F469664

General Info

Members Datasets Scaffolds Average Seq Length
617 295 1234 177

Family's Representative Sequence

Representative Sequence 3300046518|Ga0495631_0070092|Ga0495631_0070092_399_1028
Length 209
Sequence MGKLIATTQATIDGVIDPVGEWVQPDGDHGDYSFERQARSSGLVLGRKTYEGLAGFWPSQSGKWADMVNAMPKFVGSTTLSGDLGWNATLLEGDLEDSIPKLKDEVDGDLFMHGSGEFAYALAEKGLIDEYEVYLNPLVWGEGNVHVLGDRGTIRLELADVKRFESGVVLLTYRPRPKPGGAARRRKAAQRLWLTTSTLCPSGSRTNAP

Samples

Sample ID Description Type Environment
1 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
158 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
159 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
177 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
180 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
183 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
184 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
185 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
186 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
187 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
264 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
265 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
266 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
271 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
279 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
287 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
288 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
291 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
292 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
293 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.3
Nodule 0
Rhizoplane 10.05
Rhizosphere 87.36
Stem 0
Stem Tuber 0
Unclassified 12.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495631_0070092 3300046518 Bacteria 1516
2 LJNas_1004044 3300000546 Bacteria 1647
3 JGI24751J29686_10021452 3300002459 Bacteria 1338
4 JGI25407J50210_10013156 3300003373 Bacteria 2126
5 JGI25407J50210_10015257 3300003373 Bacteria 1983
6 JGI25407J50210_10081922 3300003373 Bacteria 801
7 JGI25404J52841_10017185 3300003659 Bacteria 1569
8 Ga0070658_10564975 3300005327 Bacteria 985
9 Ga0070683_100006330 3300005329 Bacteria 9928
10 Ga0070683_100016407 3300005329 Bacteria 6533
11 Ga0070683_100063024 3300005329 Bacteria 3448
12 Ga0070683_100929515 3300005329 Bacteria 835
13 Ga0070670_100007445 3300005331 Bacteria 9296
14 Ga0070670_100131335 3300005331 Unclassified 2162
15 Ga0070677_10000011 3300005333 Bacteria 60102
16 Ga0070677_10399825 3300005333 Bacteria 724
17 Ga0070666_10197056 3300005335 Bacteria 1416
18 Ga0070682_100000028 3300005337 Bacteria 185177
19 Ga0070682_100074293 3300005337 Bacteria 2183
20 Ga0070682_100536199 3300005337 Bacteria 913
21 Ga0070682_101348928 3300005337 Unclassified 608
22 Ga0070660_100126906 3300005339 Bacteria 2039
23 Ga0070691_10000064 3300005341 Bacteria 29794
24 Ga0070691_10243135 3300005341 Bacteria 962
25 Ga0070687_100226626 3300005343 Bacteria 1148
26 Ga0070661_100000204 3300005344 Bacteria 49187
27 Ga0070668_100011621 3300005347 Bacteria 6554
28 Ga0070668_100024814 3300005347 Bacteria 4544
29 Ga0070675_100000043 3300005354 Bacteria 77565
30 Ga0070675_100027408 3300005354 Bacteria 4576
31 Ga0070675_100075721 3300005354 Bacteria 2798
32 Ga0070675_101084689 3300005354 Bacteria 736
33 Ga0070671_100057626 3300005355 Bacteria 3233
34 Ga0070671_100879405 3300005355 Bacteria 782
35 Ga0070674_100016297 3300005356 Bacteria 4657
36 Ga0070674_100177213 3300005356 Unclassified 1630
37 Ga0070688_100000336 3300005365 Bacteria 24001
38 Ga0070688_100516863 3300005365 Bacteria 903
39 Ga0070667_100001380 3300005367 Bacteria 21746
40 Ga0070667_100162907 3300005367 Bacteria 1965
41 Ga0070714_100380714 3300005435 Bacteria 1330
42 Ga0070713_100025882 3300005436 Bacteria 4596
43 Ga0070701_10036720 3300005438 Unclassified 2470
44 Ga0070711_100038034 3300005439 Unclassified 3232
45 Ga0070711_101052616 3300005439 Bacteria 700
46 Ga0070700_100012764 3300005441 Bacteria 4702
47 Ga0070700_100034232 3300005441 Unclassified 3067
48 Ga0070700_100371183 3300005441 Unclassified 1067
49 Ga0070663_100051482 3300005455 Bacteria 2934
50 Ga0070663_100214467 3300005455 Bacteria 1509
51 Ga0070663_100547639 3300005455 Bacteria 967
52 Ga0070663_100900310 3300005455 Bacteria 764
53 Ga0070678_100002057 3300005456 Bacteria 10900
54 Ga0070678_101168318 3300005456 Unclassified 713
55 Ga0070662_100002413 3300005457 Bacteria 11488
56 Ga0070662_100312733 3300005457 Bacteria 1279
57 Ga0070681_10004765 3300005458 Bacteria 12998
58 Ga0068867_100618252 3300005459 Unclassified 947
59 Ga0068867_100700262 3300005459 Bacteria 894
60 Ga0070685_10000021 3300005466 Bacteria 103600
61 Ga0070685_10024996 3300005466 Unclassified 3286
62 Ga0070679_100000401 3300005530 Bacteria 36912
63 Ga0070684_100007447 3300005535 Bacteria 8511
64 Ga0070684_100098880 3300005535 Unclassified 2603
65 Ga0070684_100770387 3300005535 Bacteria 899
66 Ga0068853_100003123 3300005539 Bacteria 12662
67 Ga0068853_100791295 3300005539 Bacteria 908
68 Ga0070672_100075405 3300005543 Unclassified 2693
69 Ga0070686_100153047 3300005544 Bacteria 1617
70 Ga0070695_100468198 3300005545 Unclassified 969
71 Ga0070693_100571710 3300005547 Bacteria 812
72 Ga0070665_100000655 3300005548 Bacteria 46688
73 Ga0070665_100374603 3300005548 Unclassified 1431
74 Ga0068855_100105550 3300005563 Bacteria 3239
75 Ga0070664_100085099 3300005564 Bacteria 2730
76 Ga0070664_100230794 3300005564 Bacteria 1659
77 Ga0068854_100000249 3300005578 Bacteria 36592
78 Ga0068854_100027474 3300005578 Bacteria 3922
79 Ga0068854_100098383 3300005578 Bacteria 2189
80 Ga0068856_100000064 3300005614 Bacteria 98907
81 Ga0068856_100008862 3300005614 Bacteria 9790
82 Ga0068856_100072671 3300005614 Bacteria 3405
83 Ga0068856_102071918 3300005614 Bacteria 579
84 Ga0070702_100065666 3300005615 Unclassified 2126
85 Ga0070702_100076783 3300005615 Bacteria 1989
