F469692

General Info

Members Datasets Scaffolds Average Seq Length
617 316 578 157

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2932398195|2932400380
Length 186
Sequence SGREAVAVQNLPRSNIGRVTDTSPARPAPTPTYRLWQKATRLPLGSRLFSAAVSLKAPYFRTALPHVVELRPGRCVVRGPGWWGNRNHIGTFHVIAACNLAEMAMGMLAEATVPATHRWIPVGMNVRYPAMSTGGMTVTAEWAEVPDFSAFTSGRDVEVPLRFVDDAGVEPVVGSITIRVSPKKKR

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2547132424 Nocardia nova SH22a Isolate Unclassified
3 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
4 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
5 2582580736 Prauserella sp. Am3 Isolate Unclassified
6 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
7 2643221692 Nocardia sp. Root136 Isolate Unclassified
8 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
9 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
10 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
11 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
12 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
13 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
14 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
15 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
16 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
17 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
18 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
19 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
20 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
21 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
22 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
23 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
24 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
25 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
26 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
27 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
28 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
29 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
30 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
31 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
32 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
33 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
34 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
35 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
36 2922554459 Rhodococcus sp. 66b Isolate Unclassified
37 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
38 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
39 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
40 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
41 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
42 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
43 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
44 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
45 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
46 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
47 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
48 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
49 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
55 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
56 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
67 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
68 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
69 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
70 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
71 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
72 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
73 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
105 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
106 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
107 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
108 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
109 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
110 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
113 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
114 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
115 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
116 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
139 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
140 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
141 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
149 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
202 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
216 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
217 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
218 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
219 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
220 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
221 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
222 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
223 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
224 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
227 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
228 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
229 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
230 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
231 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
232 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
233 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
234 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
235 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
244 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
248 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
260 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
261 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
262 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
263 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
281 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
282 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
283 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
284 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
287 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
288 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
289 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
290 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
304 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
305 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
306 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
307 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
308 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
309 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
310 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
313 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
314 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
315 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
316 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.68
Metatranscriptomes 0
Isolates 6.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.7
Nodule 0
Rhizoplane 11.51
Rhizosphere 66.29
Stem 0
Stem Tuber 0.16
Unclassified 11.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1005802 3300001977 Bacteria 1923
2 JGI24747J21853_1008179 3300001978 Bacteria 1018
3 JGI24737J22298_10014598 3300001990 Bacteria 2549
4 JGI24743J22301_10033037 3300001991 Bacteria 1023
5 JGI24750J21931_1017330 3300002070 Bacteria 984
6 JGI24748J21848_1006142 3300002074 Bacteria 1398
7 JGI24738J21930_10029895 3300002075 Bacteria 1113
8 JGI24738J21930_10085128 3300002075 Bacteria 664
9 JGI24749J21850_1001482 3300002076 Bacteria 3317
10 JGI24744J21845_10006268 3300002077 Bacteria 2470
11 JGI24744J21845_10006461 3300002077 Bacteria 2432
12 rootH2_10054791 3300003320 Bacteria 2183
13 Ga0055540_1000310 3300003792 Bacteria 43239
14 Ga0070690_100030604 3300005330 Bacteria 3347
15 Ga0070670_101882473 3300005331 Bacteria 551
16 Ga0070666_10020444 3300005335 Bacteria 4279
17 Ga0070682_100052723 3300005337 Bacteria 2546
18 Ga0070682_100067098 3300005337 Bacteria 2284
19 Ga0070682_100478971 3300005337 Bacteria 959
20 Ga0068868_100001415 3300005338 Bacteria 16532
21 Ga0068868_100230363 3300005338 Bacteria 1554
22 Ga0068868_100254990 3300005338 Bacteria 1477
23 Ga0070691_10000993 3300005341 Bacteria 11610
24 Ga0070691_10255394 3300005341 Bacteria 942
25 Ga0070692_10194579 3300005345 Bacteria 1184
26 Ga0070692_10643451 3300005345 Bacteria 707
27 Ga0070668_100012605 3300005347 Bacteria 6294
28 Ga0070668_100128023 3300005347 Bacteria 2035
29 Ga0070668_100534567 3300005347 Bacteria 1018
30 Ga0070669_100013486 3300005353 Bacteria 5810
31 Ga0070669_100218066 3300005353 Bacteria 1508
32 Ga0070675_100091794 3300005354 Bacteria 2545
33 Ga0070671_100014779 3300005355 Bacteria 6308
34 Ga0070671_100094107 3300005355 Bacteria 2511
35 Ga0070671_100395718 3300005355 Bacteria 1181
36 Ga0070674_100014834 3300005356 Bacteria 4850
37 Ga0070674_100391035 3300005356 Bacteria 1134
38 Ga0070673_100448142 3300005364 Bacteria 1161
39 Ga0070673_100899479 3300005364 Bacteria 821
40 Ga0070688_100346590 3300005365 Bacteria 1086
41 Ga0070688_100347530 3300005365 Bacteria 1085
42 Ga0070659_100156812 3300005366 Bacteria 1859
