F469697

General Info

Members Datasets Scaffolds Average Seq Length
618 277 1236 281

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1000041|JGI25162J39368_1000041141
Length 292
Sequence MSSALVLCRFLHFIVVLMLFGAXLFRPLLLRHEPLTQALATLDQRLAKLSRLLAGFALFTGVCWLLLITASMAGSLSAAFDWPTVQLVLSNTFFGQVWRWHLLFNGLLVVCLLSPLSNSFALRMLLSSLLLMTLAPVGHGAMLDGLSGQLLILNQVIHLTCVGAWLGGLMLLMMILLRPTTHAVEPILQRFSGIGYGLVAGLLVTGLINVRVLTGAFWPTPLLSGFALILLIKVLLVSAMLGLALFNRLKIKHCEQRLSTLRTSVMLEWLLGIAAVAAVSLLGTLPPMVAGN

Samples

Sample ID Description Type Environment
1 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
2 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
20 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
21 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
22 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
23 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
37 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
43 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
59 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
63 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
64 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
65 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
66 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
67 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
68 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
69 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
70 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
71 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
72 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
73 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
74 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
75 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
76 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
80 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
85 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
86 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
87 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
88 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
89 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
90 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
91 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
94 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
110 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
140 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
143 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
144 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
145 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
151 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
172 2511231006 Pseudomonas sp. GM17 Isolate Nodule
173 2511231010 Pseudomonas sp. GM25 Isolate Nodule
174 2511231011 Pseudomonas sp. GM30 Isolate Nodule
175 2511231012 Pseudomonas sp. GM33 Isolate Nodule
176 2511231014 Pseudomonas sp. GM48 Isolate Nodule
177 2511231015 Pseudomonas sp. GM49 Isolate Nodule
178 2511231017 Pseudomonas sp. GM55 Isolate Nodule
179 2511231018 Pseudomonas sp. GM60 Isolate Nodule
180 2511231019 Pseudomonas sp. GM67 Isolate Nodule
181 2511231020 Pseudomonas sp. GM74 Isolate Nodule
182 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
183 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
184 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
185 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
186 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
187 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
188 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
189 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
190 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
191 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
192 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
193 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
194 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
195 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
196 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
197 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
198 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
199 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
200 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
201 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
202 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
203 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
204 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
205 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
206 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
207 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
208 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
209 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
210 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
211 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
212 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
213 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
214 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
215 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
216 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
217 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
218 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
219 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
220 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
221 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
222 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
223 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
224 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
225 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
226 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
227 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
228 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
229 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
230 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
231 2784132063 Pseudomonas sp. 424 Isolate Unclassified
232 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
233 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
234 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
235 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
236 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
237 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
238 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
239 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