86 Ga0070702_100853851 3300005615 Unclassified 709
87 Ga0068852_100000005 3300005616 Bacteria 173127
88 Ga0068852_100149440 3300005616 Bacteria 2171
89 Ga0068859_101167044 3300005617 Bacteria 848
90 Ga0068859_101186099 3300005617 Bacteria 841
91 Ga0068864_100150187 3300005618 Unclassified 2110
92 Ga0068864_100387704 3300005618 Unclassified 1325
93 Ga0068866_10035219 3300005718 Unclassified 2443
94 Ga0068866_10594954 3300005718 Bacteria 746
95 Ga0068861_100006575 3300005719 Bacteria 7930
96 Ga0068861_100082922 3300005719 Bacteria 2514
97 Ga0068851_10001039 3300005834 Bacteria 12048
98 Ga0068870_10023393 3300005840 Unclassified 3046
99 Ga0068863_100000004 3300005841 Bacteria 272478
100 Ga0068863_100371331 3300005841 Bacteria 1396
101 Ga0068858_100000033 3300005842 Bacteria 142748
102 Ga0068858_100911108 3300005842 Bacteria 860
103 Ga0068860_100547080 3300005843 Bacteria 1160
104 Ga0068862_100000828 3300005844 Bacteria 30634
105 Ga0081455_10019904 3300005937 Bacteria 6336
106 Ga0081455_10144484 3300005937 Bacteria 1842
107 Ga0081538_10000173 3300005981 Bacteria 69480
108 Ga0081538_10000565 3300005981 Bacteria 40995
109 Ga0081538_10000610 3300005981 Bacteria 39608
110 Ga0081538_10000701 3300005981 Bacteria 36744
111 Ga0081538_10002782 3300005981 Bacteria 16758
112 Ga0081538_10002932 3300005981 Bacteria 16281
113 Ga0081538_10005038 3300005981 Bacteria 12023
114 Ga0081538_10005312 3300005981 Bacteria 11600
115 Ga0081538_10014670 3300005981 Bacteria 6121
116 Ga0081538_10017188 3300005981 Bacteria 5502
117 Ga0081538_10075892 3300005981 Unclassified 1821
118 Ga0081538_10088648 3300005981 Bacteria 1609
119 Ga0081540_1000323 3300005983 Bacteria 49388
120 Ga0081540_1073905 3300005983 Bacteria 1564
121 Ga0081540_1166789 3300005983 Bacteria 845
122 Ga0081539_10005999 3300005985 Bacteria 11941
123 Ga0081539_10122981 3300005985 Bacteria 1286
124 Ga0075365_10964825 3300006038 Unclassified 601
125 Ga0075368_10300958 3300006042 Bacteria 692
126 Ga0075364_10077151 3300006051 Bacteria 2199
127 Ga0075364_10524016 3300006051 Bacteria 810
128 Ga0075432_10167587 3300006058 Bacteria 853
129 Ga0070712_100052024 3300006175 Bacteria 2855
130 Ga0075367_10294482 3300006178 Bacteria 1021
131 Ga0075428_100073841 3300006844 Bacteria 3725
132 Ga0075428_100115534 3300006844 Bacteria 2924
133 Ga0075430_100006226 3300006846 Bacteria 10066
134 Ga0075430_100013611 3300006846 Bacteria 6933
135 Ga0075430_100184766 3300006846 Bacteria 1733
136 Ga0075430_100458816 3300006846 Unclassified 1051
137 Ga0075431_100026085 3300006847 Bacteria 5992
138 Ga0075431_100218986 3300006847 Bacteria 1942
139 Ga0075431_100583001 3300006847 Bacteria 1103
140 Ga0075429_100166399 3300006880 Bacteria 1931
141 Ga0075429_100685898 3300006880 Unclassified 897
142 Ga0068865_100000017 3300006881 Bacteria 109636
143 Ga0068865_100342225 3300006881 Bacteria 1209
144 Ga0097620_101166841 3300006931 Bacteria 848
145 Ga0097620_101186256 3300006931 Bacteria 841
146 Ga0105244_10104677 3300009036 Bacteria 1381
147 Ga0105240_10764694 3300009093 Bacteria 1049
148 Ga0105240_11426130 3300009093 Unclassified 727
149 Ga0111539_10138359 3300009094 Bacteria 2852
150 Ga0111539_10194262 3300009094 Bacteria 2367
151 Ga0105245_10000056 3300009098 Bacteria 124109
152 Ga0105245_10000161 3300009098 Bacteria 63378
153 Ga0105245_10006191 3300009098 Bacteria 10531
154 Ga0105245_10009998 3300009098 Bacteria 8261
155 Ga0105245_10035086 3300009098 Bacteria 4450
156 Ga0105245_10280127 3300009098 Unclassified 1629
157 Ga0105245_10355742 3300009098 Unclassified 1452
158 Ga0105245_10691698 3300009098 Unclassified 1052
159 Ga0105247_10000105 3300009101 Bacteria 87578
160 Ga0105247_10412116 3300009101 Bacteria 965
161 Ga0105247_10426907 3300009101 Unclassified 950
162 Ga0114129_10003391 3300009147 Bacteria 22391
163 Ga0114129_10017746 3300009147 Bacteria 10134
164 Ga0114129_10039894 3300009147 Bacteria 6623
165 Ga0114129_10041792 3300009147 Bacteria 6456
166 Ga0114129_11168237 3300009147 Bacteria 960
167 Ga0114129_12566281 3300009147 Bacteria 608
168 Ga0105243_10174008 3300009148 Unclassified 1867
169 Ga0105243_10393235 3300009148 Unclassified 1286
170 Ga0105243_11387803 3300009148 Unclassified 723
171 Ga0105243_11719945 3300009148 Bacteria 657
172 Ga0105241_10304169 3300009174 Bacteria 1369
173 Ga0105242_10001190 3300009176 Bacteria 20519
174 Ga0105242_10087343 3300009176 Unclassified 2618
175 Ga0105242_10127826 3300009176 Bacteria 2189
176 Ga0105242_10138434 3300009176 Bacteria 2109
177 Ga0105242_11350526 3300009176 Bacteria 738
178 Ga0105248_10000032 3300009177 Bacteria 201114
179 Ga0105248_10190283 3300009177 Bacteria 2312
180 Ga0105248_10410318 3300009177 Bacteria 1525
181 Ga0105238_10000023 3300009551 Bacteria 196844
182 Ga0105238_10238867 3300009551 Bacteria 1794
183 Ga0105238_11815097 3300009551 Bacteria 642
184 Ga0105249_10003658 3300009553 Bacteria 13275
185 Ga0105249_10028680 3300009553 Bacteria 5024
186 Ga0105249_10164909 3300009553 Bacteria 2144
187 Ga0105239_10047372 3300010375 Bacteria 4711
188 Ga0105239_10169723 3300010375 Bacteria 2439
189 Ga0105239_10243171 3300010375 Bacteria 2020
190 Ga0105239_10556249 3300010375 Bacteria 1307
191 Ga0105246_10054079 3300011119 Bacteria 2765
192 Ga0105246_10063863 3300011119 Unclassified 2570
193 Ga0105246_10261163 3300011119 Bacteria 1380
194 Ga0105246_10268607 3300011119 Bacteria 1362
195 Ga0157371_10001852 3300013102 Bacteria 21245
196 Ga0157370_10057652 3300013104 Bacteria 3692
197 Ga0157369_10000130 3300013105 Bacteria 108193
198 Ga0157369_10162312 3300013105 Bacteria 2358
199 Ga0157374_10003256 3300013296 Bacteria 13641
200 Ga0157374_10011225 3300013296 Bacteria 7748
201 Ga0157374_10037517 3300013296 Bacteria 4448
202 Ga0157374_10092464 3300013296 Unclassified 2886
203 Ga0157378_10000533 3300013297 Bacteria 36164
204 Ga0157378_10017479 3300013297 Bacteria 6295
205 Ga0157378_10321732 3300013297 Unclassified 1503
206 Ga0157378_11096711 3300013297 Unclassified 833