43 Ga0070667_100000074 3300005367 Bacteria 121299
44 Ga0070667_100010381 3300005367 Bacteria 7689
45 Ga0070667_100012216 3300005367 Bacteria 7104
46 Ga0070667_100058927 3300005367 Bacteria 3247
47 Ga0070703_10071407 3300005406 Bacteria 1161
48 Ga0070709_10087187 3300005434 Bacteria 2050
49 Ga0070714_100090563 3300005435 Bacteria 2679
50 Ga0070714_100138272 3300005435 Bacteria 2184
51 Ga0070714_100589916 3300005435 Bacteria 1066
52 Ga0070713_100008336 3300005436 Bacteria 7350
53 Ga0070713_100458583 3300005436 Bacteria 1198
54 Ga0070710_10000625 3300005437 Bacteria 16827
55 Ga0070711_100000779 3300005439 Bacteria 16650
56 Ga0070705_100213085 3300005440 Bacteria 1333
57 Ga0070705_100786635 3300005440 Bacteria 756
58 Ga0070700_100007418 3300005441 Bacteria 5921
59 Ga0070700_100136084 3300005441 Bacteria 1664
60 Ga0070694_100074426 3300005444 Bacteria 2347
61 Ga0070663_100000114 3300005455 Bacteria 37448
62 Ga0070663_100049375 3300005455 Bacteria 2987
63 Ga0070663_100049406 3300005455 Bacteria 2987
64 Ga0070663_100236612 3300005455 Bacteria 1440
65 Ga0070663_100333261 3300005455 Bacteria 1224
66 Ga0070678_100005866 3300005456 Bacteria 7144
67 Ga0070678_100040956 3300005456 Bacteria 3281
68 Ga0070662_100008435 3300005457 Bacteria 6717
69 Ga0068867_100002834 3300005459 Bacteria 12189
70 Ga0070679_100295811 3300005530 Bacteria 1570
71 Ga0068853_100081495 3300005539 Bacteria 2833
72 Ga0068853_100103348 3300005539 Bacteria 2522
73 Ga0070672_100093139 3300005543 Bacteria 2433
74 Ga0070672_100168084 3300005543 Bacteria 1822
75 Ga0070672_101259469 3300005543 Bacteria 660
76 Ga0070686_100416238 3300005544 Bacteria 1025
77 Ga0070686_101295083 3300005544 Bacteria 608
78 Ga0070695_100011783 3300005545 Bacteria 5235
79 Ga0070696_100004591 3300005546 Bacteria 9224
80 Ga0070693_100025689 3300005547 Bacteria 3172
81 Ga0070665_100006624 3300005548 Bacteria 11771
82 Ga0070665_100006765 3300005548 Bacteria 11653
83 Ga0070665_100027663 3300005548 Bacteria 5710
84 Ga0070665_100082698 3300005548 Bacteria 3216
85 Ga0070665_100311045 3300005548 Bacteria 1579
86 Ga0070665_101162051 3300005548 Bacteria 783
87 Ga0070704_100006863 3300005549 Bacteria 6741
88 Ga0070704_100014418 3300005549 Bacteria 4936
89 Ga0070664_100214014 3300005564 Bacteria 1722
90 Ga0068854_100004108 3300005578 Bacteria 9146
91 Ga0068854_101079550 3300005578 Bacteria 714
92 Ga0068856_100155371 3300005614 Bacteria 2298
93 Ga0070702_100147404 3300005615 Bacteria 1506
94 Ga0068852_100422694 3300005616 Bacteria 1315
95 Ga0068852_101074800 3300005616 Bacteria 824
96 Ga0068859_100001947 3300005617 Bacteria 21042
97 Ga0068859_100045871 3300005617 Bacteria 4390
98 Ga0068859_100255934 3300005617 Bacteria 1841
99 Ga0068859_100526038 3300005617 Bacteria 1277
100 Ga0068859_101911001 3300005617 Bacteria 655
101 Ga0068864_100671221 3300005618 Bacteria 1010
102 Ga0068866_10000713 3300005718 Bacteria 15113
103 Ga0068866_10097509 3300005718 Bacteria 1615
104 Ga0068866_10655532 3300005718 Bacteria 715
105 Ga0068861_100001091 3300005719 Bacteria 16779
106 Ga0068861_100357959 3300005719 Bacteria 1282
107 Ga0068861_100530037 3300005719 Bacteria 1069
108 Ga0068861_101198561 3300005719 Bacteria 734
109 Ga0068851_10292021 3300005834 Bacteria 935
110 Ga0068851_10325659 3300005834 Bacteria 889
111 Ga0068870_10226944 3300005840 Bacteria 1146
112 Ga0068863_100003806 3300005841 Bacteria 14917
113 Ga0068863_100093811 3300005841 Bacteria 2848
114 Ga0068863_100337607 3300005841 Bacteria 1465
115 Ga0068863_101609353 3300005841 Bacteria 659
116 Ga0068858_100003437 3300005842 Bacteria 15731
117 Ga0068858_100039329 3300005842 Bacteria 4386
118 Ga0068858_100043630 3300005842 Bacteria 4158
119 Ga0068860_100000276 3300005843 Bacteria 74447
120 Ga0068860_100002734 3300005843 Bacteria 18350
121 Ga0068860_100392514 3300005843 Bacteria 1371
122 Ga0068862_100001732 3300005844 Bacteria 19723
123 Ga0068862_100128392 3300005844 Bacteria 2240
124 Ga0068862_100136707 3300005844 Bacteria 2172
125 Ga0081455_10000111 3300005937 Bacteria 92306
126 Ga0081455_10013864 3300005937 Bacteria 7928
127 Ga0081455_10230178 3300005937 Bacteria 1368
128 Ga0070717_11932399 3300006028 Bacteria 532
129 Ga0075365_10488813 3300006038 Bacteria 870
130 Ga0075368_10024563 3300006042 Bacteria 2310
131 Ga0075363_100001616 3300006048 Bacteria 8674
132 Ga0075363_100102706 3300006048 Bacteria 1583
133 Ga0075363_100185955 3300006048 Bacteria 1183
134 Ga0075363_100273775 3300006048 Bacteria 975
135 Ga0075364_10001045 3300006051 Bacteria 14742
136 Ga0075364_10009927 3300006051 Bacteria 5726
137 Ga0075364_10020759 3300006051 Bacteria 4133
138 Ga0075364_10158038 3300006051 Bacteria 1529
139 Ga0075364_10371044 3300006051 Bacteria 976
140 Ga0075364_10414031 3300006051 Bacteria 920
141 Ga0070715_10000635 3300006163 Bacteria 9315
142 Ga0070716_100002576 3300006173 Bacteria 8388
143 Ga0070712_100000676 3300006175 Bacteria 20159
144 Ga0070712_101044812 3300006175 Bacteria 708
145 Ga0075362_10021083 3300006177 Bacteria 2730
146 Ga0075362_10149544 3300006177 Bacteria 1120
147 Ga0075367_10346589 3300006178 Bacteria 937
148 Ga0075367_10586431 3300006178 Bacteria 708
149 Ga0075369_10000284 3300006186 Bacteria 15139
150 Ga0075369_10191758 3300006186 Bacteria 942
151 Ga0075369_10222080 3300006186 Bacteria 875
152 Ga0075369_10465168 3300006186 Bacteria 599
153 Ga0075366_10241254 3300006195 Bacteria 1102
154 Ga0097621_100057941 3300006237 Bacteria 3170
155 Ga0075370_10001554 3300006353 Bacteria 10055
156 Ga0075370_10016043 3300006353 Bacteria 4025
157 Ga0075370_10063111 3300006353 Bacteria 2111
158 Ga0075370_10067592 3300006353 Bacteria 2040
159 Ga0075370_10157787 3300006353 Bacteria 1331
160 Ga0075370_10377709 3300006353 Bacteria 849
161 Ga0075370_10440648 3300006353 Bacteria 783
162 Ga0068871_100017304 3300006358 Bacteria 5451
163 Ga0075429_100117062 3300006880 Bacteria 2329
164 Ga0068865_100001202 3300006881 Bacteria 15069
165 Ga0068865_100050893 3300006881 Bacteria 2864
166 Ga0097620_100001947 3300006931 Bacteria 21042
167 Ga0097620_100045866 3300006931 Bacteria 4390
168 Ga0097620_100255933 3300006931 Bacteria 1841
169 Ga0097620_100526037 3300006931 Bacteria 1277
170 Ga0097620_101911225 3300006931 Bacteria 655
171 Ga0099795_10048846 3300007788 Bacteria 1534
172 Ga0105250_10074376 3300009092 Bacteria 1374
173 Ga0105250_10242427 3300009092 Bacteria 769
174 Ga0105250_10559900 3300009092 Bacteria 525
175 Ga0105240_11410067 3300009093 Bacteria 732
176 Ga0105245_10877675 3300009098 Bacteria 938
177 Ga0105245_11702527 3300009098 Bacteria 683
178 Ga0105247_10001090 3300009101 Bacteria 20246
179 Ga0105247_10059773 3300009101 Bacteria 2361
180 Ga0105247_10408556 3300009101 Bacteria 969
181 Ga0105247_10548872 3300009101 Bacteria 849
182 Ga0105243_10000567 3300009148 Bacteria 37383
183 Ga0105243_10011286 3300009148 Bacteria 6758
184 Ga0105243_10213235 3300009148 Bacteria 1702
185 Ga0105241_10083984 3300009174 Bacteria 2499
186 Ga0105241_10620195 3300009174 Bacteria 979
187 Ga0105242_10001916 3300009176 Bacteria 16354
188 Ga0105248_10000721 3300009177 Bacteria 37448
189 Ga0105248_10195742 3300009177 Bacteria 2277
190 Ga0105248_10324419 3300009177 Bacteria 1734
191 Ga0105248_10847279 3300009177 Bacteria 1032
192 Ga0105237_10009127 3300009545 Bacteria 10656
193 Ga0105237_10010614 3300009545 Bacteria 9783
194 Ga0105237_10145052 3300009545 Bacteria 2369
195 Ga0105238_10050044 3300009551 Bacteria 4207
196 Ga0105249_10000096 3300009553 Bacteria 121083
197 Ga0105249_10001553 3300009553 Bacteria 20153
198 Ga0105249_10694836 3300009553 Bacteria 1077
199 Ga0105239_10005526 3300010375 Bacteria 14802
200 Ga0105239_10023869 3300010375 Bacteria 6734
201 Ga0105239_10165655 3300010375 Bacteria 2471
202 Ga0105239_10457141 3300010375 Bacteria 1449
203 Ga0105239_10537646 3300010375 Bacteria 1330
204 Ga0105246_10030677 3300011119 Bacteria 3552
205 Ga0157371_10191288 3300013102 Bacteria 1465
206 Ga0157371_10609019 3300013102 Bacteria 813
207 Ga0157374_10160023 3300013296 Bacteria 2193
208 Ga0157378_10064890 3300013297 Bacteria 3267
209 Ga0163162_10015089 3300013306 Bacteria 7546
210 Ga0163162_10082483 3300013306 Bacteria 3288
211 Ga0163162_10087685 3300013306 Bacteria 3191
212 Ga0163162_10134946 3300013306 Bacteria 2578
213 Ga0163162_10442984 3300013306 Bacteria 1431
214 Ga0157372_10015409 3300013307 Bacteria 8193
215 Ga0157372_10434600 3300013307 Bacteria 1530
216 Ga0157375_10436155 3300013308 Bacteria 1476
217 Ga0163163_10006752 3300014325 Bacteria 10058
218 Ga0163163_11237405 3300014325 Bacteria 809
219 Ga0157380_10008931 3300014326 Bacteria 7162
220 Ga0157380_10643862 3300014326 Bacteria 1056
221 Ga0157377_10055018 3300014745 Bacteria 2255
222 Ga0157377_10135323 3300014745 Bacteria 1509
223 Ga0157379_10032279 3300014968 Bacteria 4668
224 Ga0157379_10039814 3300014968 Bacteria 4194
225 Ga0157379_10106578 3300014968 Bacteria 2516
226 Ga0157379_10770096 3300014968 Bacteria 907
227 Ga0157376_10117552 3300014969 Bacteria 2351
228 Ga0163161_10001600 3300017792 Bacteria 16695
229 Ga0213876_10033075 3300021384 Bacteria 2726
230 Ga0213875_10132337 3300021388 Bacteria 1166
231 Ga0209025_1081288 3300025294 Bacteria 1099
232 Ga0209051_1000051 3300025303 Bacteria 283620
233 Ga0207696_1153744 3300025711 Bacteria 614
