F469699
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 618 | 249 | 1236 | 139 |
Family's Representative Sequence
| Representative Sequence | 3300003322|rootL2_10081353|rootL2_100813534 |
| Length | 161 |
| Sequence | MKRFYLIGFALLMGFDTLAQLSFKHAGAGAFPPEASLAWLLRLLQQPWLYGALLGYIGAFFTWMSLLKHAPIGPAFAASHLEVVSVLALSAWLFGERLNALQVAGAVAIVAGIVCLARGEPDEDAQARAAAGDGTAAPSAVPSAAGHRAMAAGEADGGAAH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 15 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 59 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 77 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 81 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 96 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 142 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 149 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 152 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 155 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 156 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 157 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 158 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 159 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 160 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 161 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 162 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 163 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 164 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 165 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 166 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 167 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 168 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 169 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 170 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 171 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 172 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 173 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 174 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 175 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 176 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 213 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 214 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 215 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 216 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 217 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 218 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 219 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 220 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 221 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 222 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 223 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 224 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 225 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 226 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 235 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 236 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 237 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 238 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 239 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 240 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 241 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 242 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 243 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 244 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 245 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 246 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 247 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 248 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 249 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.38 |
| Metatranscriptomes | 0.49 |
| Isolates | 1.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.64 |
| Nodule | 0.32 |
| Rhizoplane | 3.56 |
| Rhizosphere | 63.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10081353 | 3300003322 | Bacteria | 3488 |
| 2 | 2214811339 | 2209111006 | Bacteria | 685 |
| 3 | JGI24739J22299_10007614 | 3300001989 | Bacteria | 4056 |
| 4 | JGI24739J22299_10049283 | 3300001989 | Bacteria | 1366 |
| 5 | JGI24737J22298_10006842 | 3300001990 | Bacteria | 3874 |
| 6 | JGI24737J22298_10013559 | 3300001990 | Bacteria | 2651 |
| 7 | JGI24735J21928_10004826 | 3300002067 | Bacteria | 4500 |
| 8 | JGI25156J39149_1024196 | 3300002705 | Bacteria | 997 |
| 9 | JGI25162J39368_1000138 | 3300002737 | Bacteria | 78713 |
| 10 | JGI25162J39368_1000605 | 3300002737 | Bacteria | 25839 |
| 11 | JGI25162J39368_1001369 | 3300002737 | Bacteria | 13418 |
| 12 | JGI25162J39368_1001619 | 3300002737 | Bacteria | 11287 |
| 13 | JGI25162J39368_1002664 | 3300002737 | Bacteria | 6547 |
| 14 | JGI25157J39369_1000182 | 3300002741 | Bacteria | 53311 |
| 15 | JGI25157J39369_1000253 | 3300002741 | Bacteria | 39977 |
| 16 | JGI25157J39369_1001032 | 3300002741 | Bacteria | 12792 |
| 17 | JGI25157J39369_1006786 | 3300002741 | Bacteria | 1708 |
| 18 | JGI25157J39369_1010147 | 3300002741 | Bacteria | 1246 |
| 19 | JGI25163J39215_1000444 | 3300002771 | Bacteria | 12688 |
| 20 | JGI25164J39214_1000170 | 3300002772 | Bacteria | 60952 |
| 21 | JGI25164J39214_1000390 | 3300002772 | Bacteria | 25835 |
| 22 | JGI25164J39214_1000439 | 3300002772 | Bacteria | 22628 |
| 23 | JGI25165J46597_1000224 | 3300003214 | Bacteria | 78713 |
| 24 | JGI25165J46597_1000725 | 3300003214 | Bacteria | 25839 |
| 25 | JGI25165J46597_1004499 | 3300003214 | Bacteria | 2965 |
| 26 | JGI25153J46596_10012356 | 3300003215 | Bacteria | 3693 |
| 27 | rootH2_10063399 | 3300003320 | Bacteria | 7364 |
| 28 | rootH2_10208949 | 3300003320 | Bacteria | 2519 |
| 29 | Ga0006562J51391_1016133 | 3300003578 | Bacteria | 6100 |
| 30 | Ga0006562J51391_1016134 | 3300003578 | Bacteria | 3610 |
| 31 | Ga0055538_1002329 | 3300003751 | Bacteria | 2863 |
| 32 | Ga0055533_1000506 | 3300003756 | Bacteria | 14133 |
| 33 | Ga0055533_1004350 | 3300003756 | Bacteria | 2569 |
| 34 | Ga0055525_1000164 | 3300003759 | Bacteria | 85555 |
| 35 | Ga0055527_1000065 | 3300003760 | Bacteria | 88416 |
| 36 | Ga0055527_1000272 | 3300003760 | Bacteria | 31210 |
| 37 | Ga0055527_1000317 | 3300003760 | Bacteria | 25995 |
| 38 | Ga0055535_1000216 | 3300003761 | Bacteria | 60912 |
| 39 | Ga0055535_1000690 | 3300003761 | Bacteria | 25995 |
| 40 | Ga0055535_1000716 | 3300003761 | Bacteria | 25197 |
| 41 | Ga0055535_1000949 | 3300003761 | Bacteria | 19236 |
| 42 | Ga0055542_1000097 | 3300003762 | Bacteria | 118227 |
| 43 | Ga0055542_1000136 | 3300003762 | Bacteria | 93218 |
| 44 | Ga0055542_1000140 | 3300003762 | Bacteria | 90195 |
| 45 | Ga0055542_1000179 | 3300003762 | Bacteria | 78713 |
| 46 | Ga0055542_1000932 | 3300003762 | Bacteria | 19284 |
| 47 | Ga0055529_1000189 | 3300003763 | Bacteria | 84123 |
| 48 | Ga0055529_1000335 | 3300003763 | Bacteria | 52579 |
| 49 | Ga0055529_1008619 | 3300003763 | Bacteria | 1353 |
| 50 | Ga0055537_1000021 | 3300003773 | Bacteria | 116840 |
| 51 | Ga0055524_1000037 | 3300003775 | Bacteria | 167140 |
| 52 | Ga0055524_1028565 | 3300003775 | Bacteria | 1668 |
| 53 | Ga0055534_1000006 | 3300003784 | Bacteria | 234368 |
| 54 | Ga0055528_1000006 | 3300003790 | Bacteria | 234368 |
| 55 | Ga0055531_10003887 | 3300003794 | Bacteria | 9348 |
| 56 | Ga0065165_1000566 | 3300005262 | Bacteria | 54948 |
| 57 | Ga0065165_1003025 | 3300005262 | Bacteria | 12677 |
| 58 | Ga0065716_1009210 | 3300005277 | Bacteria | 685 |
| 59 | Ga0070658_10114304 | 3300005327 | Bacteria | 2238 |
| 60 | Ga0070658_10199149 | 3300005327 | Bacteria | 1689 |
| 61 | Ga0070680_100328929 | 3300005336 | Bacteria | 1298 |
| 62 | Ga0070682_100027250 | 3300005337 | Bacteria | 3428 |
| 63 | Ga0070682_100275457 | 3300005337 | Bacteria | 1224 |
| 64 | Ga0070682_100312909 | 3300005337 | Bacteria | 1157 |