207 Ga0157372_10000078 3300013307 Bacteria 101111
208 Ga0157375_10008178 3300013308 Bacteria 9157
209 Ga0157375_10026472 3300013308 Bacteria 5406
210 Ga0157375_10252321 3300013308 Bacteria 1925
211 Ga0157375_10586491 3300013308 Bacteria 1275
212 Ga0163163_10084660 3300014325 Bacteria 3177
213 Ga0163163_10211737 3300014325 Unclassified 1987
214 Ga0163163_10366592 3300014325 Bacteria 1497
215 Ga0163163_11654713 3300014325 Bacteria 701
216 Ga0157380_10000097 3300014326 Bacteria 48365
217 Ga0157380_10903734 3300014326 Bacteria 909
218 Ga0182008_10141888 3300014497 Unclassified 1202
219 Ga0157377_10002216 3300014745 Bacteria 8542
220 Ga0157377_10024115 3300014745 Bacteria 3231
221 Ga0157379_10010922 3300014968 Bacteria 7917
222 Ga0157379_10220853 3300014968 Bacteria 1717
223 Ga0157376_10001266 3300014969 Bacteria 16615
224 Ga0157376_10516093 3300014969 Bacteria 1177
225 Ga0163161_10387531 3300017792 Bacteria 1118
226 Ga0163161_10611258 3300017792 Unclassified 900
227 Ga0206356_10986902 3300020070 Bacteria 641
228 Ga0206349_1001700 3300020075 Bacteria 1462
229 Ga0206352_10283745 3300020078 Bacteria 1028
230 Ga0207656_10000467 3300025321 Bacteria 13514
231 Ga0207656_10006271 3300025321 Bacteria 4261
232 Ga0207682_10000159 3300025893 Bacteria 30618
233 Ga0207642_10497574 3300025899 Bacteria 746
234 Ga0207710_10000231 3300025900 Bacteria 48233
235 Ga0207688_10000600 3300025901 Bacteria 17695
236 Ga0207688_10128544 3300025901 Bacteria 1484
237 Ga0207680_10014903 3300025903 Bacteria 4041
238 Ga0207680_10179803 3300025903 Bacteria 1430
239 Ga0207645_10460535 3300025907 Unclassified 859
240 Ga0207643_10003414 3300025908 Bacteria 8564
241 Ga0207693_10065788 3300025915 Bacteria 2838
242 Ga0207663_10059701 3300025916 Unclassified 2414
243 Ga0207663_10692720 3300025916 Bacteria 806
244 Ga0207660_10148943 3300025917 Bacteria 1796
245 Ga0207662_10080980 3300025918 Unclassified 1982
246 Ga0207649_10000005 3300025920 Bacteria 356179
247 Ga0207649_10048919 3300025920 Bacteria 2609
248 Ga0207652_10000577 3300025921 Bacteria 36887
249 Ga0207694_10000004 3300025924 Bacteria 967075
250 Ga0207694_10134819 3300025924 Bacteria 1982
251 Ga0207694_10174079 3300025924 Bacteria 1744
252 Ga0207650_10016406 3300025925 Bacteria 5177
253 Ga0207659_10000276 3300025926 Bacteria 31262
254 Ga0207659_10325952 3300025926 Bacteria 1268
255 Ga0207659_10929960 3300025926 Bacteria 748
256 Ga0207687_10000007 3300025927 Bacteria 604185
257 Ga0207687_10000026 3300025927 Bacteria 173968
258 Ga0207687_10001247 3300025927 Bacteria 17414
259 Ga0207687_10001606 3300025927 Bacteria 15571
260 Ga0207687_10112787 3300025927 Bacteria 2021
261 Ga0207687_10299912 3300025927 Bacteria 1294
262 Ga0207700_10025911 3300025928 Bacteria 4081
263 Ga0207664_10182849 3300025929 Bacteria 1801
264 Ga0207644_10190818 3300025931 Bacteria 1611
265 Ga0207644_10733272 3300025931 Bacteria 825
266 Ga0207706_10004007 3300025933 Bacteria 13942
267 Ga0207706_10009349 3300025933 Bacteria 9000
268 Ga0207686_10000032 3300025934 Bacteria 150341
269 Ga0207686_10295115 3300025934 Bacteria 1202
270 Ga0207686_10723604 3300025934 Bacteria 793
271 Ga0207709_10002123 3300025935 Bacteria 12743
272 Ga0207709_10278225 3300025935 Bacteria 1235
273 Ga0207670_10075984 3300025936 Unclassified 2336
274 Ga0207704_10000025 3300025938 Bacteria 135523
275 Ga0207704_10221813 3300025938 Bacteria 1399
276 Ga0207691_10045560 3300025940 Bacteria 4030
277 Ga0207711_10000020 3300025941 Bacteria 363325
278 Ga0207711_10112733 3300025941 Bacteria 2421
279 Ga0207711_11359418 3300025941 Bacteria 653
280 Ga0207689_10068916 3300025942 Bacteria 2907
281 Ga0207689_10275760 3300025942 Bacteria 1392
282 Ga0207661_10000165 3300025944 Bacteria 43066
283 Ga0207661_10099364 3300025944 Bacteria 2440
284 Ga0207661_10119244 3300025944 Bacteria 2244
285 Ga0207661_11041688 3300025944 Bacteria 753
286 Ga0207679_10857524 3300025945 Bacteria 830
287 Ga0207667_10086552 3300025949 Bacteria 3243
288 Ga0207651_11308370 3300025960 Unclassified 652
289 Ga0207712_10003607 3300025961 Bacteria 9765
290 Ga0207712_10256219 3300025961 Bacteria 1417
291 Ga0207712_10639471 3300025961 Bacteria 924
292 Ga0207668_10012853 3300025972 Bacteria 5137
293 Ga0207668_10082386 3300025972 Bacteria 2337
294 Ga0207640_10000114 3300025981 Bacteria 60718
295 Ga0207640_10009188 3300025981 Bacteria 5524
296 Ga0207640_10405497 3300025981 Unclassified 1111
297 Ga0207658_10057407 3300025986 Bacteria 2892
298 Ga0207658_10344854 3300025986 Bacteria 1295
299 Ga0207658_10995017 3300025986 Bacteria 765
300 Ga0207677_10132793 3300026023 Bacteria 1893
301 Ga0207677_10507898 3300026023 Bacteria 1043
302 Ga0207703_10000126 3300026035 Bacteria 91860
303 Ga0207703_10023751 3300026035 Bacteria 4822
304 Ga0207703_10118702 3300026035 Bacteria 2268
305 Ga0207639_10001697 3300026041 Bacteria 14869
306 Ga0207639_10489840 3300026041 Unclassified 1122
307 Ga0207678_10088587 3300026067 Bacteria 2645
308 Ga0207678_10145655 3300026067 Bacteria 2022
309 Ga0207708_10006374 3300026075 Bacteria 8740
310 Ga0207708_10260603 3300026075 Bacteria 1399
311 Ga0207708_10454336 3300026075 Unclassified 1067
312 Ga0207708_11040768 3300026075 Bacteria 712
313 Ga0207702_10000016 3300026078 Bacteria 226633
314 Ga0207702_10006884 3300026078 Bacteria 9743
315 Ga0207702_10033954 3300026078 Bacteria 4263
316 Ga0207641_10000698 3300026088 Bacteria 36133
317 Ga0207641_10039668 3300026088 Bacteria 3939
318 Ga0207648_10101245 3300026089 Unclassified 2525
319 Ga0207676_10462576 3300026095 Bacteria 1198
320 Ga0207676_11053135 3300026095 Unclassified 803
321 Ga0207674_10037773 3300026116 Bacteria 5018
322 Ga0207675_100006208 3300026118 Bacteria 11346
323 Ga0207675_100126680 3300026118 Unclassified 2419
324 Ga0207675_100790925 3300026118 Bacteria 961
325 Ga0207683_10286278 3300026121 Unclassified 1506
326 Ga0207698_10000041 3300026142 Bacteria 97882
327 Ga0207698_10115793 3300026142 Bacteria 2258