234 Ga0207642_10000255 3300025899 Bacteria 15903
235 Ga0207642_10506452 3300025899 Bacteria 740
236 Ga0207710_10000033 3300025900 Bacteria 260531
237 Ga0207710_10006308 3300025900 Bacteria 5072
238 Ga0207688_10003298 3300025901 Bacteria 8817
239 Ga0207688_10005250 3300025901 Bacteria 7036
240 Ga0207647_10242111 3300025904 Bacteria 1036
241 Ga0207685_10030557 3300025905 Bacteria 1919
242 Ga0207699_10010549 3300025906 Bacteria 4642
243 Ga0207654_10144861 3300025911 Bacteria 1519
244 Ga0207654_10434951 3300025911 Bacteria 918
245 Ga0207671_10012398 3300025914 Bacteria 6856
246 Ga0207671_10127778 3300025914 Bacteria 1949
247 Ga0207693_10006799 3300025915 Bacteria 9444
248 Ga0207663_10008390 3300025916 Bacteria 5399
249 Ga0207663_10231597 3300025916 Bacteria 1350
250 Ga0207663_10856266 3300025916 Bacteria 726
251 Ga0207657_10638954 3300025919 Bacteria 829
252 Ga0207652_10286376 3300025921 Bacteria 1487
253 Ga0207681_10000456 3300025923 Bacteria 28674
254 Ga0207687_10002110 3300025927 Bacteria 13589
255 Ga0207687_10211805 3300025927 Bacteria 1521
256 Ga0207664_10049368 3300025929 Bacteria 3312
257 Ga0207664_10869462 3300025929 Bacteria 810
258 Ga0207664_11340331 3300025929 Bacteria 636
259 Ga0207644_10024252 3300025931 Bacteria 4162
260 Ga0207644_10387691 3300025931 Bacteria 1140
261 Ga0207690_10292307 3300025932 Bacteria 1272
262 Ga0207690_11191103 3300025932 Bacteria 636
263 Ga0207706_10032351 3300025933 Bacteria 4659
264 Ga0207706_10054401 3300025933 Bacteria 3532
265 Ga0207709_10000305 3300025935 Bacteria 53275
266 Ga0207709_10020338 3300025935 Bacteria 3743
267 Ga0207670_10010722 3300025936 Bacteria 5289
268 Ga0207669_10000192 3300025937 Bacteria 27738
269 Ga0207669_10025314 3300025937 Bacteria 3205
270 Ga0207669_10485695 3300025937 Bacteria 985
271 Ga0207704_10002317 3300025938 Bacteria 8556
272 Ga0207665_10007326 3300025939 Bacteria 7300
273 Ga0207691_10168321 3300025940 Bacteria 1920
274 Ga0207711_10009740 3300025941 Bacteria 7994
275 Ga0207711_10096355 3300025941 Bacteria 2611
276 Ga0207711_10150308 3300025941 Bacteria 2101
277 Ga0207711_10834271 3300025941 Bacteria 858
278 Ga0207689_10031302 3300025942 Bacteria 4430
279 Ga0207689_10052190 3300025942 Bacteria 3370
280 Ga0207679_10947737 3300025945 Bacteria 788
281 Ga0207667_11811825 3300025949 Bacteria 574
282 Ga0207651_10013280 3300025960 Bacteria 4706
283 Ga0207712_10000005 3300025961 Bacteria 608697
284 Ga0207712_10202011 3300025961 Bacteria 1577
285 Ga0207668_10000752 3300025972 Bacteria 19808
286 Ga0207668_10001576 3300025972 Bacteria 13315
287 Ga0207668_10052819 3300025972 Bacteria 2813
288 Ga0207640_10002625 3300025981 Bacteria 9635
289 Ga0207640_10287126 3300025981 Bacteria 1295
290 Ga0207658_10000517 3300025986 Bacteria 35169
291 Ga0207658_10006561 3300025986 Bacteria 7937
292 Ga0207658_10035209 3300025986 Bacteria 3584
293 Ga0207677_10008380 3300026023 Bacteria 5770
294 Ga0207677_10131991 3300026023 Bacteria 1898
295 Ga0207703_10007479 3300026035 Bacteria 8676
296 Ga0207703_10655079 3300026035 Bacteria 996
297 Ga0207639_10482122 3300026041 Bacteria 1130
298 Ga0207678_10000289 3300026067 Bacteria 45690
299 Ga0207678_10011571 3300026067 Bacteria 7749
300 Ga0207678_10044848 3300026067 Bacteria 3823
301 Ga0207678_10161599 3300026067 Bacteria 1913
302 Ga0207708_10011722 3300026075 Bacteria 6534
303 Ga0207708_10025129 3300026075 Bacteria 4504
304 Ga0207708_10120349 3300026075 Bacteria 2045
305 Ga0207708_10764475 3300026075 Unclassified 830
306 Ga0207702_10478313 3300026078 Bacteria 1212
307 Ga0207641_10001384 3300026088 Bacteria 23892
308 Ga0207641_10039593 3300026088 Bacteria 3943
309 Ga0207648_10002256 3300026089 Bacteria 20849
310 Ga0207675_100002064 3300026118 Bacteria 20030
311 Ga0207675_100023278 3300026118 Bacteria 5761
312 Ga0207683_10001521 3300026121 Bacteria 20891
313 Ga0207683_10368685 3300026121 Bacteria 1319
314 Ga0207683_10551910 3300026121 Bacteria 1065
315 Ga0207698_10206187 3300026142 Bacteria 1765
316 Ga0207698_11451604 3300026142 Bacteria 701
317 Ga0209813_10060796 3300027866 Bacteria 1205
318 Ga0268266_10007148 3300028379 Bacteria 10116
319 Ga0268266_10012998 3300028379 Bacteria 7178
320 Ga0268265_10000022 3300028380 Bacteria 270788
321 Ga0268265_10122064 3300028380 Bacteria 2148
322 Ga0268265_10350654 3300028380 Bacteria 1347
323 Ga0268264_10000005 3300028381 Bacteria 934972
324 Ga0268264_10005951 3300028381 Bacteria 10323
325 Ga0268264_10461616 3300028381 Bacteria 1232
326 Ga0268264_11634080 3300028381 Bacteria 655
327 Ga0307512_10103143 3300030522 Bacteria 1921
328 Ga0265327_10000532 3300031251 Bacteria 65543
329 Ga0265327_10002587 3300031251 Bacteria 18728
330 Ga0265327_10035443 3300031251 Bacteria 2758
331 Ga0307405_10251619 3300031731 Bacteria 1315
332 Ga0307405_11238082 3300031731 Bacteria 647
333 Ga0307413_10000652 3300031824 Bacteria 11745
334 Ga0307413_10126751 3300031824 Bacteria 1740
335 Ga0307413_10169149 3300031824 Bacteria 1545
336 Ga0307413_11182422 3300031824 Bacteria 664
337 Ga0307518_10000287 3300031838 Bacteria 38350
338 Ga0307518_10484367 3300031838 Bacteria 645
339 Ga0307406_10503096 3300031901 Bacteria 983
340 Ga0307409_100165311 3300031995 Bacteria 1941
341 Ga0307409_100523706 3300031995 Bacteria 1159
342 Ga0307409_100714963 3300031995 Bacteria 1002
343 Ga0307409_101957204 3300031995 Bacteria 616
344 Ga0307416_100274418 3300032002 Bacteria 1658
345 Ga0307411_10146022 3300032005 Bacteria 1751
346 Ga0307507_10006482 3300033179 Bacteria 17943
347 Ga0373931_0056133 3300035691 Bacteria 2109
348 Ga0436364_0388253 3300037853 Bacteria 2227
349 Ga0436364_0588322 3300037853 Bacteria 80195
350 Ga0395901_0671653 3300038443 Bacteria 1037
351 Ga0436365_0239327 3300039437 Bacteria 5116
352 Ga0436363_0781113 3300039450 Bacteria 926
353 Ga0439461_0011946 3300041410 Bacteria 1619
354 Ga0439466_0001181 3300041411 Bacteria 10165
355 Ga0439465_0004465 3300041413 Bacteria 4526
356 Ga0439465_0018882 3300041413 Bacteria 2154
357 Ga0439465_0039049 3300041413 Bacteria 1531
358 Ga0439465_0087165 3300041413 Bacteria 1064
359 Ga0451804_0279687 3300041463 Bacteria 1098
360 Ga0451845_0338184 3300041501 Bacteria 625
361 Ga0439431_0000355 3300041997 Bacteria 9648
362 Ga0439442_016467 3300042002 Bacteria 1524
363 Ga0439445_0006922 3300042004 Bacteria 2619
364 Ga0439445_0052322 3300042004 Bacteria 1104
365 Ga0439448_0022432 3300042005 Bacteria 1962
366 Ga0439449_0083178 3300042007 Bacteria 1181
367 Ga0466969_0011887 3300044656 Bacteria 4603
368 Ga0466972_0004559 3300044658 Bacteria 6941
369 Ga0466972_0005487 3300044658 Bacteria 6353
370 Ga0466972_0056741 3300044658 Bacteria 1883
371 Ga0466965_0001377 3300044683 Bacteria 9751
372 Ga0466965_0049266 3300044683 Bacteria 2088
373 Ga0466965_0207730 3300044683 Bacteria 1040
374 Ga0466966_0007740 3300044684 Bacteria 7116
375 Ga0466961_0006810 3300044693 Bacteria 7272
376 Ga0466963_0077023 3300044694 Bacteria 2253
377 Ga0466963_0415932 3300044694 Bacteria 948
378 Ga0466964_0018431 3300044706 Bacteria 2679
379 Ga0466971_0025872 3300044719 Bacteria 2621
380 Ga0466968_0058046 3300044735 Bacteria 1665
381 Ga0466968_0142236 3300044735 Bacteria 1098
382 Ga0466970_0001021 3300044765 Bacteria 13508
383 Ga0466970_0096420 3300044765 Bacteria 1608
384 Ga0466970_0123878 3300044765 Bacteria 1417
385 Ga0466957_0001124 3300044842 Bacteria 13849
386 Ga0466957_0301626 3300044842 Bacteria 1076
387 Ga0466957_0832435 3300044842 Bacteria 657
388 Ga0466960_0602942 3300044901 Bacteria 652
389 Ga0466959_0001193 3300045049 Bacteria 15686
390 Ga0466959_0015907 3300045049 Bacteria 5489
391 Ga0466958_0000806 3300045836 Bacteria 13817
392 Ga0466967_0040235 3300045976 Bacteria 4023
393 Ga0466967_0535418 3300045976 Bacteria 1152
394 Ga0466967_0655764 3300045976 Bacteria 1038
395 Ga0466967_0676626 3300045976 Bacteria 1021
396 Ga0495629_0007927 3300046459 Bacteria 7813
397 Ga0495580_0404535 3300046472 Bacteria 920
398 Ga0495582_0653640 3300046473 Bacteria 608
399 Ga0495664_0540266 3300046477 Bacteria 695
400 Ga0495606_0162914 3300046507 Bacteria 1300
401 Ga0495630_0309683 3300046517 Bacteria 1207
402 Ga0495642_0140625 3300046528 Bacteria 1042
403 Ga0495665_0042268 3300046531 Bacteria 2426
404 Ga0495665_0256926 3300046531 Bacteria 899
405 Ga0495656_0326910 3300046615 Bacteria 791
406 Ga0495656_0439033 3300046615 Bacteria 687
407 Ga0495668_0000509 3300046616 Bacteria 48446
408 Ga0495668_0010731 3300046616 Bacteria 5531
409 Ga0495588_0159678 3300046674 Bacteria 1192
410 Ga0495624_0203952 3300046690 Bacteria 1201
411 Ga0495671_0180618 3300046692 Bacteria 1025
412 Ga0495649_0295110 3300046694 Bacteria 826
413 Ga0495581_0023771 3300047315 Bacteria 3551
414 Ga0495674_0016349 3300047319 Bacteria 6919
415 Ga0495672_0002334 3300047320 Bacteria 17587
416 Ga0495672_0054180 3300047320 Bacteria 2346
417 Ga0495672_0057053 3300047320 Bacteria 2269
418 Ga0495676_0138559 3300047321 Bacteria 1746
419 Ga0495683_0002868 3300047323 Bacteria 10200
420 Ga0495673_0000805 3300047469 Bacteria 29466
421 Ga0495684_1053885 3300047471 Bacteria 513
422 Ga0495686_0003291 3300047472 Bacteria 14122
423 Ga0495626_0056690 3300048091 Bacteria 1793
424 Ga0496100_0000248 3300048903 Bacteria 28219
425 Ga0496100_0000323 3300048903 Bacteria 23622
426 Ga0496100_0000557 3300048903 Bacteria 17700
427 Ga0496100_0003761 3300048903 Bacteria 7949
