411148 Ga0207667_104111482 221
183 3300026023 Ga0207677_10138216 Ga0207677_101382162 221
184 3300026088 Ga0207641_10041415 Ga0207641_100414152 221
185 3300026095 Ga0207676_10127325 Ga0207676_101273252 221
186 3300027111 Ga0209281_1000067 Ga0209281_100006739 221
187 3300027252 Ga0209973_1000995 Ga0209973_10009952 221
188 3300027876 Ga0209974_10010965 Ga0209974_100109653 221
189 3300028379 Ga0268266_10419900 Ga0268266_104199002 221
190 3300028794 Ga0307515_10000433 Ga0307515_1000043390 221
191 3300028794 Ga0307515_10279796 Ga0307515_102797962 221
192 3300028794 Ga0307515_10385938 Ga0307515_103859381 221
193 3300031235 Ga0265330_10027322 Ga0265330_100273221 221
194 3300031456 Ga0307513_10000776 Ga0307513_1000077636 221
195 3300031456 Ga0307513_10000915 Ga0307513_100009153 221
196 3300031456 Ga0307513_10074199 Ga0307513_100741994 221
197 3300031548 Ga0307408_100002355 Ga0307408_1000023553 221
198 3300031548 Ga0307408_100020424 Ga0307408_1000204244 221
199 3300031548 Ga0307408_100357334 Ga0307408_1003573341 221
200 3300031548 Ga0307408_100510031 Ga0307408_1005100311 221
201 3300031649 Ga0307514_10000593 Ga0307514_100005939 221
202 3300031711 Ga0265314_10001118 Ga0265314_100011188 221
203 3300031730 Ga0307516_10383189 Ga0307516_103831892 221
204 3300031730 Ga0307516_10472726 Ga0307516_104727262 221
205 3300031901 Ga0307406_10017052 Ga0307406_100170524 221
206 3300031901 Ga0307406_10082572 Ga0307406_100825723 221
207 3300031911 Ga0307412_10161613 Ga0307412_101616133 221
208 3300031911 Ga0307412_10417833 Ga0307412_104178331 221
209 3300031911 Ga0307412_10569239 Ga0307412_105692392 221
210 3300032002 Ga0307416_100101067 Ga0307416_1001010673 221
211 3300037312 Ga0395899_0007968 Ga0395899_0007968_6937_7611 221
212 3300037312 Ga0395899_0038225 Ga0395899_0038225_2346_3020 221
213 3300037418 Ga0395900_0004015 Ga0395900_0004015_7656_8330 221
214 3300037418 Ga0395900_0011587 Ga0395900_0011587_4215_4889 221
215 3300037466 Ga0395898_0043724 Ga0395898_0043724_2248_2922 221
216 3300037466 Ga0395898_0170981 Ga0395898_0170981_827_1501 221
217 3300037471 Ga0395905_0000712 Ga0395905_0000712_9606_10280 221
218 3300037471 Ga0395905_0007632 Ga0395905_0007632_9367_10041 221
219 3300037471 Ga0395905_0021601 Ga0395905_0021601_4516_5190 221
220 3300037471 Ga0395905_0059900 Ga0395905_0059900_1863_2537 221
221 3300037471 Ga0395905_0094257 Ga0395905_0094257_1227_1901 221
222 3300038443 Ga0395901_0024422 Ga0395901_0024422_4300_4974 221
223 3300038443 Ga0395901_0073890 Ga0395901_0073890_2334_3008 221
224 3300038443 Ga0395901_0465788 Ga0395901_0465788_411_1085 221
225 3300039447 Ga0436361_0911356 Ga0436361_0911356_8108_8773 221
226 3300041451 Ga0451791_1344885 Ga0451791_1344885_808_1473 221
227 3300041459 Ga0451800_0107670 Ga0451800_0107670_204_869 221
228 3300042000 Ga0439437_002922 Ga0439437_002922_345_1019 221
229 3300042007 Ga0439449_0044121 Ga0439449_0044121_389_1063 221
230 3300042116 Ga0450912_002059 Ga0450912_002059_100_783 221
231 3300042125 Ga0450923_011658 Ga0450923_011658_798_1463 221
232 3300042134 Ga0450898_003794 Ga0450898_003794_376_1050 221
233 3300042156 Ga0439446_0082945 Ga0439446_0082945_110_784 221
234 3300042435 Ga0439434_0076402 Ga0439434_0076402_54_728 221
235 3300042439 Ga0439464_0043800 Ga0439464_0043800_29_703 221
236 3300042876 Ga0451577_0017221 Ga0451577_0017221_1171_1854 221
237 3300042876 Ga0451577_0175528 Ga0451577_0175528_1154_1837 221
238 3300044673 Ga0453683_0008743 Ga0453683_0008743_5664_6347 221
239 3300044673 Ga0453683_0070019 Ga0453683_0070019_391_1065 221
240 3300044684 Ga0466966_0040194 Ga0466966_0040194_2214_2888 221
241 3300044684 Ga0466966_0403673 Ga0466966_0403673_68_742 221
242 3300044693 Ga0466961_0036862 Ga0466961_0036862_2388_3062 221
243 3300044712 Ga0453684_0021294 Ga0453684_0021294_4854_5537 221