328 Ga0207428_10355448 3300027907 Bacteria 1077
329 Ga0207428_10675617 3300027907 Bacteria 740
330 Ga0268266_10002570 3300028379 Bacteria 19248
331 Ga0268266_10159406 3300028379 Bacteria 2040
332 Ga0268266_10189660 3300028379 Bacteria 1876
333 Ga0268266_10451881 3300028379 Bacteria 1222
334 Ga0268265_10150615 3300028380 Unclassified 1961
335 Ga0265334_10185212 3300028573 Bacteria 726
336 Ga0307511_10028585 3300030521 Bacteria 5056
337 Ga0316182_1019043 3300030745 Bacteria 683
338 Ga0307408_100109744 3300031548 Bacteria 2117
339 Ga0307408_100315500 3300031548 Bacteria 1315
340 Ga0307408_100620300 3300031548 Bacteria 963
341 Ga0307408_100874744 3300031548 Bacteria 821
342 Ga0307405_10101351 3300031731 Bacteria 1932
343 Ga0307405_10451888 3300031731 Bacteria 1019
344 Ga0307405_10785811 3300031731 Unclassified 796
345 Ga0307413_10214074 3300031824 Bacteria 1402
346 Ga0307413_10406497 3300031824 Bacteria 1068
347 Ga0307406_10329791 3300031901 Bacteria 1184
348 Ga0307406_10339051 3300031901 Unclassified 1170
349 Ga0307407_10584195 3300031903 Unclassified 830
350 Ga0307409_100011885 3300031995 Bacteria 5516
351 Ga0307409_100063350 3300031995 Bacteria 2899
352 Ga0307409_100098571 3300031995 Bacteria 2417
353 Ga0307409_100462050 3300031995 Bacteria 1227
354 Ga0307416_100006693 3300032002 Bacteria 7236
355 Ga0307416_100056427 3300032002 Bacteria 3170
356 Ga0307416_100068129 3300032002 Bacteria 2939
357 Ga0307416_100767995 3300032002 Bacteria 1057
358 Ga0307416_101263296 3300032002 Bacteria 844
359 Ga0307414_10202131 3300032004 Bacteria 1617
360 Ga0307411_10240755 3300032005 Bacteria 1416
361 Ga0307415_100036459 3300032126 Bacteria 3223
362 Ga0307415_100078464 3300032126 Bacteria 2349
363 Ga0307415_100733081 3300032126 Unclassified 895
364 Ga0373937_0159469 3300036401 Bacteria 2115
365 Ga0395899_0196872 3300037312 Viruses 1407
366 Ga0395900_0014163 3300037418 Bacteria 8144
367 Ga0395900_0014619 3300037418 Bacteria 8006
368 Ga0395900_0079051 3300037418 Bacteria 3379
369 Ga0395900_0132873 3300037418 Bacteria 2550
370 Ga0395900_0358135 3300037418 Unclassified 1431
371 Ga0395898_0014693 3300037466 Bacteria 8038
372 Ga0395898_0107896 3300037466 Bacteria 2670
373 Ga0395898_0197335 3300037466 Bacteria 1922
374 Ga0395898_0248811 3300037466 Bacteria 1695
375 Ga0395898_0371608 3300037466 Unclassified 1364
376 Ga0395898_1326543 3300037466 Bacteria 648
377 Ga0395905_0015283 3300037471 Bacteria 7298
378 Ga0395905_0079744 3300037471 Bacteria 3068
379 Ga0395905_0764632 3300037471 Unclassified 869
380 Ga0395901_0017271 3300038443 Bacteria 7365
381 Ga0395901_0018642 3300038443 Bacteria 7087
382 Ga0395901_0025425 3300038443 Bacteria 6077
383 Ga0395901_0160984 3300038443 Bacteria 2357
384 Ga0395901_0639881 3300038443 Bacteria 1068
385 Ga0451802_1307960 3300041460 Unclassified 653
386 Ga0451804_1140728 3300041463 Bacteria 1237
387 Ga0451807_0617074 3300041486 Bacteria 1136
388 Ga0451845_0117207 3300041501 Bacteria 581
389 Ga0451849_0734067 3300041505 Bacteria 773
390 Ga0451853_1178070 3300041512 Bacteria 1263
391 Ga0451853_3041607 3300041512 Bacteria 1082
392 Ga0451853_3663636 3300041512 Bacteria 2605
393 Ga0451853_3699005 3300041512 Bacteria 1927
394 Ga0439432_176539 3300042006 Bacteria 623
395 Ga0450906_025945 3300042145 Bacteria 1041
396 Ga0450907_016298 3300042146 Bacteria 1239
397 Ga0439435_0034521 3300042436 Bacteria 1391
398 Ga0439444_0018304 3300042437 Bacteria 1212
399 Ga0495641_0000003 3300046461 Bacteria 242879
400 Ga0495641_0013046 3300046461 Bacteria 4599
401 Ga0495641_0309525 3300046461 Bacteria 712
402 Ga0495653_0135718 3300046463 Bacteria 1736
403 Ga0495653_0340093 3300046463 Bacteria 968
404 Ga0495639_0255850 3300046475 Bacteria 867
405 Ga0495585_0294081 3300046492 Bacteria 800
406 Ga0495594_0000032 3300046499 Bacteria 63783
407 Ga0495596_0072322 3300046500 Bacteria 1339
408 Ga0495607_0120913 3300046501 Bacteria 1375
409 Ga0495606_0000057 3300046507 Bacteria 197956
410 Ga0495608_0018926 3300046511 Bacteria 4746
411 Ga0495628_0001941 3300046516 Bacteria 18745
412 Ga0495628_0054992 3300046516 Bacteria 3136
413 Ga0495630_0000025 3300046517 Bacteria 152364
414 Ga0495630_0245246 3300046517 Bacteria 1369
415 Ga0495644_0001082 3300046523 Bacteria 11295
416 Ga0495644_0270362 3300046523 Bacteria 662
417 Ga0495652_0005028 3300046529 Bacteria 12523
418 Ga0495640_0171776 3300046533 Bacteria 1385
419 Ga0495587_0090679 3300046536 Unclassified 1766
420 Ga0495598_0014271 3300046537 Bacteria 1984
421 Ga0495645_0057562 3300046543 Bacteria 2821
422 Ga0495645_0307922 3300046543 Bacteria 1032
423 Ga0495622_0000050 3300046557 Bacteria 106111
424 Ga0495667_0000022 3300046559 Bacteria 176919
425 Ga0495656_0000342 3300046615 Bacteria 15822
426 Ga0495656_0158612 3300046615 Unclassified 1098
427 Ga0495668_0454070 3300046616 Bacteria 705
428 Ga0495625_0000029 3300046660 Bacteria 244646
429 Ga0495657_0012645 3300046675 Bacteria 6262
430 Ga0495599_0007615 3300046678 Bacteria 6575
431 Ga0495646_0184297 3300046680 Bacteria 1144
432 Ga0495647_0000015 3300046681 Bacteria 86790
433 Ga0495647_0004796 3300046681 Bacteria 4411
434 Ga0495658_0001810 3300046683 Bacteria 10970
435 Ga0495669_0000130 3300046684 Bacteria 48500
436 Ga0495613_0000109 3300046689 Bacteria 80473
437 Ga0495624_0000030 3300046690 Bacteria 91755
438 Ga0495624_0000241 3300046690 Bacteria 42989
439 Ga0495649_0006497 3300046694 Bacteria 7276
440 Ga0495589_0188345 3300046794 Bacteria 977
441 Ga0495660_0298075 3300046810 Unclassified 732
442 Ga0495604_0069513 3300047317 Bacteria 2669
443 Ga0495674_0000020 3300047319 Bacteria 178465
444 Ga0495672_0048393 3300047320 Bacteria 2521
445 Ga0495672_0085523 3300047320 Unclassified 1747
446 Ga0495672_0118556 3300047320 Bacteria 1410
447 Ga0495676_0000283 3300047321 Bacteria 40939
448 Ga0495676_0005012 3300047321 Bacteria 12147
449 Ga0495680_0004998 3300047322 Bacteria 12542
450 Ga0495680_0009589 3300047322 Bacteria 8698
451 Ga0495593_0053904 3300047673 Bacteria 2121