428 Ga0496100_0035427 3300048903 Bacteria 3139
429 Ga0496100_0251203 3300048903 Bacteria 1308
430 Ga0496100_0731622 3300048903 Bacteria 773
431 Ga0496101_0000020 3300048904 Bacteria 218859
432 Ga0496101_0000075 3300048904 Bacteria 112785
433 Ga0496101_0000262 3300048904 Bacteria 37343
434 Ga0496101_0000691 3300048904 Bacteria 20348
435 Ga0496101_0011872 3300048904 Bacteria 5799
436 Ga0496102_0000003 3300048905 Bacteria 592263
437 Ga0496102_0000415 3300048905 Bacteria 49294
438 Ga0496102_0000473 3300048905 Bacteria 44556
439 Ga0496102_0000917 3300048905 Bacteria 27803
440 Ga0496102_0013544 3300048905 Bacteria 7067
441 Ga0496102_0060604 3300048905 Bacteria 3461
442 Ga0496102_0065701 3300048905 Bacteria 3325
443 Ga0496102_0107814 3300048905 Bacteria 2594
444 Ga0496102_0475286 3300048905 Bacteria 1171
445 Ga0496103_0000014 3300048906 Bacteria 290397
446 Ga0496103_0000906 3300048906 Bacteria 21290
447 Ga0496103_0004111 3300048906 Bacteria 8837
448 Ga0496103_0013273 3300048906 Bacteria 4882
449 Ga0496103_0027495 3300048906 Bacteria 3447
450 Ga0496103_0046268 3300048906 Bacteria 2686
451 Ga0496104_0010269 3300048907 Bacteria 8365
452 Ga0496104_0025026 3300048907 Bacteria 5499
453 Ga0496104_0245516 3300048907 Bacteria 1703
454 Ga0496104_0873863 3300048907 Bacteria 804
455 Ga0496105_0349102 3300048908 Bacteria 1182
456 Ga0496105_0428088 3300048908 Bacteria 1047
457 Ga0496106_0000204 3300048909 Bacteria 41472
458 Ga0496106_0001016 3300048909 Bacteria 20579
459 Ga0496106_0001848 3300048909 Bacteria 15843
460 Ga0496106_0029690 3300048909 Bacteria 4076
461 Ga0496107_0004232 3300048910 Bacteria 9704
462 Ga0496107_0039040 3300048910 Bacteria 3405
463 Ga0496107_0079283 3300048910 Bacteria 2394
464 Ga0496108_0000394 3300048911 Bacteria 36076
465 Ga0496108_0005518 3300048911 Bacteria 10231
466 Ga0496108_0028097 3300048911 Bacteria 4653
467 Ga0496108_0759430 3300048911 Bacteria 838
468 Ga0496109_0000176 3300048912 Bacteria 63730
469 Ga0496109_0008490 3300048912 Bacteria 8732
470 Ga0496109_0075659 3300048912 Bacteria 3096
471 Ga0496109_0099280 3300048912 Bacteria 2700
472 Ga0496109_0283829 3300048912 Bacteria 1560
473 Ga0496110_0027034 3300048913 Bacteria 4916
474 Ga0496110_0096070 3300048913 Bacteria 2655
475 Ga0496110_0428394 3300048913 Bacteria 1206
476 Ga0496110_0577859 3300048913 Bacteria 1020
477 Ga0496110_1445662 3300048913 Bacteria 597
478 Ga0496111_0029434 3300048914 Bacteria 3901
479 Ga0496112_0005193 3300048915 Bacteria 11198
480 Ga0496112_0010629 3300048915 Bacteria 8360
481 Ga0496112_0028280 3300048915 Bacteria 5410
482 Ga0496112_0085913 3300048915 Bacteria 3112
483 Ga0496112_0263760 3300048915 Bacteria 1672
484 Ga0496113_0003233 3300048916 Bacteria 9720
485 Ga0496113_0021372 3300048916 Bacteria 4565
486 Ga0496113_0090820 3300048916 Bacteria 2353
487 Ga0496113_0096980 3300048916 Bacteria 2280
488 Ga0496114_0000153 3300048917 Bacteria 50028
489 Ga0496114_0001161 3300048917 Bacteria 19881
490 Ga0496114_0028737 3300048917 Bacteria 4565
491 Ga0496115_0018412 3300048918 Bacteria 5362
492 Ga0496115_0022648 3300048918 Bacteria 4870
493 Ga0496115_0140640 3300048918 Bacteria 1991
494 Ga0496116_0000071 3300048919 Bacteria 244521
495 Ga0496116_0000915 3300048919 Bacteria 36492
496 Ga0496116_0101936 3300048919 Bacteria 1712
497 Ga0496117_0000003 3300048920 Bacteria 1881097
498 Ga0496117_0040791 3300048920 Bacteria 3409
499 Ga0496117_0058689 3300048920 Bacteria 2663
500 Ga0496118_0000001 3300048921 Bacteria 1881100
501 Ga0496118_0001365 3300048921 Bacteria 36792
502 Ga0496118_0011537 3300048921 Bacteria 8613
503 Ga0496119_0000527 3300048922 Bacteria 52100
504 Ga0496119_0003187 3300048922 Bacteria 17198
505 Ga0496119_0018915 3300048922 Bacteria 5101
506 Ga0496119_0050030 3300048922 Bacteria 2579
507 Ga0496120_0000235 3300048923 Bacteria 94653
508 Ga0496120_0084322 3300048923 Bacteria 1713
509 Ga0496120_0127252 3300048923 Bacteria 1309
510 Ga0496121_0000002 3300048924 Bacteria 1494588
511 Ga0496121_0000019 3300048924 Bacteria 499976
512 Ga0496121_0101156 3300048924 Bacteria 2223
513 Ga0496122_0000078 3300048925 Bacteria 214068
514 Ga0496122_0008813 3300048925 Bacteria 10778
515 Ga0496122_0015410 3300048925 Bacteria 7309
516 Ga0496123_0006264 3300048926 Bacteria 11592
517 Ga0496123_0034057 3300048926 Bacteria 3655
518 Ga0496124_0000002 3300048927 Bacteria 1494588
519 Ga0496124_0155389 3300048927 Bacteria 1789
520 Ga0496124_0599639 3300048927 Bacteria 717
521 Ga0496125_0000002 3300048928 Bacteria 1480920
522 Ga0496125_0072429 3300048928 Bacteria 2684
523 Ga0496126_0000011 3300048929 Bacteria 744275
524 Ga0496126_0000951 3300048929 Bacteria 49637
525 Ga0496126_0011441 3300048929 Bacteria 9184
526 Ga0496126_0311617 3300048929 Bacteria 1295
527 Ga0501032_0007545 3300049569 Bacteria 7945
528 Ga0501034_0014905 3300049571 Bacteria 7994
529 Ga0501034_0428474 3300049571 Bacteria 1243
530 Ga0501036_0535721 3300049572 Bacteria 973
531 Ga0501037_0000454 3300049573 Bacteria 33411
532 Ga0501038_0009505 3300049574 Bacteria 8921
533 Ga0501039_0000407 3300049575 Bacteria 30990
534 Ga0501043_0000402 3300049579 Bacteria 38918
535 Ga0501047_0113153 3300049581 Bacteria 2596
536 Ga0501047_1388687 3300049581 Bacteria 517
537 Ga0501068_0303509 3300049584 Bacteria 1022
538 Ga0501068_0325275 3300049584 Bacteria 986
539 Ga0501070_0000583 3300049586 Bacteria 33261
540 Ga0501073_0686498 3300049589 Bacteria 706
541 Ga0501044_0041620 3300049823 Bacteria 4783
542 nmdc:mga03683_119221_c1 3300050489 Bacteria 1172
543 nmdc:mga03683_47459_c1 3300050489 Bacteria 1782
544 nmdc:mga03683_76444_c1 3300050489 Bacteria 1439
545 nmdc:mga03683_86673_c1 3300050489 Bacteria 1360
546 nmdc:mga03n38_140427_c1 3300050490 Bacteria 1206
547 nmdc:mga03n38_1711_c1 3300050490 Bacteria 6465
548 nmdc:mga03n38_308569_c1 3300050490 Bacteria 851
549 nmdc:mga03n38_63326_c1 3300050490 Bacteria 1690
550 nmdc:mga03n38_836646_c1 3300050490 Bacteria 538
551 nmdc:mga00v17_133218_c1 3300050491 Bacteria 1589
552 nmdc:mga00v17_133346_c1 3300050491 Bacteria 1589
553 nmdc:mga00v17_1374_c1 3300050491 Bacteria 12762
554 nmdc:mga00v17_21220_c1 3300050491 Bacteria 3732
555 nmdc:mga00v17_22348_c1 3300050491 Bacteria 3649
556 nmdc:mga00v17_67460_c2 3300050491 Bacteria 1174
557 nmdc:mga00v17_900397_c1 3300050491 Bacteria 560
558 nmdc:mga0yw44_38654_c1 3300050492 Bacteria 2825
559 nmdc:mga06z11_377276_c1 3300050494 Bacteria 852
560 nmdc:mga06z11_856135_c1 3300050494 Bacteria 554
561 nmdc:mga07m45_11732_c1 3300050496 Bacteria 4611
562 nmdc:mga07m45_25335_c1 3300050496 Bacteria 3253
563 nmdc:mga07m45_253938_c1 3300050496 Bacteria 1023
564 nmdc:mga07m45_345224_c1 3300050496 Bacteria 865
565 nmdc:mga07m45_53922_c1 3300050496 Bacteria 2273
566 nmdc:mga07m45_75294_c1 3300050496 Bacteria 1923
567 nmdc:mga0sz30_3665_c1 3300050516 Bacteria 5534
568 nmdc:mga0sz30_383550_c1 3300050516 Bacteria 629
569 nmdc:mga0sz30_456545_c1 3300050516 Bacteria 574
570 nmdc:mga0sz30_6746_c1 3300050516 Bacteria 2557
571 Ga0495655_0010646 3300053083 Bacteria 1821
572 Ga0495655_0199358 3300053083 Bacteria 654
573 Ga0495619_0084873 3300053085 Bacteria 2138
574 Ga0500643_050400 3300053087 Bacteria 1191
575 Ga0500652_110322 3300053131 Bacteria 1150
576 Ga0500577_0085933 3300053142 Bacteria 1263
577 Ga0500616_0017062 3300053153 Bacteria 4122
578 Ga0500616_0055960 3300053153 Bacteria 2060

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044901 Ga0466960_0602942 Ga0466960_0602942_52_471 128
2 3300046674 Ga0495588_0159678 Ga0495588_0159678_772_1167 130
3 3300047315 Ga0495581_0023771 Ga0495581_0023771_2689_3084 130
4 3300031838 Ga0307518_10000287 Ga0307518_1000028716 145
5 3300005455 Ga0070663_100236612 Ga0070663_1002366122 148
6 3300009092 Ga0105250_10242427 Ga0105250_102424271 148
7 3300009092 Ga0105250_10559900 Ga0105250_105599001 148
8 3300009093 Ga0105240_11410067 Ga0105240_114100671 148
9 3300009101 Ga0105247_10001090 Ga0105247_1000109019 148
10 3300009148 Ga0105243_10011286 Ga0105243_100112866 148
11 3300009174 Ga0105241_10083984 Ga0105241_100839843 148
12 3300009176 Ga0105242_10001916 Ga0105242_100019161 148
13 3300009177 Ga0105248_10324419 Ga0105248_103244193 148
14 3300009545 Ga0105237_10145052 Ga0105237_101450524 148
15 3300009553 Ga0105249_10001553 Ga0105249_1000155321 148
16 3300009553 Ga0105249_10694836 Ga0105249_106948361 148
17 3300010375 Ga0105239_10023869 Ga0105239_100238695 148
18 3300013102 Ga0157371_10191288 Ga0157371_101912882 148
19 3300013306 Ga0163162_10015089 Ga0163162_100150897 148
20 3300013307 Ga0157372_10015409 Ga0157372_100154096 148
21 3300014326 Ga0157380_10008931 Ga0157380_100089311 148
22 3300014326 Ga0157380_10643862 Ga0157380_106438622 148
23 3300014745 Ga0157377_10135323 Ga0157377_101353233 148
24 3300014968 Ga0157379_10039814 Ga0157379_100398144 148
25 3300014968 Ga0157379_10770096 Ga0157379_107700962 148
26 3300014969 Ga0157376_10117552 Ga0157376_101175521 148
27 3300035691 Ga0373931_0056133 Ga0373931_0056133_707_1153 148
28 3300041413 Ga0439465_0039049 Ga0439465_0039049_160_606 148
29 3300048903 Ga0496100_0003761 Ga0496100_0003761_4121_4567 148
30 3300048904 Ga0496101_0000691 Ga0496101_0000691_4468_4914 148
31 3300048905 Ga0496102_0000473 Ga0496102_0000473_17381_17827 148
32 3300048906 Ga0496103_0013273 Ga0496103_0013273_4315_4761 148