240 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
241 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
242 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
243 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
244 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
245 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
246 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
247 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
248 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
249 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
250 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
251 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
252 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
253 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
254 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
255 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
256 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
257 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
258 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
259 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
260 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
261 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
262 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
263 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
264 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
265 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
266 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
267 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
268 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
269 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
270 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
271 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
272 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
273 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
274 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
275 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
276 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
277 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.85
Metatranscriptomes 0
Isolates 17.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.88
Nodule 1.78
Rhizoplane 5.83
Rhizosphere 74.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000041 3300002737 Bacteria 174952
2 JGI25162J39368_1000014 3300002737 Bacteria 328873
3 JGI25163J39215_1000165 3300002771 Bacteria 26186
4 JGI25163J39215_1000405 3300002771 Bacteria 13638
5 JGI25164J39214_1000021 3300002772 Bacteria 174952
6 JGI25164J39214_1000059 3300002772 Bacteria 111483
7 JGI25165J46597_1000027 3300003214 Bacteria 328873
8 JGI25165J46597_1000081 3300003214 Bacteria 174952
9 Ga0055536_1000247 3300003781 Bacteria 42902
10 Ga0055530_10007832 3300003791 Bacteria 4408
11 Ga0065714_10009491 3300005288 Bacteria 2920
12 Ga0065714_10015504 3300005288 Bacteria 2542
13 Ga0065714_10068521 3300005288 Bacteria 4681
14 Ga0065714_10088919 3300005288 Bacteria 1999
15 Ga0065714_10089615 3300005288 Bacteria 1973
16 Ga0065714_10091359 3300005288 Bacteria 1913
17 Ga0065704_10143356 3300005289 Bacteria 1496
18 Ga0065712_10138491 3300005290 Bacteria 1473
19 Ga0070670_100000303 3300005331 Bacteria 42489
20 Ga0070670_100004984 3300005331 Bacteria 11172
21 Ga0070661_100000036 3300005344 Bacteria 108531
22 Ga0070669_100000891 3300005353 Bacteria 21725
23 Ga0070662_100001590 3300005457 Bacteria 14033
24 Ga0068853_100023697 3300005539 Bacteria 5142
25 Ga0070665_100272990 3300005548 Bacteria 1693
26 Ga0070664_100000275 3300005564 Bacteria 37073
27 Ga0068851_10000132 3300005834 Bacteria 40261
28 Ga0075364_10099480 3300006051 Bacteria 1936
29 Ga0075432_10004417 3300006058 Bacteria 4788
30 Ga0075432_10009815 3300006058 Bacteria 3254
31 Ga0075432_10029657 3300006058 Bacteria 1889
32 Ga0075432_10042407 3300006058 Bacteria 1592
33 Ga0075432_10046795 3300006058 Bacteria 1519
34 Ga0075432_10053649 3300006058 Bacteria 1426
35 Ga0075436_100110392 3300006914 Bacteria 1919
36 Ga0075436_100323668 3300006914 Bacteria 1108
37 Ga0105251_10000168 3300009011 Bacteria 67221
38 Ga0105251_10001353 3300009011 Bacteria 21185
39 Ga0105251_10005941 3300009011 Bacteria 7883
40 Ga0105251_10031946 3300009011 Bacteria 2628
41 Ga0105251_10062852 3300009011 Bacteria 1743
42 Ga0105251_10114361 3300009011 Bacteria 1228
43 Ga0105244_10000801 3300009036 Bacteria 26759
44 Ga0105244_10002677 3300009036 Bacteria 13327
45 Ga0105244_10002826 3300009036 Bacteria 12878
46 Ga0105244_10033024 3300009036 Bacteria 2733
47 Ga0105244_10046496 3300009036 Bacteria 2229
48 Ga0105250_10000122 3300009092 Bacteria 67516
49 Ga0105250_10000583 3300009092 Bacteria 23970
50 Ga0105250_10000591 3300009092 Bacteria 23712
51 Ga0105250_10033711 3300009092 Bacteria 2056
52 Ga0105243_10011007 3300009148 Bacteria 6840
53 Ga0105242_10003661 3300009176 Bacteria 11960
54 Ga0105237_10001372 3300009545 Bacteria 32130
55 Ga0105246_10007319 3300011119 Bacteria 6762
56 Ga0105246_10011012 3300011119 Bacteria 5605
57 Ga0157373_10000784 3300013100 Bacteria 24454
58 Ga0157373_10002739 3300013100 Bacteria 13345
59 Ga0157373_10034006 3300013100 Bacteria 3662
60 Ga0157373_10235217 3300013100 Bacteria 1294
61 Ga0157371_10000147 3300013102 Bacteria 102369
62 Ga0157371_10000771 3300013102 Bacteria 36847
63 Ga0157370_10031156 3300013104 Bacteria 5219
64 Ga0157370_10074440 3300013104 Bacteria 3203
65 Ga0157370_10156727 3300013104 Bacteria 2118
66 Ga0157369_10005184 3300013105 Bacteria 15232
67 Ga0157369_10008823 3300013105 Bacteria 11550
68 Ga0157369_10083900 3300013105 Bacteria 3407
69 Ga0157372_10009492 3300013307 Bacteria 10346
70 Ga0157375_10001567 3300013308 Bacteria 19698
71 Ga0157375_10025255 3300013308 Bacteria 5517
72 Ga0157375_10045094 3300013308 Bacteria 4290
73 Ga0182008_10000525 3300014497 Bacteria 28726
74 Ga0182008_10005142 3300014497 Bacteria 7506
75 Ga0182008_10008636 3300014497 Bacteria 5547
76 Ga0182008_10010543 3300014497 Bacteria 4944
77 Ga0182008_10042632 3300014497 Bacteria 2260
78 Ga0182006_1001855 3300015261 Bacteria 12119
79 Ga0182006_1006100 3300015261 Bacteria 5636
80 Ga0182006_1010465 3300015261 Bacteria 4125
81 Ga0182006_1028140 3300015261 Bacteria 2288
82 Ga0182007_10001820 3300015262 Bacteria 11128
83 Ga0182005_1001427 3300015265 Bacteria 9634
84 Ga0182005_1020183 3300015265 Bacteria 1835
85 Ga0163161_10022110 3300017792 Bacteria 4476
86 Ga0163161_10025470 3300017792 Bacteria 4186
87 Ga0163161_10043048 3300017792 Bacteria 3250
88 Ga0163161_10085150 3300017792 Bacteria 2332