452 Ga0495602_0000720 3300048088 Bacteria 31219
453 Ga0496100_0000007 3300048903 Bacteria 261266
454 Ga0496100_0000049 3300048903 Bacteria 75590
455 Ga0496101_0000010 3300048904 Bacteria 281990
456 Ga0496101_0000013 3300048904 Bacteria 261266
457 Ga0496102_0000546 3300048905 Bacteria 40572
458 Ga0496102_0151796 3300048905 Bacteria 2177
459 Ga0496103_0000368 3300048906 Bacteria 40572
460 Ga0496104_0000013 3300048907 Bacteria 397163
461 Ga0496104_0098261 3300048907 Bacteria 2802
462 Ga0496104_0232405 3300048907 Unclassified 1756
463 Ga0496104_1216503 3300048907 Unclassified 656
464 Ga0496105_0000006 3300048908 Bacteria 393578
465 Ga0496105_0005390 3300048908 Bacteria 9703
466 Ga0496105_0808480 3300048908 Bacteria 712
467 Ga0496106_0000006 3300048909 Bacteria 251855
468 Ga0496106_0000018 3300048909 Bacteria 175028
469 Ga0496107_0000007 3300048910 Bacteria 257113
470 Ga0496107_0000032 3300048910 Bacteria 99848
471 Ga0496107_0179138 3300048910 Bacteria 1574
472 Ga0496108_0000001 3300048911 Bacteria 919044
473 Ga0496108_0000045 3300048911 Bacteria 137416
474 Ga0496108_0005148 3300048911 Bacteria 10571
475 Ga0496108_0007526 3300048911 Bacteria 8831
476 Ga0496108_0224267 3300048911 Bacteria 1633
477 Ga0496108_0540634 3300048911 Bacteria 1017
478 Ga0496109_0000006 3300048912 Bacteria 325513
479 Ga0496109_0000032 3300048912 Bacteria 162984
480 Ga0496109_0000039 3300048912 Bacteria 145769
481 Ga0496109_0013993 3300048912 Bacteria 6974
482 Ga0496109_0023940 3300048912 Bacteria 5423
483 Ga0496109_0078107 3300048912 Bacteria 3047
484 Ga0496109_0351857 3300048912 Bacteria 1392
485 Ga0496110_0000018 3300048913 Bacteria 79734
486 Ga0496110_0003300 3300048913 Bacteria 12318
487 Ga0496110_0010056 3300048913 Bacteria 7680
488 Ga0496110_0036076 3300048913 Bacteria 4292
489 Ga0496110_0087232 3300048913 Bacteria 2787
490 Ga0496110_0891702 3300048913 Bacteria 795
491 Ga0496110_1153216 3300048913 Bacteria 683
492 Ga0496111_0000015 3300048914 Bacteria 77334
493 Ga0496111_0002028 3300048914 Bacteria 12057
494 Ga0496111_0048976 3300048914 Bacteria 3046
495 Ga0496111_0065017 3300048914 Bacteria 2647
496 Ga0496111_0105754 3300048914 Bacteria 2071
497 Ga0496111_0217414 3300048914 Bacteria 1420
498 Ga0496111_0229531 3300048914 Bacteria 1379
499 Ga0496112_0000258 3300048915 Bacteria 33904
500 Ga0496112_0229276 3300048915 Bacteria 1812
501 Ga0496113_0000009 3300048916 Bacteria 88223
502 Ga0496113_0025906 3300048916 Bacteria 4187
503 Ga0496113_0071578 3300048916 Bacteria 2637
504 Ga0496113_0085912 3300048916 Bacteria 2417
505 Ga0496113_0728366 3300048916 Bacteria 790
506 Ga0496114_0000003 3300048917 Bacteria 630981
507 Ga0496114_0002643 3300048917 Bacteria 13674
508 Ga0496114_0077448 3300048917 Bacteria 2803
509 Ga0496114_0084433 3300048917 Bacteria 2689
510 Ga0496114_0477849 3300048917 Bacteria 1103
511 Ga0496115_0000036 3300048918 Bacteria 127774
512 Ga0496124_0480686 3300048927 Bacteria 839
513 Ga0501031_0022602 3300049568 Bacteria 4098
514 Ga0501033_0036566 3300049570 Bacteria 3679
515 Ga0501036_0078109 3300049572 Bacteria 2800
516 Ga0501036_0218079 3300049572 Bacteria 1602
517 Ga0501038_0059585 3300049574 Bacteria 3270
518 Ga0501039_0049196 3300049575 Bacteria 3259
519 Ga0501039_0061164 3300049575 Bacteria 2916
520 Ga0501039_1078515 3300049575 Unclassified 623
521 Ga0501040_0002792 3300049576 Bacteria 11256
522 Ga0501040_0013812 3300049576 Bacteria 5315
523 Ga0501040_0084835 3300049576 Bacteria 2198
524 Ga0501041_0003126 3300049577 Bacteria 9523
525 Ga0501041_0092194 3300049577 Unclassified 1871
526 Ga0501041_0131075 3300049577 Bacteria 1561
527 Ga0501041_0224733 3300049577 Bacteria 1178
528 Ga0501041_0803758 3300049577 Bacteria 603
529 Ga0501042_0035218 3300049578 Bacteria 3551
530 Ga0501042_0043004 3300049578 Bacteria 3216
531 Ga0501042_0049583 3300049578 Bacteria 2995
532 Ga0501043_0085134 3300049579 Bacteria 2484
533 Ga0501043_0435519 3300049579 Bacteria 987
534 Ga0501046_0114263 3300049580 Bacteria 2060
535 Ga0501048_0018043 3300049582 Bacteria 5193
536 Ga0501048_0094689 3300049582 Bacteria 2106
537 Ga0501067_0121909 3300049583 Bacteria 1451
538 Ga0501069_0187920 3300049585 Bacteria 1195
539 Ga0501071_0018260 3300049587 Bacteria 4853
540 Ga0501071_0746832 3300049587 Unclassified 754
541 Ga0501072_0043467 3300049588 Bacteria 3530
542 Ga0501072_0058425 3300049588 Bacteria 3040
543 Ga0501072_0083625 3300049588 Unclassified 2530
544 Ga0501072_0413499 3300049588 Bacteria 1069
545 Ga0501072_0539730 3300049588 Bacteria 921
546 Ga0501074_0034413 3300049590 Bacteria 3672
547 Ga0501074_0134531 3300049590 Bacteria 1768
548 Ga0501074_0182436 3300049590 Bacteria 1497
549 Ga0501075_0011238 3300049591 Bacteria 6334
550 Ga0501075_0032656 3300049591 Bacteria 3868
551 Ga0501075_0162590 3300049591 Bacteria 1703
552 Ga0501076_0009190 3300049592 Bacteria 7287
553 Ga0501076_0018165 3300049592 Bacteria 5356
554 Ga0501076_0079359 3300049592 Bacteria 2634
555 Ga0501076_0437941 3300049592 Bacteria 1076
556 Ga0501077_0004431 3300049593 Bacteria 8527
557 Ga0501077_0140167 3300049593 Bacteria 1533
558 Ga0501077_0630545 3300049593 Bacteria 689
559 Ga0501217_087511 3300049661 Unclassified 871
560 Ga0501230_061587 3300049667 Bacteria 761
561 Ga0501235_053400 3300049669 Bacteria 939
562 Ga0501247_037997 3300049677 Bacteria 680
563 Ga0501079_0000542 3300049741 Bacteria 24598
564 Ga0501079_0020080 3300049741 Bacteria 5104
565 Ga0501079_0099141 3300049741 Bacteria 2258
566 Ga0501079_0590818 3300049741 Unclassified 874
567 Ga0501080_0297888 3300049742 Bacteria 1463
568 Ga0501080_0987779 3300049742 Bacteria 731
569 Ga0501081_0015257 3300049743 Bacteria 5067
570 Ga0501081_0030112 3300049743 Bacteria 3672
571 Ga0501081_0128759 3300049743 Unclassified 1807
572 Ga0501081_0524006 3300049743 Bacteria 884
573 Ga0501267_034586 3300049764 Bacteria 609
574 Ga0501271_020355 3300049768 Bacteria 767
575 Ga0501035_0404003 3300049822 Bacteria 1136