33 3300048907 Ga0496104_0245516 Ga0496104_0245516_1162_1608 148
34 3300048909 Ga0496106_0001016 Ga0496106_0001016_5657_6103 148
35 3300048917 Ga0496114_0000153 Ga0496114_0000153_36803_37249 148
36 3300048918 Ga0496115_0140640 Ga0496115_0140640_122_568 148
37 3300050490 nmdc:mga03n38_140427_c1 nmdc:mga03n38_140427_c1_351_797 148
38 3300050490 nmdc:mga03n38_63326_c1 nmdc:mga03n38_63326_c1_1175_1621 148
39 3300050492 nmdc:mga0yw44_38654_c1 nmdc:mga0yw44_38654_c1_1452_1898 148
40 3300050516 nmdc:mga0sz30_383550_c1 nmdc:mga0sz30_383550_c1_39_485 148
41 iso_pu_bacteria 2899370129 2899373107 148
42 3300005331 Ga0070670_101882473 Ga0070670_1018824731 149
43 3300005338 Ga0068868_100230363 Ga0068868_1002303631 149
44 3300005436 Ga0070713_100458583 Ga0070713_1004585831 149
45 3300005455 Ga0070663_100049406 Ga0070663_1000494062 149
46 3300006175 Ga0070712_101044812 Ga0070712_1010448121 149
47 3300009092 Ga0105250_10074376 Ga0105250_100743763 149
48 3300009098 Ga0105245_11702527 Ga0105245_117025271 149
49 3300009101 Ga0105247_10408556 Ga0105247_104085562 149
50 3300009101 Ga0105247_10548872 Ga0105247_105488722 149
51 3300009177 Ga0105248_10847279 Ga0105248_108472792 149
52 3300010375 Ga0105239_10537646 Ga0105239_105376461 149
53 3300011119 Ga0105246_10030677 Ga0105246_100306774 149
54 3300013296 Ga0157374_10160023 Ga0157374_101600232 149
55 3300013297 Ga0157378_10064890 Ga0157378_100648902 149
56 3300013306 Ga0163162_10082483 Ga0163162_100824832 149
57 3300013306 Ga0163162_10087685 Ga0163162_100876851 149
58 3300013306 Ga0163162_10442984 Ga0163162_104429841 149
59 3300013308 Ga0157375_10436155 Ga0157375_104361553 149
60 3300014325 Ga0163163_11237405 Ga0163163_112374052 149
61 3300014745 Ga0157377_10055018 Ga0157377_100550181 149
62 3300026075 Ga0207708_10764475 Ga0207708_107644751 149
63 3300041411 Ga0439466_0001181 Ga0439466_0001181_9086_9535 149
64 3300041413 Ga0439465_0087165 Ga0439465_0087165_132_581 149
65 3300041501 Ga0451845_0338184 Ga0451845_0338184_44_493 149
66 3300042002 Ga0439442_016467 Ga0439442_016467_660_1109 149
67 3300042004 Ga0439445_0006922 Ga0439445_0006922_1788_2237 149
68 3300044735 Ga0466968_0142236 Ga0466968_0142236_351_800 149
69 3300045976 Ga0466967_0676626 Ga0466967_0676626_203_679 149
70 3300046531 Ga0495665_0256926 Ga0495665_0256926_16_465 149
71 3300047320 Ga0495672_0054180 Ga0495672_0054180_1872_2321 149
72 3300047471 Ga0495684_1053885 Ga0495684_1053885_48_497 149
73 3300048905 Ga0496102_0013544 Ga0496102_0013544_6192_6644 149
74 3300048905 Ga0496102_0065701 Ga0496102_0065701_2330_2779 149
75 3300048905 Ga0496102_0107814 Ga0496102_0107814_1844_2293 149
76 3300048905 Ga0496102_0475286 Ga0496102_0475286_241_690 149
77 3300048906 Ga0496103_0027495 Ga0496103_0027495_2585_3037 149
78 3300048906 Ga0496103_0046268 Ga0496103_0046268_2051_2500 149
79 3300048907 Ga0496104_0025026 Ga0496104_0025026_4583_5035 149
80 3300048908 Ga0496105_0349102 Ga0496105_0349102_40_492 149
81 3300048911 Ga0496108_0000394 Ga0496108_0000394_28261_28710 149
82 3300048911 Ga0496108_0028097 Ga0496108_0028097_2800_3249 149
83 3300048912 Ga0496109_0008490 Ga0496109_0008490_2042_2491 149
84 3300048912 Ga0496109_0075659 Ga0496109_0075659_543_995 149
85 3300048912 Ga0496109_0099280 Ga0496109_0099280_539_988 149
86 3300048913 Ga0496110_0027034 Ga0496110_0027034_1158_1607 149
87 3300048913 Ga0496110_0096070 Ga0496110_0096070_1843_2295 149
88 3300048913 Ga0496110_1445662 Ga0496110_1445662_116_565 149
89 3300048915 Ga0496112_0005193 Ga0496112_0005193_2342_2791 149
90 3300048915 Ga0496112_0028280 Ga0496112_0028280_3309_3758 149
91 3300048916 Ga0496113_0096980 Ga0496113_0096980_248_697 149
92 3300050489 nmdc:mga03683_119221_c1 nmdc:mga03683_119221_c1_514_963 149
93 3300050491 nmdc:mga00v17_133346_c1 nmdc:mga00v17_133346_c1_512_961 149
94 3300050516 nmdc:mga0sz30_3665_c1 nmdc:mga0sz30_3665_c1_4373_4822 149
95 iso_pu_bacteria 2585427649 2586058400 150
96 iso_pu_bacteria 2808606522 2809592755 150
97 iso_pu_bacteria 2866612099 2866613495 150
98 iso_pu_bacteria 2899359706 2899367288 150
99 iso_pu_bacteria 2915768154 2915770967 150
100 iso_pu_bacteria 8003314358 8003315826 150
101 3300009148 Ga0105243_10000567 Ga0105243_1000056715 151
102 3300025935 Ga0207709_10000305 Ga0207709_100003056 151
103 3300048916 Ga0496113_0090820 Ga0496113_0090820_1498_1956 151
104 3300005435 Ga0070714_100090563 Ga0070714_1000905632 152
105 3300005937 Ga0081455_10000111 Ga0081455_1000011155 152
106 3300006880 Ga0075429_100117062 Ga0075429_1001170622 152
107 3300025929 Ga0207664_10869462 Ga0207664_108694621 152
108 3300031731 Ga0307405_11238082 Ga0307405_112380822 152
109 3300031995 Ga0307409_100714963 Ga0307409_1007149631 152
110 3300042007 Ga0439449_0083178 Ga0439449_0083178_112_573 152
111 3300044694 Ga0466963_0077023 Ga0466963_0077023_370_840 152
112 3300045976 Ga0466967_0535418 Ga0466967_0535418_629_1099 152
113 3300031824 Ga0307413_10000652 Ga0307413_1000065213 153
114 iso_pu_bacteria 2547132424 2548693099 153
115 iso_pu_bacteria 2551306166 2552105769 153
116 iso_pu_bacteria 2565956761 2566992655 153
117 iso_pu_bacteria 2643221715 2644635646 153
118 iso_pu_bacteria 2738541264 2738664240 153
119 iso_pu_bacteria 2738541356 2739143375 153
120 iso_pu_bacteria 2738543011 2739236881 153
121 iso_pu_bacteria 2744054611 2744955821 153
122 iso_pu_bacteria 2889300758 2889305774 153
123 iso_pu_bacteria 2902792274 2902792959 153
124 iso_pu_bacteria 2902810491 2902813737 153
125 iso_pu_bacteria 2904535858 2904538386 153
126 iso_pu_bacteria 2919713450 2919718237 153
127 iso_pu_bacteria 2922554459 2922559118 153
128 iso_pu_bacteria 2939743619 2939743910 153
129 3300003320 rootH2_10054791 rootH2_100547912 154
130 3300005347 Ga0070668_100012605 Ga0070668_1000126058 154
131 3300005435 Ga0070714_100138272 Ga0070714_1001382722 154
132 3300005441 Ga0070700_100136084 Ga0070700_1001360843 154
133 3300005455 Ga0070663_100000114 Ga0070663_1000001144 154
134 3300005544 Ga0070686_101295083 Ga0070686_1012950831 154
135 3300025929 Ga0207664_11340331 Ga0207664_113403312 154
136 3300025972 Ga0207668_10001576 Ga0207668_100015768 154
137 3300026067 Ga0207678_10000289 Ga0207678_1000028924 154
138 3300026075 Ga0207708_10120349 Ga0207708_101203492 154
139 3300030522 Ga0307512_10103143 Ga0307512_101031433 154
140 3300031838 Ga0307518_10484367 Ga0307518_104843671 154
141 3300033179 Ga0307507_10006482 Ga0307507_1000648210 154
142 3300044658 Ga0466972_0005487 Ga0466972_0005487_3265_3738 154
143 3300044683 Ga0466965_0207730 Ga0466965_0207730_179_652 154
144 3300044735 Ga0466968_0058046 Ga0466968_0058046_554_1027 154
145 3300044765 Ga0466970_0096420 Ga0466970_0096420_344_817 154
146 3300048927 Ga0496124_0599639 Ga0496124_0599639_101_574 154
147 iso_pu_bacteria 2738543034 2739363096 154
148 iso_pu_bacteria 2795385472 2795796774 154
149 iso_pu_bacteria 2891326441 2891330164 154
150 3300009098 Ga0105245_10877675 Ga0105245_108776751 155
151 3300037853 Ga0436364_0388253 Ga0436364_0388253_379_867 155
152 3300038443 Ga0395901_0671653 Ga0395901_0671653_447_917 155
153 iso_pu_bacteria 2582580736 2583152618 155
154 iso_pu_bacteria 2917736166 2917740137 155
155 3300006051 Ga0075364_10371044 Ga0075364_103710442 156
156 3300031251 Ga0265327_10000532 Ga0265327_1000053255 156
157 3300031251 Ga0265327_10035443 Ga0265327_100354433 156
158 3300048905 Ga0496102_0000003 Ga0496102_0000003_228583_229053 156
159 3300048906 Ga0496103_0000014 Ga0496103_0000014_61563_62033 156
160 3300048919 Ga0496116_0000071 Ga0496116_0000071_227718_228188 156
161 3300048920 Ga0496117_0000003 Ga0496117_0000003_363211_363681 156
162 3300048921 Ga0496118_0000001 Ga0496118_0000001_363214_363684 156
163 3300048925 Ga0496122_0008813 Ga0496122_0008813_1882_2352 156
164 3300048926 Ga0496123_0034057 Ga0496123_0034057_2161_2631 156
165 3300049584 Ga0501068_0325275 Ga0501068_0325275_46_540 156
166 3300050491 nmdc:mga00v17_900397_c1 nmdc:mga00v17_900397_c1_10_480 156
167 3300001978 JGI24747J21853_1008179 JGI24747J21853_10081792 157
168 3300001991 JGI24743J22301_10033037 JGI24743J22301_100330372 157
169 3300002070 JGI24750J21931_1017330 JGI24750J21931_10173301 157
170 3300002074 JGI24748J21848_1006142 JGI24748J21848_10061424 157
171 3300002075 JGI24738J21930_10029895 JGI24738J21930_100298952 157
172 3300002076 JGI24749J21850_1001482 JGI24749J21850_10014827 157
173 3300002077 JGI24744J21845_10006268 JGI24744J21845_100062683 157
174 3300002077 JGI24744J21845_10006461 JGI24744J21845_100064611 157
175 3300003792 Ga0055540_1000310 Ga0055540_10003107 157
176 3300005330 Ga0070690_100030604 Ga0070690_1000306043 157
177 3300005335 Ga0070666_10020444 Ga0070666_100204444 157
178 3300005338 Ga0068868_100001415 Ga0068868_10000141517 157
179 3300005341 Ga0070691_10000993 Ga0070691_100009933 157
180 3300005345 Ga0070692_10194579 Ga0070692_101945792 157
181 3300005355 Ga0070671_100395718 Ga0070671_1003957182 157
182 3300005364 Ga0070673_100899479 Ga0070673_1008994792 157
183 3300005366 Ga0070659_100156812 Ga0070659_1001568124 157
184 3300005367 Ga0070667_100010381 Ga0070667_1000103813 157
185 3300005367 Ga0070667_100012216 Ga0070667_1000122163 157
186 3300005406 Ga0070703_10071407 Ga0070703_100714073 157
187 3300005437 Ga0070710_10000625 Ga0070710_1000062514 157
188 3300005439 Ga0070711_100000779 Ga0070711_1000007797 157