89 Ga0163161_10111018 3300017792 Bacteria 2050
90 Ga0163161_10172005 3300017792 Bacteria 1657
91 Ga0163161_10182530 3300017792 Bacteria 1610
92 Ga0163161_10307702 3300017792 Bacteria 1249
93 Ga0163161_10363541 3300017792 Bacteria 1153
94 Ga0209760_100025 3300025207 Bacteria 156628
95 Ga0209760_100074 3300025207 Bacteria 80573
96 Ga0207427_100003 3300025231 Bacteria 1035004
97 Ga0207427_100064 3300025231 Bacteria 174987
98 Ga0209437_100002 3300025233 Bacteria 1574801
99 Ga0209437_100044 3300025233 Bacteria 430619
100 Ga0209233_1000004 3300025261 Bacteria 1574798
101 Ga0209233_1000057 3300025261 Bacteria 430619
102 Ga0209676_1004916 3300025292 Bacteria 7194
103 Ga0209050_1000914 3300025298 Bacteria 38994
104 Ga0209051_1002770 3300025303 Bacteria 12099
105 Ga0207656_10000880 3300025321 Bacteria 9793
106 Ga0207696_1000051 3300025711 Bacteria 276833
107 Ga0207696_1000108 3300025711 Bacteria 157445
108 Ga0207696_1000264 3300025711 Bacteria 67521
109 Ga0207696_1007743 3300025711 Bacteria 4174
110 Ga0207655_1000173 3300025728 Bacteria 118589
111 Ga0207655_1001582 3300025728 Bacteria 20417
112 Ga0207655_1002917 3300025728 Bacteria 13164
113 Ga0207655_1010438 3300025728 Bacteria 5630
114 Ga0207655_1025183 3300025728 Bacteria 2895
115 Ga0207655_1029183 3300025728 Bacteria 2588
116 Ga0207713_1000020 3300025735 Bacteria 359258
117 Ga0207713_1002121 3300025735 Bacteria 14783
118 Ga0207713_1002307 3300025735 Bacteria 14027
119 Ga0207713_1005552 3300025735 Bacteria 7860
120 Ga0207713_1008034 3300025735 Bacteria 6132
121 Ga0207713_1026659 3300025735 Bacteria 2642
122 Ga0207671_10001354 3300025914 Bacteria 28611
123 Ga0207649_10000042 3300025920 Bacteria 117456
124 Ga0207681_10004855 3300025923 Bacteria 8261
125 Ga0207650_10000068 3300025925 Bacteria 139947
126 Ga0207650_10000240 3300025925 Bacteria 60809
127 Ga0207706_10063620 3300025933 Bacteria 3248
128 Ga0207709_10001157 3300025935 Bacteria 19199
129 Ga0207679_10000044 3300025945 Bacteria 122251
130 Ga0207428_10029342 3300027907 Bacteria 4560
131 Ga0207428_10052164 3300027907 Bacteria 3268
132 Ga0207428_10158460 3300027907 Bacteria 1720
133 Ga0307517_10108361 3300028786 Bacteria 2133
134 Ga0307511_10076457 3300030521 Bacteria 2393
135 Ga0307405_10008864 3300031731 Bacteria 5128
136 Ga0307412_10154313 3300031911 Bacteria 1698
137 Ga0439438_015042 3300041405 Bacteria 2286
138 Ga0439438_026174 3300041405 Bacteria 1583
139 Ga0439447_002212 3300041407 Bacteria 7135
140 Ga0439447_033104 3300041407 Bacteria 1290
141 Ga0439466_0003304 3300041411 Bacteria 6269
142 Ga0439432_001132 3300042006 Bacteria 10119
143 Ga0439432_006138 3300042006 Bacteria 4303
144 Ga0439451_006463 3300042009 Bacteria 2396
145 Ga0439452_011826 3300042010 Bacteria 2499
146 Ga0439452_015042 3300042010 Bacteria 2132
147 Ga0439463_003863 3300042016 Bacteria 3778
148 Ga0450899_005173 3300042135 Bacteria 1401
149 Ga0450907_000140 3300042146 Bacteria 27596
150 Ga0439446_0030566 3300042156 Bacteria 1556
151 Ga0450909_006821 3300042185 Bacteria 1645
152 Ga0439434_0000827 3300042435 Bacteria 8916
153 Ga0439440_0002114 3300042993 Bacteria 3710
154 Ga0495617_000954 3300046452 Bacteria 13433
155 Ga0495617_004226 3300046452 Bacteria 5249
156 Ga0495617_014223 3300046452 Bacteria 2705
157 Ga0495617_025484 3300046452 Bacteria 1993
158 Ga0495627_001501 3300046453 Bacteria 13468
159 Ga0495627_020048 3300046453 Bacteria 2233
160 Ga0495627_024162 3300046453 Bacteria 1983
161 Ga0495592_0168844 3300046454 Bacteria 1499
162 Ga0495603_0007516 3300046455 Bacteria 6553
163 Ga0495603_0008796 3300046455 Bacteria 6102
164 Ga0495590_0001143 3300046457 Bacteria 11622
165 Ga0495590_0004895 3300046457 Bacteria 5352
166 Ga0495590_0096868 3300046457 Bacteria 1046
167 Ga0495590_0163281 3300046457 Bacteria 810
168 Ga0495591_000533 3300046458 Bacteria 29482
169 Ga0495591_002186 3300046458 Bacteria 11168
170 Ga0495591_014717 3300046458 Bacteria 2796
171 Ga0495591_016241 3300046458 Bacteria 2602
172 Ga0495591_022210 3300046458 Bacteria 2055
173 Ga0495591_032870 3300046458 Bacteria 1540
174 Ga0495591_051965 3300046458 Bacteria 1116
175 Ga0495638_0003846 3300046460 Bacteria 11661
176 Ga0495638_0004285 3300046460 Bacteria 10824
177 Ga0495638_0027625 3300046460 Bacteria 3671
178 Ga0495638_0043277 3300046460 Bacteria 2841
179 Ga0495638_0052268 3300046460 Bacteria 2545
180 Ga0495638_0055055 3300046460 Bacteria 2471
181 Ga0495638_0055465 3300046460 Bacteria 2460
182 Ga0495638_0073047 3300046460 Bacteria 2094
183 Ga0495638_0074917 3300046460 Bacteria 2063
184 Ga0495638_0110853 3300046460 Bacteria 1630
185 Ga0495638_0130942 3300046460 Bacteria 1473
186 Ga0495638_0203055 3300046460 Bacteria 1118
187 Ga0495650_0007460 3300046471 Bacteria 6564
188 Ga0495650_0083993 3300046471 Bacteria 1222
189 Ga0495582_0018485 3300046473 Bacteria 3811
190 Ga0495605_0009407 3300046474 Bacteria 5489
191 Ga0495605_0019997 3300046474 Bacteria 3563
192 Ga0495605_0020400 3300046474 Bacteria 3522
193 Ga0495605_0034099 3300046474 Bacteria 2579
194 Ga0495605_0155094 3300046474 Bacteria 1019
195 Ga0495639_0015257 3300046475 Bacteria 3330
196 Ga0495639_0133786 3300046475 Bacteria 1188
197 Ga0495584_0001259 3300046491 Bacteria 15455
198 Ga0495584_0004158 3300046491 Bacteria 7813
199 Ga0495584_0014777 3300046491 Bacteria 3977
200 Ga0495584_0017547 3300046491 Bacteria 3642
201 Ga0495585_0003983 3300046492 Bacteria 9739
202 Ga0495585_0013722 3300046492 Bacteria 4735
203 Ga0495585_0037282 3300046492 Bacteria 2738
204 Ga0495585_0048883 3300046492 Bacteria 2350
205 Ga0495585_0051143 3300046492 Bacteria 2290
206 Ga0495585_0115801 3300046492 Bacteria 1421
207 Ga0495585_0117362 3300046492 Bacteria 1410
208 Ga0495585_0150026 3300046492 Bacteria 1216
209 Ga0495594_0041673 3300046499 Bacteria 2513
210 Ga0495596_0001522 3300046500 Bacteria 13225
211 Ga0495607_0003760 3300046501 Bacteria 11473
212 Ga0495607_0013118 3300046501 Bacteria 5440
213 Ga0495607_0031841 3300046501 Bacteria 3225
214 Ga0495607_0058558 3300046501 Bacteria 2201
215 Ga0495607_0073352 3300046501 Bacteria 1903
216 Ga0495607_0256382 3300046501 Bacteria 840
217 Ga0495607_0258664 3300046501 Bacteria 834
218 Ga0495583_0000813 3300046506 Bacteria 38429
219 Ga0495583_0015809 3300046506 Bacteria 4086
220 Ga0495583_0025588 3300046506 Bacteria 2945
221 Ga0495583_0073021 3300046506 Bacteria 1504
222 Ga0495606_0003409 3300046507 Bacteria 16880
223 Ga0495606_0006605 3300046507 Bacteria 10652
224 Ga0495606_0008724 3300046507 Bacteria 8726
225 Ga0495606_0020906 3300046507 Bacteria 4807
226 Ga0495606_0022655 3300046507 Bacteria 4568
227 Ga0495606_0043175 3300046507 Bacteria 3008