576 Ga0501044_0593790 3300049823 Bacteria 1001
577 Ga0501045_0012422 3300049824 Bacteria 5995
578 Ga0501045_0037441 3300049824 Bacteria 3526
579 Ga0501045_0208470 3300049824 Bacteria 1456
580 Ga0501045_0216206 3300049824 Bacteria 1427
581 nmdc:mga00v17_163845_c1 3300050491 Unclassified 1432
582 nmdc:mga0yw44_546975_c1 3300050492 Bacteria 786
583 nmdc:mga05p37_1368333_c1 3300050507 Bacteria 716
584 nmdc:mga05p37_142918_c1 3300050507 Bacteria 2931
585 nmdc:mga05p37_15347_c1 3300050507 Bacteria 9203
586 nmdc:mga05p37_22290_c1 3300050507 Bacteria 7681
587 nmdc:mga05p37_256067_c1 3300050507 Bacteria 2097
588 nmdc:mga09592_2462_c1 3300050508 Bacteria 14943
589 nmdc:mga09592_83093_c1 3300050508 Bacteria 2729
590 nmdc:mga0qj67_276704_c1 3300050509 Bacteria 1361
591 nmdc:mga0qj67_4420_c1 3300050509 Bacteria 5936
592 nmdc:mga06r32_112373_c1 3300050510 Bacteria 2681
593 nmdc:mga06r32_150413_c1 3300050510 Bacteria 2306
594 nmdc:mga06r32_42766_c1 3300050510 Bacteria 4309
595 nmdc:mga08y16_1522521_c1 3300050511 Bacteria 629
596 nmdc:mga08y16_152590_c1 3300050511 Bacteria 2401
597 nmdc:mga0n895_674176_c1 3300050512 Unclassified 1031
598 nmdc:mga0rr50_1045446_c1 3300050513 Unclassified 695
599 Ga0495601_0000260 3300053077 Bacteria 28505
600 Ga0495601_0172541 3300053077 Bacteria 1413
601 Ga0495612_0070213 3300053078 Bacteria 1459
602 Ga0495655_0000004 3300053083 Bacteria 293683
603 Ga0495655_0247569 3300053083 Bacteria 598
604 Ga0495595_0043236 3300053084 Bacteria 2066
605 Ga0500628_000049 3300053129 Bacteria 41425
606 Ga0501084_0027832 3300054114 Bacteria 4723
607 Ga0501084_0056216 3300054114 Bacteria 3292
608 Ga0590071_002978 3300059421 Bacteria 4206
609 Ga0590074_005066 3300059423 Bacteria 2179
610 Ga0590075_021710 3300059424 Bacteria 1604
611 Ga0590077_005764 3300059426 Bacteria 2537
612 Ga0501082_0476701 3300060353 Bacteria 1091
613 Ga0501082_0625456 3300060353 Bacteria 942
614 Ga0530510_0005145 3300061734 Bacteria 9021
615 Ga0530510_0051555 3300061734 Bacteria 2973
616 Ga0530510_0161448 3300061734 Unclassified 1658
617 Ga0530510_0176520 3300061734 Bacteria 1583
618 Ga0495631_0070092
619 LJNas_1004044
620 JGI24751J29686_10021452
621 JGI25407J50210_10013156
622 JGI25407J50210_10015257
623 JGI25407J50210_10081922
624 JGI25404J52841_10017185
625 Ga0070658_10564975
626 Ga0070683_100006330
627 Ga0070683_100016407
628 Ga0070683_100063024
629 Ga0070683_100929515
630 Ga0070670_100007445
631 Ga0070670_100131335
632 Ga0070677_10000011
633 Ga0070677_10399825
634 Ga0070666_10197056
635 Ga0070682_100000028
636 Ga0070682_100074293
637 Ga0070682_100536199
638 Ga0070682_101348928
639 Ga0070660_100126906
640 Ga0070691_10000064
641 Ga0070691_10243135
642 Ga0070687_100226626
643 Ga0070661_100000204
644 Ga0070668_100011621
645 Ga0070668_100024814
646 Ga0070675_100000043
647 Ga0070675_100027408
648 Ga0070675_100075721
649 Ga0070675_101084689
650 Ga0070671_100057626
651 Ga0070671_100879405
652 Ga0070674_100016297
653 Ga0070674_100177213
654 Ga0070688_100000336
655 Ga0070688_100516863
656 Ga0070667_100001380
657 Ga0070667_100162907
658 Ga0070714_100380714
659 Ga0070713_100025882
660 Ga0070701_10036720
661 Ga0070711_100038034
662 Ga0070711_101052616
663 Ga0070700_100012764
664 Ga0070700_100034232
665 Ga0070700_100371183
666 Ga0070663_100051482
667 Ga0070663_100214467
668 Ga0070663_100547639
669 Ga0070663_100900310
670 Ga0070678_100002057
671 Ga0070678_101168318
672 Ga0070662_100002413
673 Ga0070662_100312733
674 Ga0070681_10004765
675 Ga0068867_100618252
676 Ga0068867_100700262
677 Ga0070685_10000021
678 Ga0070685_10024996
679 Ga0070679_100000401
680 Ga0070684_100007447
681 Ga0070684_100098880
682 Ga0070684_100770387
683 Ga0068853_100003123
684 Ga0068853_100791295
685 Ga0070672_100075405
686 Ga0070686_100153047
687 Ga0070695_100468198
688 Ga0070693_100571710
689 Ga0070665_100000655
690 Ga0070665_100374603
691 Ga0068855_100105550
692 Ga0070664_100085099
693 Ga0070664_100230794
694 Ga0068854_100000249
695 Ga0068854_100027474
696 Ga0068854_100098383
697 Ga0068856_100000064
698 Ga0068856_100008862
699 Ga0068856_100072671
700 Ga0068856_102071918
701 Ga0070702_100065666
702 Ga0070702_100076783
703 Ga0070702_100853851
704 Ga0068852_100000005
705 Ga0068852_100149440
706 Ga0068859_101167044
707 Ga0068859_101186099
708 Ga0068864_100150187
709 Ga0068864_100387704
710 Ga0068866_10035219
711 Ga0068866_10594954
712 Ga0068861_100006575
713 Ga0068861_100082922
714 Ga0068851_10001039
715 Ga0068870_10023393
716 Ga0068863_100000004
717 Ga0068863_100371331
718 Ga0068858_100000033
719 Ga0068858_100911108
720 Ga0068860_100547080
721 Ga0068862_100000828
722 Ga0081455_10019904
723 Ga0081455_10144484
724 Ga0081538_10000173
725 Ga0081538_10000565
726 Ga0081538_10000610
727 Ga0081538_10000701
728 Ga0081538_10002782
729 Ga0081538_10002932
730 Ga0081538_10005038
731 Ga0081538_10005312
732 Ga0081538_10014670
733 Ga0081538_10017188
734 Ga0081538_10075892
735 Ga0081538_10088648
736 Ga0081540_1000323
737 Ga0081540_1073905
738 Ga0081540_1166789
739 Ga0081539_10005999
740 Ga0081539_10122981
741 Ga0075365_10964825
742 Ga0075368_10300958
743 Ga0075364_10077151
744 Ga0075364_10524016
745 Ga0075432_10167587
746 Ga0070712_100052024
747 Ga0075367_10294482
748 Ga0075428_100073841
749 Ga0075428_100115534
750 Ga0075430_100006226
751 Ga0075430_100013611
752 Ga0075430_100184766
753 Ga0075430_100458816
754 Ga0075431_100026085
755 Ga0075431_100218986
756 Ga0075431_100583001
757 Ga0075429_100166399
758 Ga0075429_100685898
759 Ga0068865_100000017
760 Ga0068865_100342225
761 Ga0097620_101166841
762 Ga0097620_101186256
763 Ga0105244_10104677
764 Ga0105240_10764694
765 Ga0105240_11426130
766 Ga0111539_10138359
767 Ga0111539_10194262
768 Ga0105245_10000056
769 Ga0105245_10000161
770 Ga0105245_10006191
771 Ga0105245_10009998
772 Ga0105245_10035086
773 Ga0105245_10280127
774 Ga0105245_10355742
775 Ga0105245_10691698
776 Ga0105247_10000105
777 Ga0105247_10412116
778 Ga0105247_10426907
779 Ga0114129_10003391