244 3300044712 Ga0453684_0142910 Ga0453684_0142910_2069_2752 221
245 3300045051 Ga0451576_0002831 Ga0451576_0002831_15130_15813 221
246 3300048919 Ga0496116_0071393 Ga0496116_0071393_636_1301 221
247 3300048924 Ga0496121_0064030 Ga0496121_0064030_1072_1737 221
248 3300048926 Ga0496123_0213380 Ga0496123_0213380_167_832 221
249 3300049569 Ga0501032_0451052 Ga0501032_0451052_20_694 221
250 3300049571 Ga0501034_0044675 Ga0501034_0044675_693_1367 221
251 3300049574 Ga0501038_0154020 Ga0501038_0154020_663_1337 221
252 3300049579 Ga0501043_0179231 Ga0501043_0179231_458_1132 221
253 3300049580 Ga0501046_0047891 Ga0501046_0047891_1706_2380 221
254 3300049581 Ga0501047_0050483 Ga0501047_0050483_1233_1907 221
255 3300049822 Ga0501035_0060542 Ga0501035_0060542_2144_2818 221
256 3300049823 Ga0501044_0154695 Ga0501044_0154695_805_1479 221
257 3300050490 nmdc:mga03n38_260340_c1 nmdc:mga03n38_260340_c1_59_733 221
258 3300050492 nmdc:mga0yw44_216680_c1 nmdc:mga0yw44_216680_c1_426_1100 221
259 3300050492 nmdc:mga0yw44_98986_c1 nmdc:mga0yw44_98986_c1_510_1184 221
260 3300050493 nmdc:mga0k408_107210_c1 nmdc:mga0k408_107210_c1_385_1059 221
261 3300053088 Ga0500644_0005224 Ga0500644_0005224_2427_3092 221
262 3300053093 Ga0500651_0018753 Ga0500651_0018753_2615_3280 221
263 3300053098 Ga0500650_0084110 Ga0500650_0084110_582_1247 221
264 3300053100 Ga0500660_130803 Ga0500660_130803_253_918 221
265 3300053108 Ga0500562_001229 Ga0500562_001229_4474_5148 221
266 3300053109 Ga0500569_065226 Ga0500569_065226_360_1037 221
267 3300053117 Ga0500593_000868 Ga0500593_000868_8675_9340 221
268 3300053129 Ga0500628_004569 Ga0500628_004569_652_1317 221
269 3300053136 Ga0500559_0088686 Ga0500559_0088686_320_1009 221
270 3300053151 Ga0500604_0021296 Ga0500604_0021296_953_1618 221
271 3300053153 Ga0500616_0065280 Ga0500616_0065280_348_1025 221
272 3300053177 Ga0500636_0192398 Ga0500636_0192398_349_1026 221
273 3300053730 Ga0500645_025700 Ga0500645_025700_931_1596 221
274 3300053730 Ga0500645_026384 Ga0500645_026384_187_852 221
275 3300053730 Ga0500645_026978 Ga0500645_026978_880_1545 221
276 3300053730 Ga0500645_029481 Ga0500645_029481_914_1579 221
277 3300053730 Ga0500645_079122 Ga0500645_079122_257_922 221
278 3300055283 Ga0500661_005868 Ga0500661_005868_1285_1950 221
279 iso_pu_bacteria 2738543012 2739244646 221
280 iso_pu_bacteria 2816332133 2816475150 221
281 3300001989 JGI24739J22299_10004773 JGI24739J22299_100047734 222
282 3300002773 JGI25152J39213_1010201 JGI25152J39213_10102011 222
283 3300002774 JGI25150J39212_1008486 JGI25150J39212_10084861 222
284 3300002774 JGI25150J39212_1008525 JGI25150J39212_10085251 222
285 3300002987 JGI25159J45721_1012607 JGI25159J45721_10126071 222
286 3300002987 JGI25159J45721_1012612 JGI25159J45721_10126123 222
287 3300003187 JGI25151J46595_10036524 JGI25151J46595_100365243 222
288 3300003187 JGI25151J46595_10036575 JGI25151J46595_100365751 222
289 3300003187 JGI25151J46595_10037463 JGI25151J46595_100374633 222
290 3300003215 JGI25153J46596_10027171 JGI25153J46596_100271713 222
291 3300003215 JGI25153J46596_10027229 JGI25153J46596_100272293 222
292 3300003320 rootH2_10184100 rootH2_101841002 222
293 3300003323 rootH1_10051051 rootH1_100510512 222
294 3300003354 JGI25160J50197_1020294 JGI25160J50197_10202943 222
295 3300003354 JGI25160J50197_1020324 JGI25160J50197_10203243 222
296 3300003374 JGI25161J50226_1005909 JGI25161J50226_10059093 222
297 3300003374 JGI25161J50226_1007313 JGI25161J50226_10073133 222
298 3300003761 Ga0055535_1000086 Ga0055535_100008693 222
299 3300003762 Ga0055542_1000009 Ga0055542_1000009255 222
300 3300003771 Ga0055526_1024058 Ga0055526_10240583 222
301 3300003771 Ga0055526_1024086 Ga0055526_10240863 222
302 3300003773 Ga0055537_1010103 Ga0055537_10101031 222
303 3300003773 Ga0055537_1010151 Ga0055537_10101513 222