228 Ga0495606_0043845 3300046507 Bacteria 2979
229 Ga0495606_0111292 3300046507 Bacteria 1651
230 Ga0495606_0270222 3300046507 Bacteria 934
231 Ga0495610_0008962 3300046512 Bacteria 6398
232 Ga0495610_0012041 3300046512 Bacteria 5236
233 Ga0495610_0013686 3300046512 Bacteria 4807
234 Ga0495610_0025211 3300046512 Bacteria 3196
235 Ga0495610_0029318 3300046512 Bacteria 2899
236 Ga0495610_0036068 3300046512 Bacteria 2531
237 Ga0495610_0037329 3300046512 Bacteria 2474
238 Ga0495610_0097363 3300046512 Bacteria 1323
239 Ga0495610_0110967 3300046512 Bacteria 1215
240 Ga0495620_0000231 3300046515 Bacteria 41704
241 Ga0495620_0006599 3300046515 Bacteria 6363
242 Ga0495620_0013805 3300046515 Bacteria 4128
243 Ga0495620_0022744 3300046515 Bacteria 3012
244 Ga0495620_0031804 3300046515 Bacteria 2412
245 Ga0495628_0172040 3300046516 Bacteria 1642
246 Ga0495630_0033134 3300046517 Bacteria 3852
247 Ga0495630_0070229 3300046517 Bacteria 2635
248 Ga0495630_0072774 3300046517 Bacteria 2587
249 Ga0495630_0156856 3300046517 Bacteria 1732
250 Ga0495631_0000275 3300046518 Bacteria 35971
251 Ga0495631_0031742 3300046518 Bacteria 2385
252 Ga0495631_0041085 3300046518 Bacteria 2047
253 Ga0495632_0003919 3300046519 Bacteria 10335
254 Ga0495632_0012444 3300046519 Bacteria 4908
255 Ga0495632_0017422 3300046519 Bacteria 3965
256 Ga0495632_0079757 3300046519 Bacteria 1562
257 Ga0495632_0114551 3300046519 Bacteria 1264
258 Ga0495637_0000632 3300046520 Bacteria 24749
259 Ga0495637_0002657 3300046520 Bacteria 9779
260 Ga0495637_0022865 3300046520 Bacteria 2845
261 Ga0495637_0023114 3300046520 Bacteria 2829
262 Ga0495637_0027672 3300046520 Bacteria 2534
263 Ga0495637_0028929 3300046520 Bacteria 2470
264 Ga0495637_0037187 3300046520 Bacteria 2115
265 Ga0495637_0050263 3300046520 Bacteria 1749
266 Ga0495643_0029185 3300046522 Bacteria 3087
267 Ga0495643_0048524 3300046522 Bacteria 2294
268 Ga0495643_0058752 3300046522 Bacteria 2045
269 Ga0495643_0147967 3300046522 Bacteria 1165
270 Ga0495643_0148099 3300046522 Bacteria 1165
271 Ga0495644_0012174 3300046523 Bacteria 3306
272 Ga0495644_0048124 3300046523 Bacteria 1601
273 Ga0495648_0002745 3300046524 Bacteria 15897
274 Ga0495648_0003911 3300046524 Bacteria 12903
275 Ga0495648_0005770 3300046524 Bacteria 10213
276 Ga0495648_0007279 3300046524 Bacteria 8879
277 Ga0495648_0009796 3300046524 Bacteria 7372
278 Ga0495648_0034416 3300046524 Bacteria 3296
279 Ga0495648_0047947 3300046524 Bacteria 2634
280 Ga0495648_0084466 3300046524 Bacteria 1796
281 Ga0495648_0108198 3300046524 Bacteria 1518
282 Ga0495648_0215274 3300046524 Bacteria 951
283 Ga0495648_0268404 3300046524 Bacteria 815
284 Ga0495666_0009236 3300046526 Bacteria 4930
285 Ga0495666_0014961 3300046526 Bacteria 3860
286 Ga0495642_0000067 3300046528 Bacteria 61823
287 Ga0495652_0245677 3300046529 Bacteria 1329
288 Ga0495654_0004696 3300046530 Bacteria 8048
289 Ga0495654_0010440 3300046530 Bacteria 5054
290 Ga0495654_0013373 3300046530 Bacteria 4393
291 Ga0495654_0034109 3300046530 Bacteria 2570
292 Ga0495654_0034598 3300046530 Bacteria 2547
293 Ga0495654_0035530 3300046530 Bacteria 2508
294 Ga0495654_0037936 3300046530 Bacteria 2412
295 Ga0495654_0040096 3300046530 Bacteria 2335
296 Ga0495654_0079213 3300046530 Bacteria 1543
297 Ga0495586_0028017 3300046535 Bacteria 3014
298 Ga0495587_0008026 3300046536 Bacteria 6814
299 Ga0495587_0176561 3300046536 Bacteria 1212
300 Ga0495587_0180147 3300046536 Bacteria 1198
301 Ga0495609_0017820 3300046538 Bacteria 3296
302 Ga0495609_0136646 3300046538 Bacteria 1047
303 Ga0495597_0003816 3300046542 Bacteria 8570
304 Ga0495597_0017495 3300046542 Bacteria 3371
305 Ga0495597_0030340 3300046542 Bacteria 2464
306 Ga0495597_0037405 3300046542 Bacteria 2179
307 Ga0495645_0063609 3300046543 Bacteria 2671
308 Ga0495622_0044504 3300046557 Bacteria 2063
309 Ga0495622_0047006 3300046557 Bacteria 2006
310 Ga0495622_0053797 3300046557 Bacteria 1868
311 Ga0495622_0083158 3300046557 Bacteria 1473
312 Ga0495622_0158861 3300046557 Bacteria 1020
313 Ga0495633_0041268 3300046558 Bacteria 2195
314 Ga0495633_0057282 3300046558 Bacteria 1830
315 Ga0495633_0128699 3300046558 Bacteria 1171
316 Ga0495656_0002252 3300046615 Bacteria 6377
317 Ga0495656_0022598 3300046615 Bacteria 2465
318 Ga0495656_0028395 3300046615 Bacteria 2244
319 Ga0495668_0002597 3300046616 Bacteria 14638
320 Ga0495668_0002653 3300046616 Bacteria 14376
321 Ga0495634_0010691 3300046642 Bacteria 6718
322 Ga0495611_0038388 3300046648 Bacteria 2130
323 Ga0495611_0095153 3300046648 Bacteria 1378
324 Ga0495625_0003348 3300046660 Bacteria 16135
325 Ga0495625_0137588 3300046660 Bacteria 1649
326 Ga0495625_0152224 3300046660 Bacteria 1554
327 Ga0495625_0219617 3300046660 Bacteria 1246
328 Ga0495625_0245958 3300046660 Bacteria 1162
329 Ga0495635_0005376 3300046663 Bacteria 8915
330 Ga0495635_0041815 3300046663 Bacteria 3166
331 Ga0495661_0001162 3300046665 Bacteria 22969
332 Ga0495661_0008184 3300046665 Bacteria 7249
333 Ga0495661_0044893 3300046665 Bacteria 2706
334 Ga0495661_0053004 3300046665 Bacteria 2441
335 Ga0495661_0111911 3300046665 Bacteria 1520
336 Ga0495588_0035000 3300046674 Bacteria 2543
337 Ga0495588_0046616 3300046674 Bacteria 2223
338 Ga0495588_0108436 3300046674 Bacteria 1462
339 Ga0495657_0108402 3300046675 Bacteria 1762
340 Ga0495623_0006054 3300046679 Bacteria 7864
341 Ga0495623_0047708 3300046679 Bacteria 2719
342 Ga0495646_0023306 3300046680 Bacteria 3898
343 Ga0495646_0032220 3300046680 Bacteria 3262
344 Ga0495669_0005517 3300046684 Bacteria 5279
345 Ga0495613_0044332 3300046689 Bacteria 3291
346 Ga0495613_0128741 3300046689 Bacteria 1813
347 Ga0495624_0005052 3300046690 Bacteria 9545
348 Ga0495670_0013190 3300046691 Bacteria 4064
349 Ga0495670_0024849 3300046691 Bacteria 2961
350 Ga0495670_0063715 3300046691 Bacteria 1856
351 Ga0495670_0090521 3300046691 Bacteria 1565
352 Ga0495671_0007038 3300046692 Bacteria 6445
353 Ga0495671_0033129 3300046692 Bacteria 2633
354 Ga0495671_0035190 3300046692 Bacteria 2544
355 Ga0495671_0044316 3300046692 Bacteria 2231
356 Ga0495671_0045178 3300046692 Bacteria 2206
357 Ga0495671_0108684 3300046692 Bacteria 1354
358 Ga0495671_0118914 3300046692 Bacteria 1289
359 Ga0495649_0012080 3300046694 Bacteria 5038
360 Ga0495649_0029610 3300046694 Bacteria 3027
361 Ga0495649_0039383 3300046694 Bacteria 2591
362 Ga0495649_0051521 3300046694 Bacteria 2231
363 Ga0495649_0055771 3300046694 Bacteria 2134
364 Ga0495649_0058309 3300046694 Bacteria 2080
365 Ga0495649_0157093 3300046694 Bacteria 1193
366 Ga0495589_0005175 3300046794 Bacteria 6895