780 Ga0114129_10017746
781 Ga0114129_10039894
782 Ga0114129_10041792
783 Ga0114129_11168237
784 Ga0114129_12566281
785 Ga0105243_10174008
786 Ga0105243_10393235
787 Ga0105243_11387803
788 Ga0105243_11719945
789 Ga0105241_10304169
790 Ga0105242_10001190
791 Ga0105242_10087343
792 Ga0105242_10127826
793 Ga0105242_10138434
794 Ga0105242_11350526
795 Ga0105248_10000032
796 Ga0105248_10190283
797 Ga0105248_10410318
798 Ga0105238_10000023
799 Ga0105238_10238867
800 Ga0105238_11815097
801 Ga0105249_10003658
802 Ga0105249_10028680
803 Ga0105249_10164909
804 Ga0105239_10047372
805 Ga0105239_10169723
806 Ga0105239_10243171
807 Ga0105239_10556249
808 Ga0105246_10054079
809 Ga0105246_10063863
810 Ga0105246_10261163
811 Ga0105246_10268607
812 Ga0157371_10001852
813 Ga0157370_10057652
814 Ga0157369_10000130
815 Ga0157369_10162312
816 Ga0157374_10003256
817 Ga0157374_10011225
818 Ga0157374_10037517
819 Ga0157374_10092464
820 Ga0157378_10000533
821 Ga0157378_10017479
822 Ga0157378_10321732
823 Ga0157378_11096711
824 Ga0157372_10000078
825 Ga0157375_10008178
826 Ga0157375_10026472
827 Ga0157375_10252321
828 Ga0157375_10586491
829 Ga0163163_10084660
830 Ga0163163_10211737
831 Ga0163163_10366592
832 Ga0163163_11654713
833 Ga0157380_10000097
834 Ga0157380_10903734
835 Ga0182008_10141888
836 Ga0157377_10002216
837 Ga0157377_10024115
838 Ga0157379_10010922
839 Ga0157379_10220853
840 Ga0157376_10001266
841 Ga0157376_10516093
842 Ga0163161_10387531
843 Ga0163161_10611258
844 Ga0206356_10986902
845 Ga0206349_1001700
846 Ga0206352_10283745
847 Ga0207656_10000467
848 Ga0207656_10006271
849 Ga0207682_10000159
850 Ga0207642_10497574
851 Ga0207710_10000231
852 Ga0207688_10000600
853 Ga0207688_10128544
854 Ga0207680_10014903
855 Ga0207680_10179803
856 Ga0207645_10460535
857 Ga0207643_10003414
858 Ga0207693_10065788
859 Ga0207663_10059701
860 Ga0207663_10692720
861 Ga0207660_10148943
862 Ga0207662_10080980
863 Ga0207649_10000005
864 Ga0207649_10048919
865 Ga0207652_10000577
866 Ga0207694_10000004
867 Ga0207694_10134819
868 Ga0207694_10174079
869 Ga0207650_10016406
870 Ga0207659_10000276
871 Ga0207659_10325952
872 Ga0207659_10929960
873 Ga0207687_10000007
874 Ga0207687_10000026
875 Ga0207687_10001247
876 Ga0207687_10001606
877 Ga0207687_10112787
878 Ga0207687_10299912
879 Ga0207700_10025911
880 Ga0207664_10182849
881 Ga0207644_10190818
882 Ga0207644_10733272
883 Ga0207706_10004007
884 Ga0207706_10009349
885 Ga0207686_10000032
886 Ga0207686_10295115
887 Ga0207686_10723604
888 Ga0207709_10002123
889 Ga0207709_10278225
890 Ga0207670_10075984
891 Ga0207704_10000025
892 Ga0207704_10221813
893 Ga0207691_10045560
894 Ga0207711_10000020
895 Ga0207711_10112733
896 Ga0207711_11359418
897 Ga0207689_10068916
898 Ga0207689_10275760
899 Ga0207661_10000165
900 Ga0207661_10099364
901 Ga0207661_10119244
902 Ga0207661_11041688
903 Ga0207679_10857524
904 Ga0207667_10086552
905 Ga0207651_11308370
906 Ga0207712_10003607
907 Ga0207712_10256219
908 Ga0207712_10639471
909 Ga0207668_10012853
910 Ga0207668_10082386
911 Ga0207640_10000114
912 Ga0207640_10009188
913 Ga0207640_10405497
914 Ga0207658_10057407
915 Ga0207658_10344854
916 Ga0207658_10995017
917 Ga0207677_10132793
918 Ga0207677_10507898
919 Ga0207703_10000126
920 Ga0207703_10023751
921 Ga0207703_10118702
922 Ga0207639_10001697
923 Ga0207639_10489840
924 Ga0207678_10088587
925 Ga0207678_10145655
926 Ga0207708_10006374
927 Ga0207708_10260603
928 Ga0207708_10454336
929 Ga0207708_11040768
930 Ga0207702_10000016
931 Ga0207702_10006884
932 Ga0207702_10033954
933 Ga0207641_10000698
934 Ga0207641_10039668
935 Ga0207648_10101245
936 Ga0207676_10462576
937 Ga0207676_11053135
938 Ga0207674_10037773
939 Ga0207675_100006208
940 Ga0207675_100126680
941 Ga0207675_100790925
942 Ga0207683_10286278
943 Ga0207698_10000041
944 Ga0207698_10115793
945 Ga0207428_10355448
946 Ga0207428_10675617
947 Ga0268266_10002570
948 Ga0268266_10159406
949 Ga0268266_10189660
950 Ga0268266_10451881
951 Ga0268265_10150615
952 Ga0265334_10185212
953 Ga0307511_10028585
954 Ga0316182_1019043
955 Ga0307408_100109744
956 Ga0307408_100315500
957 Ga0307408_100620300
958 Ga0307408_100874744
959 Ga0307405_10101351
960 Ga0307405_10451888
961 Ga0307405_10785811
962 Ga0307413_10214074
963 Ga0307413_10406497
964 Ga0307406_10329791
965 Ga0307406_10339051
966 Ga0307407_10584195
967 Ga0307409_100011885
968 Ga0307409_100063350
969 Ga0307409_100098571
970 Ga0307409_100462050
971 Ga0307416_100006693
972 Ga0307416_100056427
973 Ga0307416_100068129
974 Ga0307416_100767995
975 Ga0307416_101263296
976 Ga0307414_10202131
977 Ga0307411_10240755
978 Ga0307415_100036459
979 Ga0307415_100078464
980 Ga0307415_100733081
981 Ga0373937_0159469
982 Ga0395899_0196872
983 Ga0395900_0014163
984 Ga0395900_0014619
985 Ga0395900_0079051
986 Ga0395900_0132873
987 Ga0395900_0358135
988 Ga0395898_0014693
989 Ga0395898_0107896
990 Ga0395898_0197335
991 Ga0395898_0248811
992 Ga0395898_0371608
993 Ga0395898_1326543
994 Ga0395905_0015283
995 Ga0395905_0079744
996 Ga0395905_0764632
997 Ga0395901_0017271
998 Ga0395901_0018642
999 Ga0395901_0025425
1000 Ga0395901_0160984
1001 Ga0395901_0639881
1002 Ga0451802_1307960
1003 Ga0451804_1140728
1004 Ga0451807_0617074
1005 Ga0451845_0117207
1006 Ga0451849_0734067
1007 Ga0451853_1178070
1008 Ga0451853_3041607
1009 Ga0451853_3663636
1010 Ga0451853_3699005
1011 Ga0439432_176539
1012 Ga0450906_025945
1013 Ga0450907_016298
1014 Ga0439435_0034521
1015 Ga0439444_0018304
1016 Ga0495641_0000003
1017 Ga0495641_0013046
1018 Ga0495641_0309525
1019 Ga0495653_0135718
1020 Ga0495653_0340093
1021 Ga0495639_0255850
1022 Ga0495585_0294081
1023 Ga0495594_0000032
1024 Ga0495596_0072322
1025 Ga0495607_0120913
1026 Ga0495606_0000057
1027 Ga0495608_0018926
1028 Ga0495628_0001941
1029 Ga0495628_0054992
1030 Ga0495630_0000025
1031 Ga0495630_0245246
1032 Ga0495644_0001082
1033 Ga0495644_0270362
1034 Ga0495652_0005028
1035 Ga0495640_0171776
1036 Ga0495587_0090679