304 3300003775 Ga0055524_1023155 Ga0055524_10231551 222
305 3300003781 Ga0055536_1023787 Ga0055536_10237873 222
306 3300003784 Ga0055534_1008443 Ga0055534_10084432 222
307 3300003784 Ga0055534_1008485 Ga0055534_10084853 222
308 3300003784 Ga0055534_1008504 Ga0055534_10085043 222
309 3300003784 Ga0055534_1008787 Ga0055534_10087873 222
310 3300003790 Ga0055528_1023827 Ga0055528_10238273 222
311 3300003790 Ga0055528_1023984 Ga0055528_10239841 222
312 3300003790 Ga0055528_1024590 Ga0055528_10245903 222
313 3300003791 Ga0055530_10022659 Ga0055530_100226592 222
314 3300003791 Ga0055530_10030298 Ga0055530_100302982 222
315 3300003792 Ga0055540_1001126 Ga0055540_10011263 222
316 3300003792 Ga0055540_1015739 Ga0055540_10157393 222
317 3300003792 Ga0055540_1020369 Ga0055540_10203693 222
318 3300003792 Ga0055540_1037217 Ga0055540_10372172 222
319 3300003794 Ga0055531_10030096 Ga0055531_100300963 222
320 3300003794 Ga0055531_10030341 Ga0055531_100303413 222
321 3300003794 Ga0055531_10034333 Ga0055531_100343332 222
322 3300004625 Ga0055543_1005542 Ga0055543_10055421 222
323 3300005262 Ga0065165_1021205 Ga0065165_10212051 222
324 3300005262 Ga0065165_1068233 Ga0065165_10682331 222
325 3300005289 Ga0065704_10260257 Ga0065704_102602571 222
326 3300005334 Ga0068869_100321142 Ga0068869_1003211421 222
327 3300005335 Ga0070666_10028546 Ga0070666_100285462 222
328 3300005353 Ga0070669_100324616 Ga0070669_1003246161 222
329 3300005356 Ga0070674_100045696 Ga0070674_1000456964 222
330 3300005364 Ga0070673_100484022 Ga0070673_1004840222 222
331 3300005367 Ga0070667_100129361 Ga0070667_1001293612 222
332 3300005455 Ga0070663_100561729 Ga0070663_1005617291 222
333 3300005456 Ga0070678_100041498 Ga0070678_1000414981 222
334 3300005456 Ga0070678_100454246 Ga0070678_1004542461 222
335 3300005457 Ga0070662_100213547 Ga0070662_1002135472 222
336 3300005459 Ga0068867_100211301 Ga0068867_1002113011 222
337 3300005539 Ga0068853_100143636 Ga0068853_1001436363 222
338 3300005539 Ga0068853_100270192 Ga0068853_1002701922 222
339 3300005548 Ga0070665_100145355 Ga0070665_1001453553 222
340 3300005548 Ga0070665_100661725 Ga0070665_1006617252 222
341 3300005564 Ga0070664_100008915 Ga0070664_1000089153 222
342 3300005577 Ga0068857_100097172 Ga0068857_1000971723 222
343 3300005578 Ga0068854_100123927 Ga0068854_1001239273 222
344 3300005616 Ga0068852_100240902 Ga0068852_1002409022 222
345 3300005616 Ga0068852_100277879 Ga0068852_1002778792 222
346 3300005616 Ga0068852_100991902 Ga0068852_1009919022 222
347 3300005616 Ga0068852_101017247 Ga0068852_1010172471 222
348 3300005834 Ga0068851_10004387 Ga0068851_100043873 222
349 3300006038 Ga0075365_10015827 Ga0075365_100158273 222
350 3300006042 Ga0075368_10038318 Ga0075368_100383182 222
351 3300006048 Ga0075363_100047690 Ga0075363_1000476901 222
352 3300006048 Ga0075363_100071774 Ga0075363_1000717743 222
353 3300006048 Ga0075363_100146716 Ga0075363_1001467161 222
354 3300006058 Ga0075432_10031986 Ga0075432_100319863 222
355 3300006177 Ga0075362_10033186 Ga0075362_100331861 222
356 3300006177 Ga0075362_10059798 Ga0075362_100597981 222
357 3300006177 Ga0075362_10126361 Ga0075362_101263612 222
358 3300006178 Ga0075367_10130567 Ga0075367_101305672 222
359 3300006178 Ga0075367_10306290 Ga0075367_103062901 222
360 3300006195 Ga0075366_10055877 Ga0075366_100558773 222
361 3300006195 Ga0075366_10071043 Ga0075366_100710431 222
362 3300006195 Ga0075366_10096620 Ga0075366_100966201 222
363 3300006237 Ga0097621_100107778 Ga0097621_1001077783 222
364 3300006353 Ga0075370_10075365 Ga0075370_100753651 222
365 3300006353 Ga0075370_10085660 Ga0075370_100856601 222
366 3300006353 Ga0075370_10085962 Ga0075370_100859621 222
367 3300006358 Ga0068871_100021411 Ga0068871_1000214115 222
368 3300006914 Ga0075436_100560806 Ga0075436_1005608062 222