367 Ga0495589_0013723 3300046794 Bacteria 4178
368 Ga0495589_0035430 3300046794 Bacteria 2502
369 Ga0495589_0067080 3300046794 Bacteria 1756
370 Ga0495589_0069343 3300046794 Bacteria 1724
371 Ga0495600_0009462 3300046809 Bacteria 6022
372 Ga0495660_0010021 3300046810 Bacteria 5512
373 Ga0495660_0019081 3300046810 Bacteria 3937
374 Ga0495660_0019690 3300046810 Bacteria 3872
375 Ga0495660_0020349 3300046810 Bacteria 3803
376 Ga0495660_0037022 3300046810 Bacteria 2719
377 Ga0495660_0070047 3300046810 Bacteria 1862
378 Ga0495604_0005618 3300047317 Bacteria 9944
379 Ga0495604_0027642 3300047317 Bacteria 4509
380 Ga0495674_0069891 3300047319 Bacteria 3035
381 Ga0495672_0003277 3300047320 Bacteria 14018
382 Ga0495672_0008375 3300047320 Bacteria 7645
383 Ga0495672_0014680 3300047320 Bacteria 5350
384 Ga0495672_0015185 3300047320 Bacteria 5240
385 Ga0495672_0015612 3300047320 Bacteria 5148
386 Ga0495672_0028605 3300047320 Bacteria 3523
387 Ga0495672_0036382 3300047320 Bacteria 3023
388 Ga0495672_0043667 3300047320 Bacteria 2693
389 Ga0495672_0045458 3300047320 Bacteria 2626
390 Ga0495672_0055683 3300047320 Bacteria 2307
391 Ga0495672_0084203 3300047320 Bacteria 1764
392 Ga0495672_0233332 3300047320 Bacteria 902
393 Ga0495676_0152262 3300047321 Bacteria 1644
394 Ga0495680_0030591 3300047322 Bacteria 4394
395 Ga0495680_0097972 3300047322 Bacteria 2188
396 Ga0495680_0112036 3300047322 Bacteria 2021
397 Ga0495680_0254844 3300047322 Bacteria 1242
398 Ga0495683_0003385 3300047323 Bacteria 9315
399 Ga0495683_0104191 3300047323 Bacteria 1361
400 Ga0495687_002144 3300047443 Bacteria 16474
401 Ga0495687_011658 3300047443 Bacteria 4707
402 Ga0495675_0030773 3300047444 Bacteria 3424
403 Ga0495675_0074705 3300047444 Bacteria 2135
404 Ga0495677_0006622 3300047445 Bacteria 4367
405 Ga0495679_001670 3300047446 Bacteria 12333
406 Ga0495679_005475 3300047446 Bacteria 5624
407 Ga0495679_012561 3300047446 Bacteria 3216
408 Ga0495679_013140 3300047446 Bacteria 3121
409 Ga0495679_015057 3300047446 Bacteria 2841
410 Ga0495673_0000077 3300047469 Bacteria 204403
411 Ga0495673_0002071 3300047469 Bacteria 14668
412 Ga0495673_0008979 3300047469 Bacteria 5567
413 Ga0495673_0013504 3300047469 Bacteria 4285
414 Ga0495673_0041702 3300047469 Bacteria 2064
415 Ga0495673_0041960 3300047469 Bacteria 2056
416 Ga0495673_0059926 3300047469 Bacteria 1634
417 Ga0495673_0101838 3300047469 Bacteria 1159
418 Ga0495673_0145557 3300047469 Bacteria 920
419 Ga0495673_0171504 3300047469 Bacteria 826
420 Ga0495681_0001694 3300047470 Bacteria 16333
421 Ga0495681_0027487 3300047470 Bacteria 2941
422 Ga0495681_0031212 3300047470 Bacteria 2701
423 Ga0495681_0032196 3300047470 Bacteria 2642
424 Ga0495681_0040976 3300047470 Bacteria 2251
425 Ga0495681_0042856 3300047470 Bacteria 2187
426 Ga0495684_0081514 3300047471 Bacteria 2455
427 Ga0495684_0137814 3300047471 Bacteria 1830
428 Ga0495686_0023956 3300047472 Bacteria 4014
429 Ga0495686_0062889 3300047472 Bacteria 2301
430 Ga0495593_0007329 3300047673 Bacteria 6462
431 Ga0495593_0019565 3300047673 Bacteria 3795
432 Ga0495593_0028760 3300047673 Bacteria 3051
433 Ga0495593_0175212 3300047673 Bacteria 1080
434 Ga0495602_0009891 3300048088 Bacteria 9895
435 Ga0495614_0129640 3300048089 Bacteria 1115
436 Ga0495626_0000647 3300048091 Bacteria 33586
437 Ga0495626_0000727 3300048091 Bacteria 30796
438 Ga0495626_0002545 3300048091 Bacteria 12517
439 Ga0495626_0003906 3300048091 Bacteria 9338
440 Ga0495626_0009169 3300048091 Bacteria 5361
441 Ga0495626_0053347 3300048091 Bacteria 1861
442 Ga0496102_0000073 3300048905 Bacteria 149887
443 Ga0496103_0027756 3300048906 Bacteria 3433
444 Ga0496107_0411921 3300048910 Bacteria 1005
445 Ga0496112_0277675 3300048915 Bacteria 1623
446 Ga0496115_0091725 3300048918 Bacteria 2483
447 Ga0496116_0000221 3300048919 Bacteria 106314
448 Ga0496116_0023558 3300048919 Bacteria 4582
449 Ga0496116_0031455 3300048919 Bacteria 3798
450 Ga0496117_0002605 3300048920 Bacteria 22421
451 Ga0496117_0009691 3300048920 Bacteria 8904
452 Ga0496117_0016267 3300048920 Bacteria 6286
453 Ga0496117_0046132 3300048920 Bacteria 3137
454 Ga0496117_0049409 3300048920 Bacteria 2992
455 Ga0496117_0062021 3300048920 Bacteria 2565
456 Ga0496117_0140343 3300048920 Bacteria 1448
457 Ga0496117_0242853 3300048920 Bacteria 987
458 Ga0496118_0024655 3300048921 Bacteria 5185
459 Ga0496118_0024888 3300048921 Bacteria 5152
460 Ga0496118_0025424 3300048921 Bacteria 5077
461 Ga0496118_0028686 3300048921 Bacteria 4681
462 Ga0496118_0030667 3300048921 Bacteria 4479
463 Ga0496118_0070625 3300048921 Bacteria 2520
464 Ga0496118_0074477 3300048921 Bacteria 2426
465 Ga0496118_0102511 3300048921 Bacteria 1928
466 Ga0496118_0260643 3300048921 Bacteria 978
467 Ga0496119_0011139 3300048922 Bacteria 7489
468 Ga0496119_0018504 3300048922 Bacteria 5180
469 Ga0496119_0046113 3300048922 Bacteria 2725
470 Ga0496119_0094496 3300048922 Bacteria 1691
471 Ga0496119_0095359 3300048922 Bacteria 1680
472 Ga0496119_0220902 3300048922 Bacteria 970
473 Ga0496120_0006672 3300048923 Bacteria 8800
474 Ga0496120_0015474 3300048923 Bacteria 5027
475 Ga0496120_0037342 3300048923 Bacteria 2883
476 Ga0496120_0084800 3300048923 Bacteria 1706
477 Ga0496121_0000307 3300048924 Bacteria 101849
478 Ga0496121_0107878 3300048924 Bacteria 2131
479 Ga0496121_0120571 3300048924 Bacteria 1981
480 Ga0496121_0130415 3300048924 Bacteria 1882
481 Ga0496122_0005969 3300048925 Bacteria 14254
482 Ga0496122_0010797 3300048925 Bacteria 9357
483 Ga0496122_0029513 3300048925 Bacteria 4624
484 Ga0496122_0049028 3300048925 Bacteria 3240
485 Ga0496122_0079243 3300048925 Bacteria 2296
486 Ga0496123_0004380 3300048926 Bacteria 14895
487 Ga0496123_0007869 3300048926 Bacteria 9908
488 Ga0496123_0022827 3300048926 Bacteria 4807
489 Ga0496123_0053117 3300048926 Bacteria 2681
490 Ga0496124_0012169 3300048927 Bacteria 8517
491 Ga0496124_0024608 3300048927 Bacteria 5469
492 Ga0496124_0062409 3300048927 Bacteria 3118
493 Ga0496124_0208307 3300048927 Bacteria 1481
494 Ga0496125_0000862 3300048928 Bacteria 48602
495 Ga0496125_0002740 3300048928 Bacteria 22304
496 Ga0496125_0034714 3300048928 Bacteria 4439
497 Ga0496125_0056172 3300048928 Bacteria 3200
498 Ga0496125_0073885 3300048928 Bacteria 2647
499 Ga0496125_0133047 3300048928 Bacteria 1746
500 Ga0496126_0026916 3300048929 Bacteria 5504
501 Ga0496126_0039578 3300048929 Bacteria 4373
502 Ga0496126_0077614 3300048929 Bacteria 2944
503 Ga0496126_0125906 3300048929 Bacteria 2217
504 Ga0496126_0258911 3300048929 Bacteria 1447
505 Ga0495678_011179 3300049459 Bacteria 4314
506 Ga0495678_029950 3300049459 Bacteria 2282