1037 Ga0495598_0014271
1038 Ga0495645_0057562
1039 Ga0495645_0307922
1040 Ga0495622_0000050
1041 Ga0495667_0000022
1042 Ga0495656_0000342
1043 Ga0495656_0158612
1044 Ga0495668_0454070
1045 Ga0495625_0000029
1046 Ga0495657_0012645
1047 Ga0495599_0007615
1048 Ga0495646_0184297
1049 Ga0495647_0000015
1050 Ga0495647_0004796
1051 Ga0495658_0001810
1052 Ga0495669_0000130
1053 Ga0495613_0000109
1054 Ga0495624_0000030
1055 Ga0495624_0000241
1056 Ga0495649_0006497
1057 Ga0495589_0188345
1058 Ga0495660_0298075
1059 Ga0495604_0069513
1060 Ga0495674_0000020
1061 Ga0495672_0048393
1062 Ga0495672_0085523
1063 Ga0495672_0118556
1064 Ga0495676_0000283
1065 Ga0495676_0005012
1066 Ga0495680_0004998
1067 Ga0495680_0009589
1068 Ga0495593_0053904
1069 Ga0495602_0000720
1070 Ga0496100_0000007
1071 Ga0496100_0000049
1072 Ga0496101_0000010
1073 Ga0496101_0000013
1074 Ga0496102_0000546
1075 Ga0496102_0151796
1076 Ga0496103_0000368
1077 Ga0496104_0000013
1078 Ga0496104_0098261
1079 Ga0496104_0232405
1080 Ga0496104_1216503
1081 Ga0496105_0000006
1082 Ga0496105_0005390
1083 Ga0496105_0808480
1084 Ga0496106_0000006
1085 Ga0496106_0000018
1086 Ga0496107_0000007
1087 Ga0496107_0000032
1088 Ga0496107_0179138
1089 Ga0496108_0000001
1090 Ga0496108_0000045
1091 Ga0496108_0005148
1092 Ga0496108_0007526
1093 Ga0496108_0224267
1094 Ga0496108_0540634
1095 Ga0496109_0000006
1096 Ga0496109_0000032
1097 Ga0496109_0000039
1098 Ga0496109_0013993
1099 Ga0496109_0023940
1100 Ga0496109_0078107
1101 Ga0496109_0351857
1102 Ga0496110_0000018
1103 Ga0496110_0003300
1104 Ga0496110_0010056
1105 Ga0496110_0036076
1106 Ga0496110_0087232
1107 Ga0496110_0891702
1108 Ga0496110_1153216
1109 Ga0496111_0000015
1110 Ga0496111_0002028
1111 Ga0496111_0048976
1112 Ga0496111_0065017
1113 Ga0496111_0105754
1114 Ga0496111_0217414
1115 Ga0496111_0229531
1116 Ga0496112_0000258
1117 Ga0496112_0229276
1118 Ga0496113_0000009
1119 Ga0496113_0025906
1120 Ga0496113_0071578
1121 Ga0496113_0085912
1122 Ga0496113_0728366
1123 Ga0496114_0000003
1124 Ga0496114_0002643
1125 Ga0496114_0077448
1126 Ga0496114_0084433
1127 Ga0496114_0477849
1128 Ga0496115_0000036
1129 Ga0496124_0480686
1130 Ga0501031_0022602
1131 Ga0501033_0036566
1132 Ga0501036_0078109
1133 Ga0501036_0218079
1134 Ga0501038_0059585
1135 Ga0501039_0049196
1136 Ga0501039_0061164
1137 Ga0501039_1078515
1138 Ga0501040_0002792
1139 Ga0501040_0013812
1140 Ga0501040_0084835
1141 Ga0501041_0003126
1142 Ga0501041_0092194
1143 Ga0501041_0131075
1144 Ga0501041_0224733
1145 Ga0501041_0803758
1146 Ga0501042_0035218
1147 Ga0501042_0043004
1148 Ga0501042_0049583
1149 Ga0501043_0085134
1150 Ga0501043_0435519
1151 Ga0501046_0114263
1152 Ga0501048_0018043
1153 Ga0501048_0094689
1154 Ga0501067_0121909
1155 Ga0501069_0187920
1156 Ga0501071_0018260
1157 Ga0501071_0746832
1158 Ga0501072_0043467
1159 Ga0501072_0058425
1160 Ga0501072_0083625
1161 Ga0501072_0413499
1162 Ga0501072_0539730
1163 Ga0501074_0034413
1164 Ga0501074_0134531
1165 Ga0501074_0182436
1166 Ga0501075_0011238
1167 Ga0501075_0032656
1168 Ga0501075_0162590
1169 Ga0501076_0009190
1170 Ga0501076_0018165
1171 Ga0501076_0079359
1172 Ga0501076_0437941
1173 Ga0501077_0004431
1174 Ga0501077_0140167
1175 Ga0501077_0630545
1176 Ga0501217_087511
1177 Ga0501230_061587
1178 Ga0501235_053400
1179 Ga0501247_037997
1180 Ga0501079_0000542
1181 Ga0501079_0020080
1182 Ga0501079_0099141
1183 Ga0501079_0590818
1184 Ga0501080_0297888
1185 Ga0501080_0987779
1186 Ga0501081_0015257
1187 Ga0501081_0030112
1188 Ga0501081_0128759
1189 Ga0501081_0524006
1190 Ga0501267_034586
1191 Ga0501271_020355
1192 Ga0501035_0404003
1193 Ga0501044_0593790
1194 Ga0501045_0012422
1195 Ga0501045_0037441
1196 Ga0501045_0208470
1197 Ga0501045_0216206
1198 nmdc:mga00v17_163845_c1
1199 nmdc:mga0yw44_546975_c1
1200 nmdc:mga05p37_1368333_c1
1201 nmdc:mga05p37_142918_c1
1202 nmdc:mga05p37_15347_c1
1203 nmdc:mga05p37_22290_c1
1204 nmdc:mga05p37_256067_c1
1205 nmdc:mga09592_2462_c1
1206 nmdc:mga09592_83093_c1
1207 nmdc:mga0qj67_276704_c1
1208 nmdc:mga0qj67_4420_c1
1209 nmdc:mga06r32_112373_c1
1210 nmdc:mga06r32_150413_c1
1211 nmdc:mga06r32_42766_c1
1212 nmdc:mga08y16_1522521_c1
1213 nmdc:mga08y16_152590_c1
1214 nmdc:mga0n895_674176_c1
1215 nmdc:mga0rr50_1045446_c1
1216 Ga0495601_0000260
1217 Ga0495601_0172541
1218 Ga0495612_0070213
1219 Ga0495655_0000004
1220 Ga0495655_0247569
1221 Ga0495595_0043236
1222 Ga0500628_000049
1223 Ga0501084_0027832
1224 Ga0501084_0056216
1225 Ga0590071_002978
1226 Ga0590074_005066
1227 Ga0590075_021710
1228 Ga0590077_005764
1229 Ga0501082_0476701
1230 Ga0501082_0625456
1231 Ga0530510_0005145
1232 Ga0530510_0051555
1233 Ga0530510_0161448
1234 Ga0530510_0176520

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

2

170

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.7405 1 174
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.7297 1 174
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7168 2 176
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.7153 1 177
2gd9-assembly1.cif.gz_A crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.7146 2 174
ID Description Score Start End Superfamily
af_F7FH45_6_315_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7437 156 174 1.10.510.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.725 2 178 3.40.430.10
af_Q9M8J5_33_129_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7239 155 173 3.30.200.20
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7153 1 177 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7144 2 178 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A7Y6CVS9-F1-model_v4 Deaminase 0.9649 1 177 GO:0008703
GO:0009231
AF-A0A7Y6CVS9-F1-model_v4 Deaminase 0.9596 1 177 GO:0008703
GO:0009231
AF-A0A6F8YY66-F1-model_v4 Deaminase 0.9294 1 182 GO:0008703
GO:0009231
AF-A0A7X5ZXU1-F1-model_v4 Dihydrofolate reductase 0.929 45 177 GO:0008703
GO:0009231
AF-A0A6F8YY66-F1-model_v4 Deaminase 0.9245 1 182 GO:0008703
GO:0009231

Map