369 3300006948 Ga0099826_10068528 Ga0099826_100685281 222
370 3300006948 Ga0099826_10083338 Ga0099826_100833381 222
371 3300009036 Ga0105244_10003432 Ga0105244_100034321 222
372 3300009036 Ga0105244_10073700 Ga0105244_100737002 222
373 3300009036 Ga0105244_10092187 Ga0105244_100921872 222
374 3300009148 Ga0105243_10187185 Ga0105243_101871851 222
375 3300009148 Ga0105243_10188577 Ga0105243_101885771 222
376 3300009148 Ga0105243_10740708 Ga0105243_107407081 222
377 3300009545 Ga0105237_10107552 Ga0105237_101075522 222
378 3300009551 Ga0105238_10236473 Ga0105238_102364731 222
379 3300009551 Ga0105238_10621044 Ga0105238_106210441 222
380 3300010375 Ga0105239_10206817 Ga0105239_102068173 222
381 3300011119 Ga0105246_10065745 Ga0105246_100657451 222
382 3300012502 Ga0157347_1000279 Ga0157347_10002794 222
383 3300013104 Ga0157370_10130997 Ga0157370_101309971 222
384 3300013104 Ga0157370_10459401 Ga0157370_104594011 222
385 3300013104 Ga0157370_10534820 Ga0157370_105348202 222
386 3300013105 Ga0157369_10003332 Ga0157369_100033326 222
387 3300013307 Ga0157372_10013606 Ga0157372_1001360610 222
388 3300013308 Ga0157375_10107530 Ga0157375_101075302 222
389 3300014497 Ga0182008_10041583 Ga0182008_100415833 222
390 3300014497 Ga0182008_10042610 Ga0182008_100426103 222
391 3300014497 Ga0182008_10050245 Ga0182008_100502453 222
392 3300014497 Ga0182008_10061592 Ga0182008_100615923 222
393 3300014969 Ga0157376_10549073 Ga0157376_105490732 222
394 3300015261 Ga0182006_1011600 Ga0182006_10116002 222
395 3300015261 Ga0182006_1028707 Ga0182006_10287071 222
396 3300015261 Ga0182006_1118276 Ga0182006_11182762 222
397 3300015262 Ga0182007_10001722 Ga0182007_100017223 222
398 3300015262 Ga0182007_10022270 Ga0182007_100222701 222
399 3300017792 Ga0163161_10105183 Ga0163161_101051832 222
400 3300017792 Ga0163161_10139317 Ga0163161_101393173 222
401 3300017792 Ga0163161_10142490 Ga0163161_101424903 222
402 3300017792 Ga0163161_10435890 Ga0163161_104358902 222
403 3300025208 Ga0209436_103884 Ga0209436_1038843 222
404 3300025208 Ga0209436_111233 Ga0209436_1112332 222
405 3300025228 Ga0209672_100400 Ga0209672_10040019 222
406 3300025229 Ga0209147_100731 Ga0209147_1007316 222
407 3300025242 Ga0209258_100009 Ga0209258_100009397 222
408 3300025245 Ga0207425_1001197 Ga0207425_100119710 222
409 3300025245 Ga0207425_1011817 Ga0207425_10118173 222
410 3300025254 Ga0209148_1000007 Ga0209148_1000007397 222
411 3300025258 Ga0209129_1000013 Ga0209129_1000013223 222
412 3300025258 Ga0209129_1011213 Ga0209129_10112133 222
413 3300025258 Ga0209129_1012606 Ga0209129_10126063 222
414 3300025263 Ga0209565_1000058 Ga0209565_1000058183 222
415 3300025263 Ga0209565_1009358 Ga0209565_10093581 222
416 3300025273 Ga0209673_1000053 Ga0209673_1000053259 222
417 3300025273 Ga0209673_1016945 Ga0209673_10169453 222
418 3300025273 Ga0209673_1028270 Ga0209673_10282701 222
419 3300025284 Ga0209130_1003992 Ga0209130_10039922 222
420 3300025284 Ga0209130_1011012 Ga0209130_10110121 222
421 3300025284 Ga0209130_1013186 Ga0209130_10131863 222
422 3300025284 Ga0209130_1019487 Ga0209130_10194872 222
423 3300025291 Ga0209675_1001521 Ga0209675_10015216 222
424 3300025291 Ga0209675_1013839 Ga0209675_10138391 222
425 3300025292 Ga0209676_1000368 Ga0209676_100036840 222
426 3300025292 Ga0209676_1008144 Ga0209676_10081443 222
427 3300025292 Ga0209676_1020687 Ga0209676_10206873 222
428 3300025292 Ga0209676_1027699 Ga0209676_10276993 222
429 3300025294 Ga0209025_1000910 Ga0209025_100091044 222
430 3300025294 Ga0209025_1001889 Ga0209025_100188910 222
431 3300025294 Ga0209025_1034454 Ga0209025_10344541 222
432 3300025294 Ga0209025_1079744 Ga0209025_10797442 222
433 3300025295 Ga0209564_1003199 Ga0209564_100319910 222
434 3300025295 Ga0209564_1021583 Ga0209564_10215833 222
435 3300025297 Ga0209758_1000067 Ga0209758_100006732 222