507 Ga0495682_0000263 3300049460 Bacteria 41617
508 Ga0495682_0015867 3300049460 Bacteria 2852
509 Ga0495682_0042886 3300049460 Bacteria 1657
510 Ga0495682_0054107 3300049460 Bacteria 1457
511 nmdc:mga00v17_82249_c1 3300050491 Bacteria 2012
512 Ga0500634_0003362 3300053161 Bacteria 7087
513 2511263765 2511231006 Bacteria 6794709
514 2511289068 2511231010 Bacteria 6373152
515 2511296224 2511231011 Bacteria 6149768
516 2511300326 2511231012 Bacteria 6738011
517 2511314658 2511231014 Bacteria 6462302
518 2511322871 2511231015 Bacteria 6598026
519 2511331391 2511231017 Bacteria 6503007
520 2511336165 2511231018 Bacteria 6436256
521 2511342250 2511231019 Bacteria 6520662
522 2511348471 2511231020 Bacteria 6115223
523 2512327041 2512047018 Bacteria 6663241
524 2555669548 2554235341 Bacteria 6867980
525 2583793007 2582580891 Bacteria 6800976
526 2597857547 2597489887 Bacteria 6666321
527 2597864675 2597489888 Bacteria 6179543
528 2597870485 2597489889 Bacteria 6297495
529 2599353454 2599185160 Bacteria 6844013
530 2599363849 2599185161 Bacteria 6960462
531 2599370169 2599185162 Bacteria 6957254
532 2599372476 2599185163 Bacteria 6995158
533 2599378562 2599185164 Bacteria 6841688
534 2599384061 2599185165 Bacteria 6843250
535 2599391335 2599185166 Bacteria 6959206
536 2599397848 2599185167 Bacteria 6353609
537 2599407581 2599185168 Bacteria 6997636
538 2599452295 2599185179 Bacteria 6611171
539 2599460288 2599185181 Bacteria 6844519
540 2599470682 2599185182 Bacteria 6883168
541 2599484528 2599185185 Bacteria 6652270
542 2599489309 2599185186 Bacteria 6831633
543 2599506873 2599185189 Bacteria 5862825
544 2599513326 2599185190 Bacteria 6285678
545 2599518174 2599185191 Bacteria 6297582
546 2599802207 2599185257 Bacteria 6492581
547 2599877966 2599185288 Bacteria 6666191
548 2599892002 2599185290 Bacteria 6289611
549 2599952226 2599185303 Bacteria 6512725
550 2600212896 2599185356 Bacteria 6843884
551 2600366958 2600254931 Bacteria 6734225
552 2601690034 2600255296 Bacteria 5784754
553 2601773064 2600255313 Bacteria 6842543
554 2601797091 2600255318 Bacteria 6383414
555 2606076178 2603880185 Bacteria 6379190
556 2606131088 2603880199 Bacteria 6377649
557 2621298809 2619619299 Bacteria 6649820
558 2643871377 2643221571 Bacteria 6228673
559 2644622806 2643221713 Bacteria 6554480
560 2671094977 2667528171 Bacteria 6900659
561 2671770174 2671180172 Bacteria 6495783
562 2677900718 2675903420 Bacteria 6247433
563 2715755884 2713897149 Bacteria 6506249
564 2723249453 2721755607 Bacteria 5841722
565 2738672057 2738541265 Bacteria 6594665
566 2738750450 2738541282 Bacteria 6593925
567 2738810050 2738541294 Bacteria 6925949
568 2738859491 2738541303 Bacteria 6591772
569 2738897410 2738541309 Bacteria 6926455
570 2739258606 2738543015 Bacteria 6750701
571 2743736968 2740892503 Bacteria 6855563
572 2784265019 2784132063 Bacteria 6262788
573 2808976981 2808606385 Bacteria 6711065
574 2808992136 2808606388 Bacteria 6706662
575 2817492030 2816332298 Bacteria 6852809
576 2819705669 2818991464 Bacteria 6907494
577 2834032840 2834028612 Bacteria 6354979
578 2842828195 2842826826 Bacteria 5974129
579 2842841211 2842837860 Bacteria 6066181
580 2844670048 2844665904 Bacteria 6817974
581 2852613685 2852612431 Bacteria 6885235
582 2852659538 2852657418 Bacteria 6472974
583 2852668579 2852667396 Bacteria 6885555
584 2860342325 2860339153 Bacteria 6846989
585 2860871174 2860867994 Bacteria 5645326
586 2878033338 2878029506 Bacteria 6418441
587 2880232942 2880230671 Bacteria 6140320
588 2904550559 2904550169 Bacteria 6221258
589 2908450520 2908446538 Bacteria 6829095
590 2917073361 2917070673 Bacteria 6868303
591 2919066960 2919063839 Bacteria 6302690
592 2919459007 2919456309 Bacteria 6586567
593 2923155998 2923153595 Bacteria 6870622
594 2929193245 2929189879 Bacteria 5930554
595 2931394523 2931390751 Bacteria 6273349
596 2931402408 2931396565 Bacteria 7251677
597 2935357640 2935353572 Unclassified 6955622
598 2945934212 2945928738 Bacteria 6053221
599 2945964832 2945961074 Bacteria 7342064
600 2946008995 2946006987 Bacteria 6705746
601 2946031526 2946027586 Bacteria 6049274
602 2947238490 2947233263 Bacteria 6439278
603 2984290027 2984286254 Bacteria 6702062
604 3007401542 3007395558 Bacteria 6755444
605 3007514606 3007511990 Bacteria 6481491
606 3007621837 3007619802 Bacteria 6411688
607 637319881 637000220 Bacteria 7074893
608 8019775042 8019769354 Bacteria 6924660
609 8054288371 8054285046 Bacteria 6919322
610 8054348915 8054347763 Bacteria 5901107
611 8054507035 8054503363 Bacteria 6101651
612 8055773352 8055770955 Bacteria 6827675
613 8055821992 8055817908 Bacteria 6609162
614 8056135466 8056131705 Bacteria 6107031
615 8056154453 8056148874 Bacteria 6479865
616 8056165268 8056161164 Bacteria 6106669
617 8056173785 8056172158 Bacteria 6133900
618 8057799972 8057798959 Bacteria 6713499
619 JGI25162J39368_1000041
620 JGI25162J39368_1000014
621 JGI25163J39215_1000165
622 JGI25163J39215_1000405
623 JGI25164J39214_1000021
624 JGI25164J39214_1000059
625 JGI25165J46597_1000027
626 JGI25165J46597_1000081
627 Ga0055536_1000247
628 Ga0055530_10007832
629 Ga0065714_10009491
630 Ga0065714_10015504
631 Ga0065714_10068521
632 Ga0065714_10088919
633 Ga0065714_10089615
634 Ga0065714_10091359
635 Ga0065704_10143356
636 Ga0065712_10138491
637 Ga0070670_100000303
638 Ga0070670_100004984
639 Ga0070661_100000036
640 Ga0070669_100000891
641 Ga0070662_100001590
642 Ga0068853_100023697
643 Ga0070665_100272990
644 Ga0070664_100000275
645 Ga0068851_10000132
646 Ga0075364_10099480
647 Ga0075432_10004417
648 Ga0075432_10009815
649 Ga0075432_10029657
650 Ga0075432_10042407
651 Ga0075432_10046795
652 Ga0075432_10053649
653 Ga0075436_100110392
654 Ga0075436_100323668
655 Ga0105251_10000168
656 Ga0105251_10001353
657 Ga0105251_10005941
658 Ga0105251_10031946
659 Ga0105251_10062852
660 Ga0105251_10114361
661 Ga0105244_10000801
662 Ga0105244_10002677
663 Ga0105244_10002826
664 Ga0105244_10033024
665 Ga0105244_10046496
666 Ga0105250_10000122
667 Ga0105250_10000583
668 Ga0105250_10000591
669 Ga0105250_10033711
670 Ga0105243_10011007
671 Ga0105242_10003661
672 Ga0105237_10001372
673 Ga0105246_10007319
674 Ga0105246_10011012
675 Ga0157373_10000784
676 Ga0157373_10002739
677 Ga0157373_10034006
678 Ga0157373_10235217
679 Ga0157371_10000147
680 Ga0157371_10000771
681 Ga0157370_10031156
682 Ga0157370_10074440
683 Ga0157370_10156727
684 Ga0157369_10005184
685 Ga0157369_10008823
686 Ga0157369_10083900
687 Ga0157372_10009492
688 Ga0157375_10001567
689 Ga0157375_10025255
690 Ga0157375_10045094
691 Ga0182008_10000525