| 65 | Ga0070660_100021077 | 3300005339 | Bacteria | 4800 |
| 66 | Ga0070660_100131048 | 3300005339 | Bacteria | 2006 |
| 67 | Ga0070660_100191114 | 3300005339 | Bacteria | 1658 |
| 68 | Ga0070660_100317864 | 3300005339 | Bacteria | 1278 |
| 69 | Ga0070660_100509730 | 3300005339 | Bacteria | 1001 |
| 70 | Ga0070660_100647956 | 3300005339 | Bacteria | 884 |
| 71 | Ga0070660_100915801 | 3300005339 | Bacteria | 739 |
| 72 | Ga0070661_100029573 | 3300005344 | Bacteria | 3955 |
| 73 | Ga0070661_101646289 | 3300005344 | Bacteria | 543 |
| 74 | Ga0070659_100191664 | 3300005366 | Bacteria | 1680 |
| 75 | Ga0070659_100231405 | 3300005366 | Bacteria | 1527 |
| 76 | Ga0070659_100326043 | 3300005366 | Bacteria | 1284 |
| 77 | Ga0070659_100777757 | 3300005366 | Bacteria | 831 |
| 78 | Ga0070659_101945863 | 3300005366 | Bacteria | 527 |
| 79 | Ga0070714_100000030 | 3300005435 | Bacteria | 136610 |
| 80 | Ga0070714_100092470 | 3300005435 | Bacteria | 2651 |
| 81 | Ga0070713_100001474 | 3300005436 | Bacteria | 15027 |
| 82 | Ga0070711_100130051 | 3300005439 | Bacteria | 1874 |
| 83 | Ga0070694_100069688 | 3300005444 | Bacteria | 2420 |
| 84 | Ga0070663_100705725 | 3300005455 | Bacteria | 858 |
| 85 | Ga0070662_100055644 | 3300005457 | Bacteria | 2870 |
| 86 | Ga0070681_10040856 | 3300005458 | Bacteria | 4646 |
| 87 | Ga0070681_10269327 | 3300005458 | Bacteria | 1615 |
| 88 | Ga0070681_10627521 | 3300005458 | Bacteria | 989 |
| 89 | Ga0068867_101433101 | 3300005459 | Bacteria | 641 |
| 90 | Ga0070685_10000461 | 3300005466 | Bacteria | 23671 |
| 91 | Ga0070679_100039770 | 3300005530 | Bacteria | 4675 |
| 92 | Ga0070679_100149893 | 3300005530 | Bacteria | 2309 |
| 93 | Ga0070684_101167710 | 3300005535 | Bacteria | 724 |
| 94 | Ga0068853_100018029 | 3300005539 | Bacteria | 5836 |
| 95 | Ga0068853_100243644 | 3300005539 | Bacteria | 1648 |
| 96 | Ga0068853_101040921 | 3300005539 | Bacteria | 788 |
| 97 | Ga0070696_100015121 | 3300005546 | Bacteria | 5181 |
| 98 | Ga0070696_100106855 | 3300005546 | Bacteria | 2012 |
| 99 | Ga0070693_100659557 | 3300005547 | Bacteria | 762 |
| 100 | Ga0070665_100071137 | 3300005548 | Bacteria | 3485 |
| 101 | Ga0068855_100066875 | 3300005563 | Bacteria | 4189 |
| 102 | Ga0068855_100148459 | 3300005563 | Bacteria | 2667 |
| 103 | Ga0068855_101869141 | 3300005563 | Bacteria | 609 |
| 104 | Ga0068857_100012027 | 3300005577 | Bacteria | 7526 |
| 105 | Ga0068857_100033648 | 3300005577 | Bacteria | 4534 |
| 106 | Ga0068857_100279182 | 3300005577 | Bacteria | 1536 |
| 107 | Ga0068854_100001248 | 3300005578 | Bacteria | 15268 |
| 108 | Ga0068854_100062286 | 3300005578 | Bacteria | 2704 |
| 109 | Ga0068854_100161396 | 3300005578 | Bacteria | 1736 |
| 110 | Ga0068854_100242675 | 3300005578 | Bacteria | 1435 |
| 111 | Ga0068856_100001493 | 3300005614 | Bacteria | 24470 |
| 112 | Ga0068856_100260833 | 3300005614 | Bacteria | 1748 |
| 113 | Ga0068856_100545950 | 3300005614 | Bacteria | 1180 |
| 114 | Ga0068852_100067297 | 3300005616 | Bacteria | 3131 |
| 115 | Ga0068852_100165028 | 3300005616 | Bacteria | 2072 |
| 116 | Ga0068851_10024532 | 3300005834 | Bacteria | 2953 |
| 117 | Ga0068851_10692160 | 3300005834 | Bacteria | 627 |
| 118 | Ga0068858_100108278 | 3300005842 | Bacteria | 2594 |
| 119 | Ga0068858_102202718 | 3300005842 | Unclassified | 545 |
| 120 | Ga0068862_100400578 | 3300005844 | Bacteria | 1284 |
| 121 | Ga0099823_1000028 | 3300006944 | Bacteria | 69723 |
| 122 | Ga0105244_10028766 | 3300009036 | Bacteria | 2978 |
| 123 | Ga0105250_10056527 | 3300009092 | Bacteria | 1575 |
| 124 | Ga0105240_10000609 | 3300009093 | Bacteria | 66384 |
| 125 | Ga0105240_10002324 | 3300009093 | Bacteria | 30759 |
| 126 | Ga0105240_10005495 | 3300009093 | Bacteria | 18891 |
| 127 | Ga0105240_10023541 | 3300009093 | Bacteria | 8141 |
| 128 | Ga0105240_10027518 | 3300009093 | Bacteria | 7442 |
| 129 | Ga0105240_10034726 | 3300009093 | Bacteria | 6502 |
| 130 | Ga0105240_10429652 | 3300009093 | Bacteria | 1482 |