436 3300025297 Ga0209758_1032763 Ga0209758_10327633 222
437 3300025298 Ga0209050_1000002 Ga0209050_1000002510 222
438 3300025298 Ga0209050_1003087 Ga0209050_100308712 222
439 3300025299 Ga0209256_1000685 Ga0209256_10006851 222
440 3300025299 Ga0209256_1000708 Ga0209256_10007081 222
441 3300025302 Ga0207426_1000101 Ga0207426_1000101223 222
442 3300025302 Ga0207426_1000129 Ga0207426_1000129204 222
443 3300025303 Ga0209051_1000002 Ga0209051_1000002278 222
444 3300025303 Ga0209051_1005102 Ga0209051_10051023 222
445 3300025303 Ga0209051_1024301 Ga0209051_10243011 222
446 3300025303 Ga0209051_1026880 Ga0209051_10268803 222
447 3300025303 Ga0209051_1026998 Ga0209051_10269981 222
448 3300025303 Ga0209051_1027758 Ga0209051_10277583 222
449 3300025303 Ga0209051_1032154 Ga0209051_10321543 222
450 3300025304 Ga0209257_1000002 Ga0209257_1000002419 222
451 3300025304 Ga0209257_1003692 Ga0209257_10036924 222
452 3300025304 Ga0209257_1023043 Ga0209257_10230433 222
453 3300025304 Ga0209257_1065362 Ga0209257_10653622 222
454 3300025728 Ga0207655_1002304 Ga0207655_10023048 222
455 3300025907 Ga0207645_10105139 Ga0207645_101051392 222
456 3300025924 Ga0207694_10021796 Ga0207694_100217964 222
457 3300025924 Ga0207694_10081197 Ga0207694_100811974 222
458 3300025924 Ga0207694_10319667 Ga0207694_103196671 222
459 3300025933 Ga0207706_10011048 Ga0207706_100110484 222
460 3300025933 Ga0207706_10203604 Ga0207706_102036043 222
461 3300025935 Ga0207709_10113951 Ga0207709_101139513 222
462 3300025935 Ga0207709_10512778 Ga0207709_105127781 222
463 3300025937 Ga0207669_10308258 Ga0207669_103082582 222
464 3300025942 Ga0207689_10250889 Ga0207689_102508891 222
465 3300025945 Ga0207679_10060526 Ga0207679_100605263 222
466 3300026041 Ga0207639_10072976 Ga0207639_100729761 222
467 3300026041 Ga0207639_10235979 Ga0207639_102359792 222
468 3300026089 Ga0207648_10194325 Ga0207648_101943252 222
469 3300026116 Ga0207674_10495336 Ga0207674_104953362 222
470 3300026121 Ga0207683_10099576 Ga0207683_100995763 222
471 3300026121 Ga0207683_10926264 Ga0207683_109262641 222
472 3300026142 Ga0207698_10390935 Ga0207698_103909352 222
473 3300026142 Ga0207698_10459656 Ga0207698_104596561 222
474 3300027666 Ga0209282_1000719 Ga0209282_100071910 222
475 3300027666 Ga0209282_1213601 Ga0209282_12136012 222
476 3300028379 Ga0268266_10017357 Ga0268266_100173573 222
477 3300028380 Ga0268265_10087653 Ga0268265_100876532 222
478 3300030522 Ga0307512_10095391 Ga0307512_100953913 222
479 3300030731 Ga0316177_1077523 Ga0316177_10775231 222
480 3300030732 Ga0316176_1202841 Ga0316176_12028412 222
481 3300030733 Ga0314311_1066159 Ga0314311_10661592 222
482 3300030742 Ga0316183_1154266 Ga0316183_11542663 222
483 3300030745 Ga0316182_1065183 Ga0316182_10651831 222
484 3300030745 Ga0316182_1137785 Ga0316182_11377851 222
485 3300031251 Ga0265327_10003665 Ga0265327_100036653 222
486 3300031507 Ga0307509_10005169 Ga0307509_100051699 222
487 3300031507 Ga0307509_10201282 Ga0307509_102012822 222
488 3300031548 Ga0307408_100065419 Ga0307408_1000654191 222
489 3300031548 Ga0307408_100143198 Ga0307408_1001431981 222
490 3300031548 Ga0307408_100461300 Ga0307408_1004613002 222
491 3300031616 Ga0307508_10299213 Ga0307508_102992132 222
492 3300031649 Ga0307514_10037604 Ga0307514_100376044 222
493 3300031649 Ga0307514_10160100 Ga0307514_101601002 222
494 3300031731 Ga0307405_10438418 Ga0307405_104384181 222
495 3300031852 Ga0307410_10477739 Ga0307410_104777391 222
496 3300031901 Ga0307406_10055509 Ga0307406_100555091 222
497 3300031901 Ga0307406_10348354 Ga0307406_103483542 222
498 3300031903 Ga0307407_10129719 Ga0307407_101297192 222
499 3300031911 Ga0307412_10031418 Ga0307412_100314184 222
500 3300031911 Ga0307412_10074369 Ga0307412_100743691 222
501 3300031911 Ga0307412_10136335 Ga0307412_101363353 222