692 Ga0182008_10005142
693 Ga0182008_10008636
694 Ga0182008_10010543
695 Ga0182008_10042632
696 Ga0182006_1001855
697 Ga0182006_1006100
698 Ga0182006_1010465
699 Ga0182006_1028140
700 Ga0182007_10001820
701 Ga0182005_1001427
702 Ga0182005_1020183
703 Ga0163161_10022110
704 Ga0163161_10025470
705 Ga0163161_10043048
706 Ga0163161_10085150
707 Ga0163161_10111018
708 Ga0163161_10172005
709 Ga0163161_10182530
710 Ga0163161_10307702
711 Ga0163161_10363541
712 Ga0209760_100025
713 Ga0209760_100074
714 Ga0207427_100003
715 Ga0207427_100064
716 Ga0209437_100002
717 Ga0209437_100044
718 Ga0209233_1000004
719 Ga0209233_1000057
720 Ga0209676_1004916
721 Ga0209050_1000914
722 Ga0209051_1002770
723 Ga0207656_10000880
724 Ga0207696_1000051
725 Ga0207696_1000108
726 Ga0207696_1000264
727 Ga0207696_1007743
728 Ga0207655_1000173
729 Ga0207655_1001582
730 Ga0207655_1002917
731 Ga0207655_1010438
732 Ga0207655_1025183
733 Ga0207655_1029183
734 Ga0207713_1000020
735 Ga0207713_1002121
736 Ga0207713_1002307
737 Ga0207713_1005552
738 Ga0207713_1008034
739 Ga0207713_1026659
740 Ga0207671_10001354
741 Ga0207649_10000042
742 Ga0207681_10004855
743 Ga0207650_10000068
744 Ga0207650_10000240
745 Ga0207706_10063620
746 Ga0207709_10001157
747 Ga0207679_10000044
748 Ga0207428_10029342
749 Ga0207428_10052164
750 Ga0207428_10158460
751 Ga0307517_10108361
752 Ga0307511_10076457
753 Ga0307405_10008864
754 Ga0307412_10154313
755 Ga0439438_015042
756 Ga0439438_026174
757 Ga0439447_002212
758 Ga0439447_033104
759 Ga0439466_0003304
760 Ga0439432_001132
761 Ga0439432_006138
762 Ga0439451_006463
763 Ga0439452_011826
764 Ga0439452_015042
765 Ga0439463_003863
766 Ga0450899_005173
767 Ga0450907_000140
768 Ga0439446_0030566
769 Ga0450909_006821
770 Ga0439434_0000827
771 Ga0439440_0002114
772 Ga0495617_000954
773 Ga0495617_004226
774 Ga0495617_014223
775 Ga0495617_025484
776 Ga0495627_001501
777 Ga0495627_020048
778 Ga0495627_024162
779 Ga0495592_0168844
780 Ga0495603_0007516
781 Ga0495603_0008796
782 Ga0495590_0001143
783 Ga0495590_0004895
784 Ga0495590_0096868
785 Ga0495590_0163281
786 Ga0495591_000533
787 Ga0495591_002186
788 Ga0495591_014717
789 Ga0495591_016241
790 Ga0495591_022210
791 Ga0495591_032870
792 Ga0495591_051965
793 Ga0495638_0003846
794 Ga0495638_0004285
795 Ga0495638_0027625
796 Ga0495638_0043277
797 Ga0495638_0052268
798 Ga0495638_0055055
799 Ga0495638_0055465
800 Ga0495638_0073047
801 Ga0495638_0074917
802 Ga0495638_0110853
803 Ga0495638_0130942
804 Ga0495638_0203055
805 Ga0495650_0007460
806 Ga0495650_0083993
807 Ga0495582_0018485
808 Ga0495605_0009407
809 Ga0495605_0019997
810 Ga0495605_0020400
811 Ga0495605_0034099
812 Ga0495605_0155094
813 Ga0495639_0015257
814 Ga0495639_0133786
815 Ga0495584_0001259
816 Ga0495584_0004158
817 Ga0495584_0014777
818 Ga0495584_0017547
819 Ga0495585_0003983
820 Ga0495585_0013722
821 Ga0495585_0037282
822 Ga0495585_0048883
823 Ga0495585_0051143
824 Ga0495585_0115801
825 Ga0495585_0117362
826 Ga0495585_0150026
827 Ga0495594_0041673
828 Ga0495596_0001522
829 Ga0495607_0003760
830 Ga0495607_0013118
831 Ga0495607_0031841
832 Ga0495607_0058558
833 Ga0495607_0073352
834 Ga0495607_0256382
835 Ga0495607_0258664
836 Ga0495583_0000813
837 Ga0495583_0015809
838 Ga0495583_0025588
839 Ga0495583_0073021
840 Ga0495606_0003409
841 Ga0495606_0006605
842 Ga0495606_0008724
843 Ga0495606_0020906
844 Ga0495606_0022655
845 Ga0495606_0043175
846 Ga0495606_0043845
847 Ga0495606_0111292
848 Ga0495606_0270222
849 Ga0495610_0008962
850 Ga0495610_0012041
851 Ga0495610_0013686
852 Ga0495610_0025211
853 Ga0495610_0029318
854 Ga0495610_0036068
855 Ga0495610_0037329
856 Ga0495610_0097363
857 Ga0495610_0110967
858 Ga0495620_0000231
859 Ga0495620_0006599
860 Ga0495620_0013805
861 Ga0495620_0022744
862 Ga0495620_0031804
863 Ga0495628_0172040
864 Ga0495630_0033134
865 Ga0495630_0070229
866 Ga0495630_0072774
867 Ga0495630_0156856
868 Ga0495631_0000275
869 Ga0495631_0031742
870 Ga0495631_0041085
871 Ga0495632_0003919
872 Ga0495632_0012444
873 Ga0495632_0017422
874 Ga0495632_0079757
875 Ga0495632_0114551
876 Ga0495637_0000632
877 Ga0495637_0002657
878 Ga0495637_0022865
879 Ga0495637_0023114
880 Ga0495637_0027672
881 Ga0495637_0028929
882 Ga0495637_0037187
883 Ga0495637_0050263
884 Ga0495643_0029185
885 Ga0495643_0048524
886 Ga0495643_0058752
887 Ga0495643_0147967
888 Ga0495643_0148099
889 Ga0495644_0012174
890 Ga0495644_0048124
891 Ga0495648_0002745
892 Ga0495648_0003911
893 Ga0495648_0005770
894 Ga0495648_0007279
895 Ga0495648_0009796
896 Ga0495648_0034416
897 Ga0495648_0047947
898 Ga0495648_0084466
899 Ga0495648_0108198
900 Ga0495648_0215274
901 Ga0495648_0268404
902 Ga0495666_0009236
903 Ga0495666_0014961
904 Ga0495642_0000067
905 Ga0495652_0245677
906 Ga0495654_0004696
907 Ga0495654_0010440
908 Ga0495654_0013373
909 Ga0495654_0034109
910 Ga0495654_0034598
911 Ga0495654_0035530
912 Ga0495654_0037936
913 Ga0495654_0040096
914 Ga0495654_0079213
915 Ga0495586_0028017
916 Ga0495587_0008026
917 Ga0495587_0176561
918 Ga0495587_0180147
919 Ga0495609_0017820
920 Ga0495609_0136646
921 Ga0495597_0003816
922 Ga0495597_0017495
923 Ga0495597_0030340
924 Ga0495597_0037405
925 Ga0495645_0063609
926 Ga0495622_0044504
927 Ga0495622_0047006
928 Ga0495622_0053797
929 Ga0495622_0083158
930 Ga0495622_0158861
931 Ga0495633_0041268
932 Ga0495633_0057282
933 Ga0495633_0128699
934 Ga0495656_0002252
935 Ga0495656_0022598
936 Ga0495656_0028395
937 Ga0495668_0002597
938 Ga0495668_0002653
939 Ga0495634_0010691
940 Ga0495611_0038388
941 Ga0495611_0095153
942 Ga0495625_0003348
943 Ga0495625_0137588
944 Ga0495625_0152224
945 Ga0495625_0219617
946 Ga0495625_0245958
947 Ga0495635_0005376
948 Ga0495635_0041815
949 Ga0495661_0001162
950 Ga0495661_0008184
951 Ga0495661_0044893
952 Ga0495661_0053004
953 Ga0495661_0111911
954 Ga0495588_0035000
955 Ga0495588_0046616
956 Ga0495588_0108436
957 Ga0495657_0108402
958 Ga0495623_0006054
959 Ga0495623_0047708
960 Ga0495646_0023306
961 Ga0495646_0032220
962 Ga0495669_0005517
963 Ga0495613_0044332
964 Ga0495613_0128741
965 Ga0495624_0005052
966 Ga0495670_0013190
967 Ga0495670_0024849
968 Ga0495670_0063715
969 Ga0495670_0090521
970 Ga0495671_0007038
971 Ga0495671_0033129
972 Ga0495671_0035190
973 Ga0495671_0044316
974 Ga0495671_0045178
975 Ga0495671_0108684
976 Ga0495671_0118914
977 Ga0495649_0012080
978 Ga0495649_0029610
979 Ga0495649_0039383
980 Ga0495649_0051521
981 Ga0495649_0055771
982 Ga0495649_0058309
983 Ga0495649_0157093
984 Ga0495589_0005175
985 Ga0495589_0013723
986 Ga0495589_0035430
987 Ga0495589_0067080
988 Ga0495589_0069343
989 Ga0495600_0009462