189 3300005440 Ga0070705_100213085 Ga0070705_1002130853 157
190 3300005441 Ga0070700_100007418 Ga0070700_1000074186 157
191 3300005444 Ga0070694_100074426 Ga0070694_1000744263 157
192 3300005456 Ga0070678_100005866 Ga0070678_1000058665 157
193 3300005457 Ga0070662_100008435 Ga0070662_1000084356 157
194 3300005459 Ga0068867_100002834 Ga0068867_10000283413 157
195 3300005530 Ga0070679_100295811 Ga0070679_1002958111 157
196 3300005539 Ga0068853_100081495 Ga0068853_1000814952 157
197 3300005543 Ga0070672_100168084 Ga0070672_1001680843 157
198 3300005543 Ga0070672_101259469 Ga0070672_1012594691 157
199 3300005544 Ga0070686_100416238 Ga0070686_1004162381 157
200 3300005545 Ga0070695_100011783 Ga0070695_1000117833 157
201 3300005546 Ga0070696_100004591 Ga0070696_1000045917 157
202 3300005547 Ga0070693_100025689 Ga0070693_1000256894 157
203 3300005548 Ga0070665_100006765 Ga0070665_1000067653 157
204 3300005548 Ga0070665_100082698 Ga0070665_1000826983 157
205 3300005549 Ga0070704_100006863 Ga0070704_1000068634 157
206 3300005578 Ga0068854_100004108 Ga0068854_1000041087 157
207 3300005578 Ga0068854_101079550 Ga0068854_1010795501 157
208 3300005614 Ga0068856_100155371 Ga0068856_1001553711 157
209 3300005617 Ga0068859_100045871 Ga0068859_1000458711 157
210 3300005617 Ga0068859_100255934 Ga0068859_1002559342 157
211 3300005718 Ga0068866_10000713 Ga0068866_1000071314 157
212 3300005719 Ga0068861_100001091 Ga0068861_1000010917 157
213 3300005719 Ga0068861_101198561 Ga0068861_1011985612 157
214 3300005834 Ga0068851_10292021 Ga0068851_102920211 157
215 3300005841 Ga0068863_101609353 Ga0068863_1016093531 157
216 3300005842 Ga0068858_100003437 Ga0068858_1000034372 157
217 3300005843 Ga0068860_100002734 Ga0068860_10000273418 157
218 3300005844 Ga0068862_100001732 Ga0068862_1000017327 157
219 3300005844 Ga0068862_100136707 Ga0068862_1001367074 157
220 3300005937 Ga0081455_10230178 Ga0081455_102301783 157
221 3300006038 Ga0075365_10488813 Ga0075365_104888133 157
222 3300006042 Ga0075368_10024563 Ga0075368_100245632 157
223 3300006048 Ga0075363_100001616 Ga0075363_1000016168 157
224 3300006048 Ga0075363_100185955 Ga0075363_1001859552 157
225 3300006051 Ga0075364_10001045 Ga0075364_1000104516 157
226 3300006051 Ga0075364_10009927 Ga0075364_100099275 157
227 3300006051 Ga0075364_10414031 Ga0075364_104140312 157
228 3300006163 Ga0070715_10000635 Ga0070715_100006359 157
229 3300006173 Ga0070716_100002576 Ga0070716_1000025762 157
230 3300006175 Ga0070712_100000676 Ga0070712_1000006768 157
231 3300006177 Ga0075362_10021083 Ga0075362_100210832 157
232 3300006177 Ga0075362_10149544 Ga0075362_101495442 157
233 3300006178 Ga0075367_10346589 Ga0075367_103465892 157
234 3300006178 Ga0075367_10586431 Ga0075367_105864312 157
235 3300006186 Ga0075369_10000284 Ga0075369_1000028416 157
236 3300006186 Ga0075369_10191758 Ga0075369_101917581 157
237 3300006186 Ga0075369_10222080 Ga0075369_102220802 157
238 3300006186 Ga0075369_10465168 Ga0075369_104651681 157
239 3300006195 Ga0075366_10241254 Ga0075366_102412542 157
240 3300006237 Ga0097621_100057941 Ga0097621_1000579414 157
241 3300006353 Ga0075370_10001554 Ga0075370_1000155418 157
242 3300006353 Ga0075370_10016043 Ga0075370_100160432 157
243 3300006353 Ga0075370_10063111 Ga0075370_100631111 157
244 3300006353 Ga0075370_10067592 Ga0075370_100675924 157
245 3300006353 Ga0075370_10157787 Ga0075370_101577873 157
246 3300006353 Ga0075370_10377709 Ga0075370_103777091 157
247 3300006353 Ga0075370_10440648 Ga0075370_104406482 157
248 3300006358 Ga0068871_100017304 Ga0068871_1000173045 157
249 3300006881 Ga0068865_100001202 Ga0068865_1000012028 157
250 3300006931 Ga0097620_100045866 Ga0097620_1000458661 157
251 3300006931 Ga0097620_100255933 Ga0097620_1002559332 157
252 3300009545 Ga0105237_10009127 Ga0105237_100091276 157
253 3300009545 Ga0105237_10010614 Ga0105237_100106148 157
254 3300009551 Ga0105238_10050044 Ga0105238_100500444 157
255 3300010375 Ga0105239_10005526 Ga0105239_100055268 157
256 3300010375 Ga0105239_10165655 Ga0105239_101656551 157
257 3300010375 Ga0105239_10457141 Ga0105239_104571413 157
258 3300017792 Ga0163161_10001600 Ga0163161_100016007 157
259 3300025294 Ga0209025_1081288 Ga0209025_10812882 157
260 3300025303 Ga0209051_1000051 Ga0209051_1000051157 157
261 3300025711 Ga0207696_1153744 Ga0207696_11537442 157
262 3300025899 Ga0207642_10000255 Ga0207642_1000025510 157
263 3300025900 Ga0207710_10006308 Ga0207710_100063085 157
264 3300025901 Ga0207688_10005250 Ga0207688_100052502 157
265 3300025904 Ga0207647_10242111 Ga0207647_102421112 157
266 3300025905 Ga0207685_10030557 Ga0207685_100305574 157
267 3300025906 Ga0207699_10010549 Ga0207699_100105491 157
268 3300025911 Ga0207654_10144861 Ga0207654_101448611 157
269 3300025914 Ga0207671_10012398 Ga0207671_100123983 157
270 3300025914 Ga0207671_10127778 Ga0207671_101277781 157
271 3300025915 Ga0207693_10006799 Ga0207693_100067998 157
272 3300025916 Ga0207663_10008390 Ga0207663_100083909 157
273 3300025919 Ga0207657_10638954 Ga0207657_106389541 157
274 3300025921 Ga0207652_10286376 Ga0207652_102863763 157
275 3300025927 Ga0207687_10002110 Ga0207687_1000211017 157
276 3300025932 Ga0207690_10292307 Ga0207690_102923071 157
277 3300025933 Ga0207706_10032351 Ga0207706_100323512 157
278 3300025935 Ga0207709_10020338 Ga0207709_100203384 157
279 3300025936 Ga0207670_10010722 Ga0207670_100107223 157
280 3300025937 Ga0207669_10000192 Ga0207669_1000019215 157
281 3300025938 Ga0207704_10002317 Ga0207704_100023176 157
282 3300025939 Ga0207665_10007326 Ga0207665_100073267 157
283 3300025940 Ga0207691_10168321 Ga0207691_101683213 157
284 3300025941 Ga0207711_10096355 Ga0207711_100963553 157
285 3300025942 Ga0207689_10052190 Ga0207689_100521905 157
286 3300025949 Ga0207667_11811825 Ga0207667_118118251 157
287 3300025961 Ga0207712_10202011 Ga0207712_102020112 157
288 3300025972 Ga0207668_10000752 Ga0207668_1000075214 157
289 3300025981 Ga0207640_10002625 Ga0207640_100026254 157
290 3300025986 Ga0207658_10006561 Ga0207658_1000656110 157
291 3300026023 Ga0207677_10008380 Ga0207677_100083807 157
292 3300026035 Ga0207703_10007479 Ga0207703_100074793 157
293 3300026067 Ga0207678_10011571 Ga0207678_100115717 157
294 3300026075 Ga0207708_10011722 Ga0207708_100117227 157
295 3300026078 Ga0207702_10478313 Ga0207702_104783131 157
296 3300026089 Ga0207648_10002256 Ga0207648_100022565 157
297 3300026118 Ga0207675_100002064 Ga0207675_1000020645 157
298 3300026121 Ga0207683_10001521 Ga0207683_1000152121 157
299 3300027866 Ga0209813_10060796 Ga0209813_100607962 157
300 3300028380 Ga0268265_10000022 Ga0268265_100000225 157
301 3300028380 Ga0268265_10122064 Ga0268265_101220642 157
302 3300028380 Ga0268265_10350654 Ga0268265_103506541 157
303 3300028381 Ga0268264_10005951 Ga0268264_100059517 157
304 3300028381 Ga0268264_11634080 Ga0268264_116340801 157
305 3300031251 Ga0265327_10002587 Ga0265327_100025879 157
306 3300031731 Ga0307405_10251619 Ga0307405_102516192 157
307 3300031824 Ga0307413_10126751 Ga0307413_101267512 157
308 3300031824 Ga0307413_10169149 Ga0307413_101691491 157
309 3300031824 Ga0307413_11182422 Ga0307413_111824221 157
310 3300031901 Ga0307406_10503096 Ga0307406_105030962 157
311 3300031995 Ga0307409_100165311 Ga0307409_1001653112 157
312 3300031995 Ga0307409_100523706 Ga0307409_1005237062 157
313 3300032005 Ga0307411_10146022 Ga0307411_101460223 157
314 3300041413 Ga0439465_0018882 Ga0439465_0018882_150_623 157
315 3300041997 Ga0439431_0000355 Ga0439431_0000355_6192_6665 157
316 3300042005 Ga0439448_0022432 Ga0439448_0022432_198_671 157
317 3300044656 Ga0466969_0011887 Ga0466969_0011887_345_818 157
318 3300044658 Ga0466972_0056741 Ga0466972_0056741_403_876 157
319 3300044683 Ga0466965_0049266 Ga0466965_0049266_193_666 157
320 3300044684 Ga0466966_0007740 Ga0466966_0007740_762_1235 157
321 3300044693 Ga0466961_0006810 Ga0466961_0006810_1776_2249 157
322 3300044694 Ga0466963_0415932 Ga0466963_0415932_465_938 157
323 3300044706 Ga0466964_0018431 Ga0466964_0018431_651_1124 157
324 3300044719 Ga0466971_0025872 Ga0466971_0025872_1484_1957 157
325 3300044765 Ga0466970_0123878 Ga0466970_0123878_775_1248 157
326 3300044842 Ga0466957_0301626 Ga0466957_0301626_585_1058 157
327 3300045049 Ga0466959_0001193 Ga0466959_0001193_11560_12033 157
328 3300045836 Ga0466958_0000806 Ga0466958_0000806_4486_4959 157
329 3300046472 Ga0495580_0404535 Ga0495580_0404535_25_504 157
330 3300046528 Ga0495642_0140625 Ga0495642_0140625_234_707 157
331 3300046531 Ga0495665_0042268 Ga0495665_0042268_1902_2381 157
332 3300046615 Ga0495656_0326910 Ga0495656_0326910_128_604 157
333 3300046615 Ga0495656_0439033 Ga0495656_0439033_16_492 157
334 3300046616 Ga0495668_0000509 Ga0495668_0000509_12607_13083 157
335 3300046616 Ga0495668_0010731 Ga0495668_0010731_701_1174 157
336 3300046692 Ga0495671_0180618 Ga0495671_0180618_506_979 157
337 3300047320 Ga0495672_0002334 Ga0495672_0002334_8794_9267 157
338 3300047323 Ga0495683_0002868 Ga0495683_0002868_3158_3634 157
339 3300047469 Ga0495673_0000805 Ga0495673_0000805_13954_14427 157
340 3300048903 Ga0496100_0000323 Ga0496100_0000323_3137_3610 157
341 3300048903 Ga0496100_0000557 Ga0496100_0000557_889_1362 157
342 3300048903 Ga0496100_0035427 Ga0496100_0035427_150_623 157
343 3300048904 Ga0496101_0000020 Ga0496101_0000020_109970_110443 157