502 3300031911 Ga0307412_10473117 Ga0307412_104731172 222
503 3300031911 Ga0307412_10593923 Ga0307412_105939232 222
504 3300031911 Ga0307412_10878139 Ga0307412_108781391 222
505 3300031995 Ga0307409_101053518 Ga0307409_1010535181 222
506 3300032002 Ga0307416_100220798 Ga0307416_1002207983 222
507 3300032004 Ga0307414_10156551 Ga0307414_101565511 222
508 3300032005 Ga0307411_10181879 Ga0307411_101818791 222
509 3300033180 Ga0307510_10074139 Ga0307510_100741394 222
510 3300041453 Ga0451797_0383833 Ga0451797_0383833_160_828 222
511 3300041997 Ga0439431_0025199 Ga0439431_0025199_91_759 222
512 3300042002 Ga0439442_027650 Ga0439442_027650_340_1008 222
513 3300042123 Ga0450921_000797 Ga0450921_000797_278_946 222
514 3300042134 Ga0450898_027310 Ga0450898_027310_225_893 222
515 3300042145 Ga0450906_005736 Ga0450906_005736_1432_2100 222
516 3300042145 Ga0450906_008567 Ga0450906_008567_133_801 222
517 3300042184 Ga0450908_003269 Ga0450908_003269_2351_3019 222
518 3300042435 Ga0439434_0030202 Ga0439434_0030202_523_1191 222
519 3300042876 Ga0451577_0002278 Ga0451577_0002278_19846_20517 222
520 3300044712 Ga0453684_0000126 Ga0453684_0000126_154527_155198 222
521 3300046453 Ga0495627_037615 Ga0495627_037615_109_777 222
522 3300046460 Ga0495638_0056719 Ga0495638_0056719_246_914 222
523 3300046462 Ga0495651_0172320 Ga0495651_0172320_447_1115 222
524 3300046512 Ga0495610_0015672 Ga0495610_0015672_2254_2922 222
525 3300046513 Ga0495616_0010987 Ga0495616_0010987_4433_5101 222
526 3300046515 Ga0495620_0006458 Ga0495620_0006458_2528_3196 222
527 3300046518 Ga0495631_0005311 Ga0495631_0005311_3217_3885 222
528 3300046520 Ga0495637_0013010 Ga0495637_0013010_2242_2910 222
529 3300046530 Ga0495654_0180836 Ga0495654_0180836_62_730 222
530 3300046536 Ga0495587_0195748 Ga0495587_0195748_289_957 222
531 3300046538 Ga0495609_0058888 Ga0495609_0058888_656_1324 222
532 3300046539 Ga0495621_0006938 Ga0495621_0006938_2329_2997 222
533 3300046615 Ga0495656_0237472 Ga0495656_0237472_154_822 222
534 3300046616 Ga0495668_0057898 Ga0495668_0057898_472_1140 222
535 3300046660 Ga0495625_0033877 Ga0495625_0033877_1563_2231 222
536 3300046660 Ga0495625_0071244 Ga0495625_0071244_136_804 222
537 3300046660 Ga0495625_0110885 Ga0495625_0110885_1072_1740 222
538 3300046665 Ga0495661_0058548 Ga0495661_0058548_1122_1790 222
539 3300046674 Ga0495588_0097411 Ga0495588_0097411_136_804 222
540 3300046674 Ga0495588_0175568 Ga0495588_0175568_365_1033 222
541 3300046674 Ga0495588_0178191 Ga0495588_0178191_261_929 222
542 3300046691 Ga0495670_0039890 Ga0495670_0039890_183_851 222
543 3300046692 Ga0495671_0020535 Ga0495671_0020535_2062_2730 222
544 3300047673 Ga0495593_0009008 Ga0495593_0009008_47_715 222
545 3300048904 Ga0496101_0237324 Ga0496101_0237324_481_1149 222
546 3300048905 Ga0496102_0008041 Ga0496102_0008041_6955_7623 222
547 3300048906 Ga0496103_0026420 Ga0496103_0026420_2619_3287 222
548 3300048908 Ga0496105_0032618 Ga0496105_0032618_2338_3006 222
549 3300048909 Ga0496106_0356769 Ga0496106_0356769_447_1115 222
550 3300048910 Ga0496107_0072647 Ga0496107_0072647_180_848 222
551 3300048913 Ga0496110_0294029 Ga0496110_0294029_133_801 222
552 3300048914 Ga0496111_0042709 Ga0496111_0042709_689_1357 222
553 3300048917 Ga0496114_0030109 Ga0496114_0030109_406_1074 222
554 3300048919 Ga0496116_0086471 Ga0496116_0086471_1123_1791 222
555 3300048919 Ga0496116_0239387 Ga0496116_0239387_137_805 222
556 3300048920 Ga0496117_0017623 Ga0496117_0017623_1499_2167 222
557 3300048920 Ga0496117_0097847 Ga0496117_0097847_1094_1762 222
558 3300048921 Ga0496118_0015823 Ga0496118_0015823_5281_5949 222
559 3300048921 Ga0496118_0050127 Ga0496118_0050127_1740_2408 222
560 3300048921 Ga0496118_0322062 Ga0496118_0322062_70_738 222
561 3300048925 Ga0496122_0005247 Ga0496122_0005247_10765_11433 222