990 Ga0495660_0010021
991 Ga0495660_0019081
992 Ga0495660_0019690
993 Ga0495660_0020349
994 Ga0495660_0037022
995 Ga0495660_0070047
996 Ga0495604_0005618
997 Ga0495604_0027642
998 Ga0495674_0069891
999 Ga0495672_0003277
1000 Ga0495672_0008375
1001 Ga0495672_0014680
1002 Ga0495672_0015185
1003 Ga0495672_0015612
1004 Ga0495672_0028605
1005 Ga0495672_0036382
1006 Ga0495672_0043667
1007 Ga0495672_0045458
1008 Ga0495672_0055683
1009 Ga0495672_0084203
1010 Ga0495672_0233332
1011 Ga0495676_0152262
1012 Ga0495680_0030591
1013 Ga0495680_0097972
1014 Ga0495680_0112036
1015 Ga0495680_0254844
1016 Ga0495683_0003385
1017 Ga0495683_0104191
1018 Ga0495687_002144
1019 Ga0495687_011658
1020 Ga0495675_0030773
1021 Ga0495675_0074705
1022 Ga0495677_0006622
1023 Ga0495679_001670
1024 Ga0495679_005475
1025 Ga0495679_012561
1026 Ga0495679_013140
1027 Ga0495679_015057
1028 Ga0495673_0000077
1029 Ga0495673_0002071
1030 Ga0495673_0008979
1031 Ga0495673_0013504
1032 Ga0495673_0041702
1033 Ga0495673_0041960
1034 Ga0495673_0059926
1035 Ga0495673_0101838
1036 Ga0495673_0145557
1037 Ga0495673_0171504
1038 Ga0495681_0001694
1039 Ga0495681_0027487
1040 Ga0495681_0031212
1041 Ga0495681_0032196
1042 Ga0495681_0040976
1043 Ga0495681_0042856
1044 Ga0495684_0081514
1045 Ga0495684_0137814
1046 Ga0495686_0023956
1047 Ga0495686_0062889
1048 Ga0495593_0007329
1049 Ga0495593_0019565
1050 Ga0495593_0028760
1051 Ga0495593_0175212
1052 Ga0495602_0009891
1053 Ga0495614_0129640
1054 Ga0495626_0000647
1055 Ga0495626_0000727
1056 Ga0495626_0002545
1057 Ga0495626_0003906
1058 Ga0495626_0009169
1059 Ga0495626_0053347
1060 Ga0496102_0000073
1061 Ga0496103_0027756
1062 Ga0496107_0411921
1063 Ga0496112_0277675
1064 Ga0496115_0091725
1065 Ga0496116_0000221
1066 Ga0496116_0023558
1067 Ga0496116_0031455
1068 Ga0496117_0002605
1069 Ga0496117_0009691
1070 Ga0496117_0016267
1071 Ga0496117_0046132
1072 Ga0496117_0049409
1073 Ga0496117_0062021
1074 Ga0496117_0140343
1075 Ga0496117_0242853
1076 Ga0496118_0024655
1077 Ga0496118_0024888
1078 Ga0496118_0025424
1079 Ga0496118_0028686
1080 Ga0496118_0030667
1081 Ga0496118_0070625
1082 Ga0496118_0074477
1083 Ga0496118_0102511
1084 Ga0496118_0260643
1085 Ga0496119_0011139
1086 Ga0496119_0018504
1087 Ga0496119_0046113
1088 Ga0496119_0094496
1089 Ga0496119_0095359
1090 Ga0496119_0220902
1091 Ga0496120_0006672
1092 Ga0496120_0015474
1093 Ga0496120_0037342
1094 Ga0496120_0084800
1095 Ga0496121_0000307
1096 Ga0496121_0107878
1097 Ga0496121_0120571
1098 Ga0496121_0130415
1099 Ga0496122_0005969
1100 Ga0496122_0010797
1101 Ga0496122_0029513
1102 Ga0496122_0049028
1103 Ga0496122_0079243
1104 Ga0496123_0004380
1105 Ga0496123_0007869
1106 Ga0496123_0022827
1107 Ga0496123_0053117
1108 Ga0496124_0012169
1109 Ga0496124_0024608
1110 Ga0496124_0062409
1111 Ga0496124_0208307
1112 Ga0496125_0000862
1113 Ga0496125_0002740
1114 Ga0496125_0034714
1115 Ga0496125_0056172
1116 Ga0496125_0073885
1117 Ga0496125_0133047
1118 Ga0496126_0026916
1119 Ga0496126_0039578
1120 Ga0496126_0077614
1121 Ga0496126_0125906
1122 Ga0496126_0258911
1123 Ga0495678_011179
1124 Ga0495678_029950
1125 Ga0495682_0000263
1126 Ga0495682_0015867
1127 Ga0495682_0042886
1128 Ga0495682_0054107
1129 nmdc:mga00v17_82249_c1
1130 Ga0500634_0003362
1131 2511263765
1132 2511289068
1133 2511296224
1134 2511300326
1135 2511314658
1136 2511322871
1137 2511331391
1138 2511336165
1139 2511342250
1140 2511348471
1141 2512327041
1142 2555669548
1143 2583793007
1144 2597857547
1145 2597864675
1146 2597870485
1147 2599353454
1148 2599363849
1149 2599370169
1150 2599372476
1151 2599378562
1152 2599384061
1153 2599391335
1154 2599397848
1155 2599407581
1156 2599452295
1157 2599460288
1158 2599470682
1159 2599484528
1160 2599489309
1161 2599506873
1162 2599513326
1163 2599518174
1164 2599802207
1165 2599877966
1166 2599892002
1167 2599952226
1168 2600212896
1169 2600366958
1170 2601690034
1171 2601773064
1172 2601797091
1173 2606076178
1174 2606131088
1175 2621298809
1176 2643871377
1177 2644622806
1178 2671094977
1179 2671770174
1180 2677900718
1181 2715755884
1182 2723249453
1183 2738672057
1184 2738750450
1185 2738810050
1186 2738859491
1187 2738897410
1188 2739258606
1189 2743736968
1190 2784265019
1191 2808976981
1192 2808992136
1193 2817492030
1194 2819705669
1195 2834032840
1196 2842828195
1197 2842841211
1198 2844670048
1199 2852613685
1200 2852659538
1201 2852668579
1202 2860342325
1203 2860871174
1204 2878033338
1205 2880232942
1206 2904550559
1207 2908450520
1208 2917073361
1209 2919066960
1210 2919459007
1211 2923155998
1212 2929193245
1213 2931394523
1214 2931402408
1215 2935357640
1216 2945934212
1217 2945964832
1218 2946008995
1219 2946031526
1220 2947238490
1221 2984290027
1222 3007401542
1223 3007514606
1224 3007621837
1225 637319881
1226 8019775042
1227 8054288371
1228 8054348915
1229 8054507035
1230 8055773352
1231 8055821992
1232 8056135466
1233 8056154453
1234 8056165268
1235 8056173785
1236 8057799972

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05425

CopD

Copper resistance protein D

185

282

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d5i-assembly1.cif.gz_A structure of mycobacterium smegmatis bd complex in the apo-form. 0.6488 6 289
7d5i-assembly1.cif.gz_A structure of mycobacterium smegmatis bd complex in the apo-form. 0.6339 6 289
7nkz-assembly1.cif.gz_A cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.6321 2 281
7nkz-assembly1.cif.gz_A cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.6112 2 281
7nkz-assembly1.cif.gz_B cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.6012 4 284
ID Description Score Start End Superfamily
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5928 4 283 1.20.1630.10
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.579 4 283 1.20.1630.10
af_Q4DB10_34_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5269 4 167 1.20.120.1770
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5087 4 280 1.20.1630.10
af_A0A1D6ML49_3_186_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.4925 3 160 1.20.1410.10
ID Description Score Start End GO Terms
AF-A0A3A6R1A0-F1-model_v4 Copper resistance protein D 0.9448 1 290 GO:0005886
GO:0006825
GO:0046688
AF-A0A3A6R1A0-F1-model_v4 Copper resistance protein D 0.9416 1 290 GO:0005886
GO:0006825
GO:0046688
AF-A0A1M3KNW9-F1-model_v4 Copper resistance protein D domain-containing protein 0.9272 1 286 GO:0005886
GO:0006825
AF-A0A3D9Z0M1-F1-model_v4 Putative copper resistance protein D 0.9225 5 287 GO:0005886
GO:0006825
AF-A0A6B3UEP6-F1-model_v4 Copper homeostasis membrane protein CopD 0.9218 2 289 GO:0005886
GO:0006825

Map