344 3300048904 Ga0496101_0000075 Ga0496101_0000075_54786_55259 157
345 3300048904 Ga0496101_0011872 Ga0496101_0011872_3335_3808 157
346 3300048905 Ga0496102_0000917 Ga0496102_0000917_24343_24816 157
347 3300048906 Ga0496103_0004111 Ga0496103_0004111_1832_2305 157
348 3300048907 Ga0496104_0873863 Ga0496104_0873863_241_714 157
349 3300048908 Ga0496105_0428088 Ga0496105_0428088_329_802 157
350 3300048909 Ga0496106_0000204 Ga0496106_0000204_4402_4875 157
351 3300048909 Ga0496106_0029690 Ga0496106_0029690_115_588 157
352 3300048910 Ga0496107_0039040 Ga0496107_0039040_2306_2779 157
353 3300048910 Ga0496107_0079283 Ga0496107_0079283_1511_1984 157
354 3300048911 Ga0496108_0005518 Ga0496108_0005518_8133_8606 157
355 3300048911 Ga0496108_0759430 Ga0496108_0759430_152_628 157
356 3300048912 Ga0496109_0000176 Ga0496109_0000176_42441_42914 157
357 3300048914 Ga0496111_0029434 Ga0496111_0029434_1317_1790 157
358 3300048915 Ga0496112_0010629 Ga0496112_0010629_6294_6767 157
359 3300048915 Ga0496112_0263760 Ga0496112_0263760_615_1088 157
360 3300048916 Ga0496113_0003233 Ga0496113_0003233_756_1229 157
361 3300048917 Ga0496114_0001161 Ga0496114_0001161_15934_16407 157
362 3300048918 Ga0496115_0022648 Ga0496115_0022648_2692_3165 157
363 3300048919 Ga0496116_0000915 Ga0496116_0000915_32149_32622 157
364 3300048920 Ga0496117_0058689 Ga0496117_0058689_374_847 157
365 3300048921 Ga0496118_0011537 Ga0496118_0011537_1608_2081 157
366 3300048922 Ga0496119_0000527 Ga0496119_0000527_17988_18461 157
367 3300048922 Ga0496119_0003187 Ga0496119_0003187_3367_3840 157
368 3300048922 Ga0496119_0050030 Ga0496119_0050030_1840_2391 157
369 3300048923 Ga0496120_0000235 Ga0496120_0000235_16329_16802 157
370 3300048923 Ga0496120_0127252 Ga0496120_0127252_365_838 157
371 3300048924 Ga0496121_0000002 Ga0496121_0000002_816494_816967 157
372 3300048924 Ga0496121_0000019 Ga0496121_0000019_238002_238475 157
373 3300048925 Ga0496122_0000078 Ga0496122_0000078_1418_1891 157
374 3300048925 Ga0496122_0015410 Ga0496122_0015410_5072_5545 157
375 3300048926 Ga0496123_0006264 Ga0496123_0006264_10795_11268 157
376 3300048927 Ga0496124_0000002 Ga0496124_0000002_677622_678095 157
377 3300048928 Ga0496125_0000002 Ga0496125_0000002_816494_816967 157
378 3300048928 Ga0496125_0072429 Ga0496125_0072429_977_1453 157
379 3300048929 Ga0496126_0000011 Ga0496126_0000011_677622_678095 157
380 3300048929 Ga0496126_0000951 Ga0496126_0000951_16333_16806 157
381 3300048929 Ga0496126_0011441 Ga0496126_0011441_5177_5650 157
382 3300049569 Ga0501032_0007545 Ga0501032_0007545_189_671 157
383 3300049571 Ga0501034_0014905 Ga0501034_0014905_7090_7572 157
384 3300049571 Ga0501034_0428474 Ga0501034_0428474_118_591 157
385 3300049572 Ga0501036_0535721 Ga0501036_0535721_187_669 157
386 3300049573 Ga0501037_0000454 Ga0501037_0000454_21593_22075 157
387 3300049574 Ga0501038_0009505 Ga0501038_0009505_1116_1598 157
388 3300049575 Ga0501039_0000407 Ga0501039_0000407_29579_30061 157
389 3300049579 Ga0501043_0000402 Ga0501043_0000402_28006_28488 157
390 3300049581 Ga0501047_0113153 Ga0501047_0113153_1526_1999 157
391 3300049581 Ga0501047_1388687 Ga0501047_1388687_17_499 157
392 3300049584 Ga0501068_0303509 Ga0501068_0303509_311_793 157
393 3300049586 Ga0501070_0000583 Ga0501070_0000583_766_1248 157
394 3300049589 Ga0501073_0686498 Ga0501073_0686498_33_515 157
395 3300049823 Ga0501044_0041620 Ga0501044_0041620_884_1366 157
396 3300050489 nmdc:mga03683_47459_c1 nmdc:mga03683_47459_c1_675_1148 157
397 3300050489 nmdc:mga03683_76444_c1 nmdc:mga03683_76444_c1_134_610 157
398 3300050489 nmdc:mga03683_86673_c1 nmdc:mga03683_86673_c1_527_1000 157
399 3300050490 nmdc:mga03n38_1711_c1 nmdc:mga03n38_1711_c1_2061_2534 157
400 3300050490 nmdc:mga03n38_308569_c1 nmdc:mga03n38_308569_c1_357_833 157
401 3300050491 nmdc:mga00v17_133218_c1 nmdc:mga00v17_133218_c1_467_940 157
402 3300050491 nmdc:mga00v17_1374_c1 nmdc:mga00v17_1374_c1_12053_12526 157
403 3300050491 nmdc:mga00v17_21220_c1 nmdc:mga00v17_21220_c1_2902_3375 157
404 3300050491 nmdc:mga00v17_22348_c1 nmdc:mga00v17_22348_c1_528_1013 157
405 3300050494 nmdc:mga06z11_377276_c1 nmdc:mga06z11_377276_c1_210_683 157
406 3300050494 nmdc:mga06z11_856135_c1 nmdc:mga06z11_856135_c1_52_528 157
407 3300050496 nmdc:mga07m45_11732_c1 nmdc:mga07m45_11732_c1_3984_4460 157
408 3300050496 nmdc:mga07m45_25335_c1 nmdc:mga07m45_25335_c1_883_1359 157
409 3300050496 nmdc:mga07m45_345224_c1 nmdc:mga07m45_345224_c1_126_602 157
410 3300050496 nmdc:mga07m45_53922_c1 nmdc:mga07m45_53922_c1_773_1246 157
411 3300050496 nmdc:mga07m45_75294_c1 nmdc:mga07m45_75294_c1_193_669 157
412 3300050516 nmdc:mga0sz30_456545_c1 nmdc:mga0sz30_456545_c1_84_557 157
413 3300050516 nmdc:mga0sz30_6746_c1 nmdc:mga0sz30_6746_c1_1447_1920 157
414 3300053087 Ga0500643_050400 Ga0500643_050400_33_506 157
415 3300053131 Ga0500652_110322 Ga0500652_110322_489_962 157
416 3300053153 Ga0500616_0017062 Ga0500616_0017062_3133_3606 157
417 3300053153 Ga0500616_0055960 Ga0500616_0055960_468_941 157
418 iso_pu_bacteria 2643221692 2644515413 157
419 iso_pu_bacteria 2738541308 2738887463 157
420 iso_pu_bacteria 2751185725 2753035691 157
421 iso_pu_bacteria 2751185792 2753326283 157
422 3300001977 JGI24746J21847_1005802 JGI24746J21847_10058022 158
423 3300001990 JGI24737J22298_10014598 JGI24737J22298_100145983 158
424 3300002075 JGI24738J21930_10085128 JGI24738J21930_100851281 158
425 3300005337 Ga0070682_100052723 Ga0070682_1000527233 158
426 3300005337 Ga0070682_100067098 Ga0070682_1000670982 158
427 3300005337 Ga0070682_100478971 Ga0070682_1004789712 158
428 3300005338 Ga0068868_100254990 Ga0068868_1002549903 158
429 3300005341 Ga0070691_10255394 Ga0070691_102553942 158
430 3300005345 Ga0070692_10643451 Ga0070692_106434511 158
431 3300005347 Ga0070668_100128023 Ga0070668_1001280231 158
432 3300005347 Ga0070668_100534567 Ga0070668_1005345671 158
433 3300005353 Ga0070669_100013486 Ga0070669_1000134869 158
434 3300005353 Ga0070669_100218066 Ga0070669_1002180661 158
435 3300005354 Ga0070675_100091794 Ga0070675_1000917941 158
436 3300005355 Ga0070671_100014779 Ga0070671_1000147791 158
437 3300005355 Ga0070671_100094107 Ga0070671_1000941072 158
438 3300005356 Ga0070674_100014834 Ga0070674_1000148342 158
439 3300005356 Ga0070674_100391035 Ga0070674_1003910353 158
440 3300005364 Ga0070673_100448142 Ga0070673_1004481421 158
441 3300005365 Ga0070688_100346590 Ga0070688_1003465902 158
442 3300005365 Ga0070688_100347530 Ga0070688_1003475301 158
443 3300005367 Ga0070667_100000074 Ga0070667_100000074119 158
444 3300005367 Ga0070667_100058927 Ga0070667_1000589274 158
445 3300005434 Ga0070709_10087187 Ga0070709_100871874 158
446 3300005435 Ga0070714_100589916 Ga0070714_1005899162 158
447 3300005436 Ga0070713_100008336 Ga0070713_1000083362 158
448 3300005440 Ga0070705_100786635 Ga0070705_1007866352 158
449 3300005455 Ga0070663_100049375 Ga0070663_1000493753 158
450 3300005455 Ga0070663_100333261 Ga0070663_1003332611 158
451 3300005456 Ga0070678_100040956 Ga0070678_1000409562 158
452 3300005539 Ga0068853_100103348 Ga0068853_1001033483 158
453 3300005543 Ga0070672_100093139 Ga0070672_1000931393 158
454 3300005548 Ga0070665_100006624 Ga0070665_1000066243 158
455 3300005548 Ga0070665_100027663 Ga0070665_1000276633 158
456 3300005548 Ga0070665_100311045 Ga0070665_1003110452 158
457 3300005548 Ga0070665_101162051 Ga0070665_1011620512 158
458 3300005549 Ga0070704_100014418 Ga0070704_1000144186 158
459 3300005564 Ga0070664_100214014 Ga0070664_1002140142 158
460 3300005615 Ga0070702_100147404 Ga0070702_1001474043 158
461 3300005616 Ga0068852_100422694 Ga0068852_1004226941 158
462 3300005616 Ga0068852_101074800 Ga0068852_1010748002 158
463 3300005617 Ga0068859_100001947 Ga0068859_10000194721 158
464 3300005617 Ga0068859_100526038 Ga0068859_1005260382 158
465 3300005617 Ga0068859_101911001 Ga0068859_1019110011 158
466 3300005618 Ga0068864_100671221 Ga0068864_1006712212 158
467 3300005718 Ga0068866_10097509 Ga0068866_100975093 158
468 3300005718 Ga0068866_10655532 Ga0068866_106555322 158
469 3300005719 Ga0068861_100357959 Ga0068861_1003579591 158
470 3300005719 Ga0068861_100530037 Ga0068861_1005300372 158
471 3300005834 Ga0068851_10325659 Ga0068851_103256591 158
472 3300005840 Ga0068870_10226944 Ga0068870_102269442 158
473 3300005841 Ga0068863_100003806 Ga0068863_1000038063 158
474 3300005841 Ga0068863_100093811 Ga0068863_1000938113 158
475 3300005841 Ga0068863_100337607 Ga0068863_1003376071 158
476 3300005842 Ga0068858_100039329 Ga0068858_1000393293 158
477 3300005842 Ga0068858_100043630 Ga0068858_1000436302 158
478 3300005843 Ga0068860_100000276 Ga0068860_10000027678 158
479 3300005843 Ga0068860_100392514 Ga0068860_1003925143 158
480 3300005844 Ga0068862_100128392 Ga0068862_1001283924 158
481 3300005937 Ga0081455_10013864 Ga0081455_100138645 158
482 3300006028 Ga0070717_11932399 Ga0070717_119323991 158
483 3300006048 Ga0075363_100102706 Ga0075363_1001027061 158
484 3300006048 Ga0075363_100273775 Ga0075363_1002737752 158
485 3300006051 Ga0075364_10020759 Ga0075364_100207596 158
486 3300006051 Ga0075364_10158038 Ga0075364_101580383 158
487 3300006881 Ga0068865_100050893 Ga0068865_1000508932 158
488 3300006931 Ga0097620_100001947 Ga0097620_10000194721 158
489 3300006931 Ga0097620_100526037 Ga0097620_1005260372 158