562 3300048925 Ga0496122_0100293 Ga0496122_0100293_1230_1898 222
563 3300048925 Ga0496122_0306790 Ga0496122_0306790_168_836 222
564 3300048926 Ga0496123_0064882 Ga0496123_0064882_1482_2150 222
565 3300048926 Ga0496123_0181637 Ga0496123_0181637_137_805 222
566 3300048927 Ga0496124_0014526 Ga0496124_0014526_6925_7596 222
567 3300048927 Ga0496124_0323830 Ga0496124_0323830_16_684 222
568 3300048927 Ga0496124_0442147 Ga0496124_0442147_87_755 222
569 3300048928 Ga0496125_0092709 Ga0496125_0092709_1481_2149 222
570 3300048928 Ga0496125_0108265 Ga0496125_0108265_1134_1802 222
571 3300049671 Ga0501238_014219 Ga0501238_014219_400_1068 222
572 3300050489 nmdc:mga03683_166629_c1 nmdc:mga03683_166629_c1_108_779 222
573 3300050489 nmdc:mga03683_33903_c1 nmdc:mga03683_33903_c1_91_759 222
574 3300050489 nmdc:mga03683_99306_c1 nmdc:mga03683_99306_c1_439_1107 222
575 3300050490 nmdc:mga03n38_12891_c1 nmdc:mga03n38_12891_c1_2387_3055 222
576 3300050490 nmdc:mga03n38_3046_c1 nmdc:mga03n38_3046_c1_997_1668 222
577 3300050490 nmdc:mga03n38_313132_c1 nmdc:mga03n38_313132_c1_117_785 222
578 3300050490 nmdc:mga03n38_445535_c1 nmdc:mga03n38_445535_c1_13_681 222
579 3300050491 nmdc:mga00v17_9026_c1 nmdc:mga00v17_9026_c1_2028_2696 222
580 3300050492 nmdc:mga0yw44_22583_c1 nmdc:mga0yw44_22583_c1_172_840 222
581 3300050493 nmdc:mga0k408_11649_c1 nmdc:mga0k408_11649_c1_2608_3276 222
582 3300050493 nmdc:mga0k408_12397_c1 nmdc:mga0k408_12397_c1_1286_1957 222
583 3300050493 nmdc:mga0k408_134524_c1 nmdc:mga0k408_134524_c1_115_783 222
584 3300050493 nmdc:mga0k408_43329_c1 nmdc:mga0k408_43329_c1_1543_2211 222
585 3300050494 nmdc:mga06z11_233034_c1 nmdc:mga06z11_233034_c1_326_994 222
586 3300050496 nmdc:mga07m45_18322_c1 nmdc:mga07m45_18322_c1_899_1570 222
587 3300050496 nmdc:mga07m45_193293_c1 nmdc:mga07m45_193293_c1_381_1049 222
588 3300050496 nmdc:mga07m45_53095_c1 nmdc:mga07m45_53095_c1_79_747 222
589 3300050496 nmdc:mga07m45_90492_c1 nmdc:mga07m45_90492_c1_126_797 222
590 3300050516 nmdc:mga0sz30_97803_c1 nmdc:mga0sz30_97803_c1_563_1231 222
591 3300053079 Ga0500610_0090291 Ga0500610_0090291_791_1459 222
592 3300053087 Ga0500643_008961 Ga0500643_008961_3134_3802 222
593 3300053093 Ga0500651_0001983 Ga0500651_0001983_2870_3538 222
594 3300053094 Ga0500566_0040684 Ga0500566_0040684_846_1514 222
595 3300053110 Ga0500571_000029 Ga0500571_000029_45190_45858 222
596 3300053117 Ga0500593_001800 Ga0500593_001800_2420_3088 222
597 3300053118 Ga0500594_0006072 Ga0500594_0006072_1870_2538 222
598 3300053118 Ga0500594_0017749 Ga0500594_0017749_728_1396 222
599 3300053121 Ga0500607_007923 Ga0500607_007923_972_1640 222
600 3300053121 Ga0500607_033813 Ga0500607_033813_103_771 222
601 3300053122 Ga0500608_028035 Ga0500608_028035_906_1574 222
602 3300053128 Ga0500626_121724 Ga0500626_121724_194_862 222
603 3300053133 Ga0500655_000756 Ga0500655_000756_3278_3946 222
604 3300053134 Ga0500658_0001017 Ga0500658_0001017_10370_11038 222
605 3300053136 Ga0500559_0011530 Ga0500559_0011530_2491_3159 222
606 3300053136 Ga0500559_0076455 Ga0500559_0076455_197_865 222
607 3300053137 Ga0500561_0011796 Ga0500561_0011796_345_1013 222
608 3300053138 Ga0500564_050435 Ga0500564_050435_945_1613 222
609 3300053139 Ga0500568_0008663 Ga0500568_0008663_1569_2237 222
610 3300053141 Ga0500574_065029 Ga0500574_065029_123_791 222
611 3300053154 Ga0500619_041985 Ga0500619_041985_293_961 222
612 3300053158 Ga0500627_0001629 Ga0500627_0001629_4597_5265 222
613 3300053160 Ga0500633_0051222 Ga0500633_0051222_109_777 222
614 3300053161 Ga0500634_0005862 Ga0500634_0005862_1996_2664 222
615 3300053161 Ga0500634_0050403 Ga0500634_0050403_1257_1925 222
616 3300053162 Ga0500638_005007 Ga0500638_005007_3251_3919 222
617 3300053735 Ga0500596_009607 Ga0500596_009607_512_1180 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

10

189

0.94

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

7

183

0.86

PF13242

Hydrolase_like

HAD-hyrolase-like

143

215

0.85

PF12710

HAD

haloacid dehalogenase-like hydrolase

10

180

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yy6-assembly2.cif.gz_B crystal structure of the phosphoglycolate phosphatase from aquifex aeolicus vf5 0.8844 6 218
2ah5-assembly1.cif.gz_A hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae 0.877 6 218
2hi0-assembly2.cif.gz_B crystal structure of putative phosphoglycolate phosphatase (yp_619066.1) from lactobacillus delbrueckii subsp. bulgaricus atcc baa-365 at 1.51 a resolution 0.8751 5 219
3sd7-assembly1.cif.gz_A 1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile 0.8749 5 219
2hsz-assembly2.cif.gz_B crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution 0.8732 6 218
ID Description Score Start End Superfamily
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9358 90 206 3.40.50.1000
2hszB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9211 6 218 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9206 90 206 3.40.50.1000
4ex7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.916 7 222 3.40.50.1000
2hdoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9156 90 218 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2R7MI62-F1-model_v4 deleted 0.9913 6 141
AF-A0A840FUD9-F1-model_v4 Phosphoglycolate phosphatase (EC 3.1.3.18) 0.9911 10 222 GO:0005829
GO:0006281
GO:0008967
AF-A0A844B3D4-F1-model_v4 HAD-IA family hydrolase 0.9894 6 218 GO:0005829
GO:0006281
GO:0008967
AF-A0A5N7W1R2-F1-model_v4 HAD family hydrolase 0.9889 6 219 GO:0005829
GO:0006281
GO:0008967
AF-A0A0H2LZ70-F1-model_v4 Phosphoglycolate phosphatase (EC 3.1.3.18) 0.9856 1 222 GO:0005829
GO:0006281
GO:0008967

Feature Viewer

pLDDT pTM Quality
94.09 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map