490 3300006931 Ga0097620_101911225 Ga0097620_1019112251 158
491 3300007788 Ga0099795_10048846 Ga0099795_100488461 158
492 3300009101 Ga0105247_10059773 Ga0105247_100597733 158
493 3300009148 Ga0105243_10213235 Ga0105243_102132352 158
494 3300009174 Ga0105241_10620195 Ga0105241_106201951 158
495 3300009177 Ga0105248_10000721 Ga0105248_1000072131 158
496 3300009177 Ga0105248_10195742 Ga0105248_101957423 158
497 3300009553 Ga0105249_10000096 Ga0105249_100000963 158
498 3300013102 Ga0157371_10609019 Ga0157371_106090192 158
499 3300013306 Ga0163162_10134946 Ga0163162_101349465 158
500 3300013307 Ga0157372_10434600 Ga0157372_104346003 158
501 3300014325 Ga0163163_10006752 Ga0163163_100067523 158
502 3300014968 Ga0157379_10032279 Ga0157379_100322791 158
503 3300014968 Ga0157379_10106578 Ga0157379_101065783 158
504 3300021384 Ga0213876_10033075 Ga0213876_100330752 158
505 3300021388 Ga0213875_10132337 Ga0213875_101323371 158
506 3300025899 Ga0207642_10506452 Ga0207642_105064522 158
507 3300025900 Ga0207710_10000033 Ga0207710_10000033263 158
508 3300025901 Ga0207688_10003298 Ga0207688_100032987 158
509 3300025911 Ga0207654_10434951 Ga0207654_104349512 158
510 3300025916 Ga0207663_10231597 Ga0207663_102315971 158
511 3300025916 Ga0207663_10856266 Ga0207663_108562661 158
512 3300025923 Ga0207681_10000456 Ga0207681_1000045626 158
513 3300025927 Ga0207687_10211805 Ga0207687_102118052 158
514 3300025929 Ga0207664_10049368 Ga0207664_100493682 158
515 3300025931 Ga0207644_10024252 Ga0207644_100242525 158
516 3300025931 Ga0207644_10387691 Ga0207644_103876912 158
517 3300025932 Ga0207690_11191103 Ga0207690_111911031 158
518 3300025933 Ga0207706_10054401 Ga0207706_100544013 158
519 3300025937 Ga0207669_10025314 Ga0207669_100253141 158
520 3300025937 Ga0207669_10485695 Ga0207669_104856951 158
521 3300025941 Ga0207711_10009740 Ga0207711_1000974013 158
522 3300025941 Ga0207711_10150308 Ga0207711_101503082 158
523 3300025941 Ga0207711_10834271 Ga0207711_108342712 158
524 3300025942 Ga0207689_10031302 Ga0207689_100313022 158
525 3300025945 Ga0207679_10947737 Ga0207679_109477371 158
526 3300025960 Ga0207651_10013280 Ga0207651_100132805 158
527 3300025961 Ga0207712_10000005 Ga0207712_10000005260 158
528 3300025972 Ga0207668_10052819 Ga0207668_100528192 158
529 3300025981 Ga0207640_10287126 Ga0207640_102871261 158
530 3300025986 Ga0207658_10000517 Ga0207658_1000051710 158
531 3300025986 Ga0207658_10035209 Ga0207658_100352094 158
532 3300026023 Ga0207677_10131991 Ga0207677_101319912 158
533 3300026035 Ga0207703_10655079 Ga0207703_106550791 158
534 3300026041 Ga0207639_10482122 Ga0207639_104821221 158
535 3300026067 Ga0207678_10044848 Ga0207678_100448482 158
536 3300026067 Ga0207678_10161599 Ga0207678_101615991 158
537 3300026075 Ga0207708_10025129 Ga0207708_100251294 158
538 3300026088 Ga0207641_10001384 Ga0207641_1000138416 158
539 3300026088 Ga0207641_10039593 Ga0207641_100395931 158
540 3300026118 Ga0207675_100023278 Ga0207675_1000232786 158
541 3300026121 Ga0207683_10368685 Ga0207683_103686852 158
542 3300026121 Ga0207683_10551910 Ga0207683_105519101 158
543 3300026142 Ga0207698_10206187 Ga0207698_102061873 158
544 3300026142 Ga0207698_11451604 Ga0207698_114516041 158
545 3300028379 Ga0268266_10007148 Ga0268266_100071489 158
546 3300028379 Ga0268266_10012998 Ga0268266_1001299811 158
547 3300028381 Ga0268264_10000005 Ga0268264_10000005257 158
548 3300028381 Ga0268264_10461616 Ga0268264_104616161 158
549 3300031995 Ga0307409_101957204 Ga0307409_1019572041 158
550 3300032002 Ga0307416_100274418 Ga0307416_1002744183 158
551 3300037853 Ga0436364_0588322 Ga0436364_0588322_74573_75052 158
552 3300039437 Ga0436365_0239327 Ga0436365_0239327_975_1454 158
553 3300039450 Ga0436363_0781113 Ga0436363_0781113_424_903 158
554 3300041410 Ga0439461_0011946 Ga0439461_0011946_30_521 158
555 3300041413 Ga0439465_0004465 Ga0439465_0004465_1913_2404 158
556 3300041463 Ga0451804_0279687 Ga0451804_0279687_395_871 158
557 3300042004 Ga0439445_0052322 Ga0439445_0052322_587_1078 158
558 3300044658 Ga0466972_0004559 Ga0466972_0004559_2654_3169 158
559 3300044683 Ga0466965_0001377 Ga0466965_0001377_6637_7152 158
560 3300044765 Ga0466970_0001021 Ga0466970_0001021_144_659 158
561 3300044842 Ga0466957_0001124 Ga0466957_0001124_3678_4193 158
562 3300044842 Ga0466957_0832435 Ga0466957_0832435_76_552 158
563 3300045049 Ga0466959_0015907 Ga0466959_0015907_621_1136 158
564 3300045976 Ga0466967_0040235 Ga0466967_0040235_3440_3955 158
565 3300045976 Ga0466967_0655764 Ga0466967_0655764_160_636 158
566 3300046459 Ga0495629_0007927 Ga0495629_0007927_2877_3353 158
567 3300046473 Ga0495582_0653640 Ga0495582_0653640_52_528 158
568 3300046477 Ga0495664_0540266 Ga0495664_0540266_177_653 158
569 3300046507 Ga0495606_0162914 Ga0495606_0162914_675_1151 158
570 3300046517 Ga0495630_0309683 Ga0495630_0309683_97_573 158
571 3300046690 Ga0495624_0203952 Ga0495624_0203952_248_724 158
572 3300046694 Ga0495649_0295110 Ga0495649_0295110_107_586 158
573 3300047319 Ga0495674_0016349 Ga0495674_0016349_5114_5590 158
574 3300047320 Ga0495672_0057053 Ga0495672_0057053_168_650 158
575 3300047321 Ga0495676_0138559 Ga0495676_0138559_95_571 158
576 3300047472 Ga0495686_0003291 Ga0495686_0003291_3386_3862 158
577 3300048091 Ga0495626_0056690 Ga0495626_0056690_1268_1747 158
578 3300048903 Ga0496100_0000248 Ga0496100_0000248_53_547 158
579 3300048903 Ga0496100_0251203 Ga0496100_0251203_782_1258 158
580 3300048903 Ga0496100_0731622 Ga0496100_0731622_224_700 158
581 3300048904 Ga0496101_0000262 Ga0496101_0000262_12886_13380 158
582 3300048905 Ga0496102_0000415 Ga0496102_0000415_1177_1653 158
583 3300048905 Ga0496102_0060604 Ga0496102_0060604_2897_3391 158
584 3300048906 Ga0496103_0000906 Ga0496103_0000906_20494_20970 158
585 3300048907 Ga0496104_0010269 Ga0496104_0010269_4609_5103 158
586 3300048909 Ga0496106_0001848 Ga0496106_0001848_13960_14454 158
587 3300048910 Ga0496107_0004232 Ga0496107_0004232_6842_7336 158
588 3300048912 Ga0496109_0283829 Ga0496109_0283829_1035_1511 158
589 3300048913 Ga0496110_0428394 Ga0496110_0428394_11_487 158
590 3300048913 Ga0496110_0577859 Ga0496110_0577859_58_534 158
591 3300048915 Ga0496112_0085913 Ga0496112_0085913_2179_2655 158
592 3300048916 Ga0496113_0021372 Ga0496113_0021372_1406_1882 158
593 3300048917 Ga0496114_0028737 Ga0496114_0028737_2679_3173 158
594 3300048918 Ga0496115_0018412 Ga0496115_0018412_3508_4002 158
595 3300048919 Ga0496116_0101936 Ga0496116_0101936_771_1247 158
596 3300048920 Ga0496117_0040791 Ga0496117_0040791_2043_2519 158
597 3300048921 Ga0496118_0001365 Ga0496118_0001365_17876_18352 158
598 3300048922 Ga0496119_0018915 Ga0496119_0018915_129_605 158
599 3300048923 Ga0496120_0084322 Ga0496120_0084322_1200_1676 158
600 3300048924 Ga0496121_0101156 Ga0496121_0101156_950_1426 158
601 3300048927 Ga0496124_0155389 Ga0496124_0155389_861_1337 158
602 3300048929 Ga0496126_0311617 Ga0496126_0311617_808_1284 158
603 3300050490 nmdc:mga03n38_836646_c1 nmdc:mga03n38_836646_c1_40_516 158
604 3300050491 nmdc:mga00v17_67460_c2 nmdc:mga00v17_67460_c2_574_1050 158
605 3300050496 nmdc:mga07m45_253938_c1 nmdc:mga07m45_253938_c1_91_567 158
606 3300053083 Ga0495655_0010646 Ga0495655_0010646_1247_1723 158
607 3300053083 Ga0495655_0199358 Ga0495655_0199358_159_635 158
608 3300053085 Ga0495619_0084873 Ga0495619_0084873_118_594 158
609 3300053142 Ga0500577_0085933 Ga0500577_0085933_161_637 158
610 iso_pu_bacteria 2523231044 2523386609 158
611 iso_pu_bacteria 2902837492 2902841723 158
612 iso_pu_bacteria 2904765812 2904766151 158
613 iso_pu_bacteria 2904770941 2904773358 158
614 iso_pu_bacteria 2908811453 2908812086 158
615 iso_pu_bacteria 2919420072 2919421423 158
616 iso_pu_bacteria 2919432681 2919432819 158
617 iso_pu_bacteria 2932398195 2932400380 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14539

DUF4442

Domain of unknown function (DUF4442)

45

180

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yoc-assembly1.cif.gz_B crystal structure of genomics apc5556 0.8984 7 157
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.8936 32 155
1sh8-assembly1.cif.gz_B 1.5 a crystal structure of a protein of unknown function pa5026 from pseudomonas aeruginosa, probable thioesterase 0.8901 21 156
3nwz-assembly2.cif.gz_C crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.8837 51 154
1zki-assembly1.cif.gz_B structure of conserved protein pa5202 from pseudomonas aeruginosa 0.8777 34 154
ID Description Score Start End Superfamily
1yocA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9496 4 157 3.10.129.10
1yocA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9432 4 157 3.10.129.10
1sh8B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8901 21 156 3.10.129.10
3dkzB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8753 35 154 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8748 34 156 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A0B2YI15-F1-model_v4 deleted 0.9998 3 157
AF-A0A1A0QCI6-F1-model_v4 deleted 0.9994 2 157
AF-A0A0U1D578-F1-model_v4 Thioesterase 0.9974 58 157
AF-A0A653FGZ7-F1-model_v4 Uncharacterized protein 0.9956 1 158
AF-F6EHX7-F1-model_v4 Thioesterase 0.9922 40 158

Feature Viewer

pLDDT pTM Quality
95.24 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map