| 131 | Ga0105247_10001759 | 3300009101 | Bacteria | 15236 |
| 132 | Ga0105241_10177031 | 3300009174 | Bacteria | 1766 |
| 133 | Ga0105241_10526954 | 3300009174 | Bacteria | 1057 |
| 134 | Ga0105241_12634373 | 3300009174 | Bacteria | 505 |
| 135 | Ga0105237_10000150 | 3300009545 | Bacteria | 97072 |
| 136 | Ga0105237_10017018 | 3300009545 | Bacteria | 7546 |
| 137 | Ga0105237_10041409 | 3300009545 | Bacteria | 4645 |
| 138 | Ga0105237_10252220 | 3300009545 | Bacteria | 1767 |
| 139 | Ga0105238_10017721 | 3300009551 | Bacteria | 7241 |
| 140 | Ga0105238_10053232 | 3300009551 | Bacteria | 4067 |
| 141 | Ga0105238_10145302 | 3300009551 | Bacteria | 2348 |
| 142 | Ga0105238_10159548 | 3300009551 | Bacteria | 2231 |
| 143 | Ga0105238_10505221 | 3300009551 | Bacteria | 1210 |
| 144 | Ga0105249_10033072 | 3300009553 | Bacteria | 4682 |
| 145 | Ga0105239_10000043 | 3300010375 | Bacteria | 196600 |
| 146 | Ga0105239_10627913 | 3300010375 | Bacteria | 1226 |
| 147 | Ga0105239_11786623 | 3300010375 | Bacteria | 712 |
| 148 | Ga0157314_1000939 | 3300012500 | Bacteria | 2337 |
| 149 | Ga0157373_10035698 | 3300013100 | Bacteria | 3568 |
| 150 | Ga0157373_10113517 | 3300013100 | Bacteria | 1904 |
| 151 | Ga0157373_10130462 | 3300013100 | Bacteria | 1768 |
| 152 | Ga0157373_10260475 | 3300013100 | Bacteria | 1227 |
| 153 | Ga0157373_10292167 | 3300013100 | Bacteria | 1156 |
| 154 | Ga0157373_10435508 | 3300013100 | Bacteria | 942 |
| 155 | Ga0157373_10541377 | 3300013100 | Bacteria | 844 |
| 156 | Ga0157371_10007045 | 3300013102 | Bacteria | 9147 |
| 157 | Ga0157371_10025302 | 3300013102 | Bacteria | 4327 |
| 158 | Ga0157371_10054194 | 3300013102 | Bacteria | 2848 |
| 159 | Ga0157371_10065001 | 3300013102 | Bacteria | 2584 |
| 160 | Ga0157370_10000662 | 3300013104 | Bacteria | 42848 |
| 161 | Ga0157370_10001955 | 3300013104 | Bacteria | 25396 |
| 162 | Ga0157370_10005446 | 3300013104 | Bacteria | 14278 |
| 163 | Ga0157370_10019836 | 3300013104 | Bacteria | 6728 |
| 164 | Ga0157370_10055639 | 3300013104 | Bacteria | 3768 |
| 165 | Ga0157370_10223059 | 3300013104 | Bacteria | 1746 |
| 166 | Ga0157370_10251118 | 3300013104 | Bacteria | 1636 |
| 167 | Ga0157370_10287348 | 3300013104 | Bacteria | 1519 |
| 168 | Ga0157370_10596023 | 3300013104 | Bacteria | 1012 |
| 169 | Ga0157370_11923945 | 3300013104 | Bacteria | 530 |
| 170 | Ga0157369_10000580 | 3300013105 | Bacteria | 47824 |
| 171 | Ga0157369_10027481 | 3300013105 | Bacteria | 6306 |
| 172 | Ga0157369_10042069 | 3300013105 | Bacteria | 4985 |
| 173 | Ga0157369_10066969 | 3300013105 | Bacteria | 3863 |
| 174 | Ga0157369_10540879 | 3300013105 | Bacteria | 1204 |
| 175 | Ga0163162_10127993 | 3300013306 | Bacteria | 2647 |
| 176 | Ga0157372_10009430 | 3300013307 | Bacteria | 10386 |
| 177 | Ga0157372_10031116 | 3300013307 | Bacteria | 5843 |
| 178 | Ga0157372_10058048 | 3300013307 | Bacteria | 4325 |
| 179 | Ga0157372_10458414 | 3300013307 | Bacteria | 1486 |
| 180 | Ga0163163_12918942 | 3300014325 | Bacteria | 533 |
| 181 | Ga0182008_10000262 | 3300014497 | Bacteria | 41194 |
| 182 | Ga0182008_10008655 | 3300014497 | Bacteria | 5539 |
| 183 | Ga0182008_10085561 | 3300014497 | Bacteria | 1553 |
| 184 | Ga0182008_10114951 | 3300014497 | Bacteria | 1335 |
| 185 | Ga0182008_10684538 | 3300014497 | Bacteria | 584 |
| 186 | Ga0182008_10995007 | 3300014497 | Bacteria | 500 |
| 187 | Ga0182006_1000031 | 3300015261 | Bacteria | 240055 |
| 188 | Ga0182006_1005217 | 3300015261 | Bacteria | 6226 |
| 189 | Ga0182006_1075906 | 3300015261 | Bacteria | 1236 |
| 190 | Ga0182006_1192280 | 3300015261 | Bacteria | 678 |
| 191 | Ga0182007_10002777 | 3300015262 | Bacteria | 8548 |
| 192 | Ga0182007_10026485 | 3300015262 | Bacteria | 2009 |
| 193 | Ga0182007_10031851 | 3300015262 | Bacteria | 1794 |
| 194 | Ga0182007_10037606 | 3300015262 | Bacteria | 1625 |
| 195 | Ga0182007_10379145 | 3300015262 | Bacteria | 536 |
| 196 | Ga0182005_1000352 | 3300015265 | Bacteria | 26091 |
| 197 | Ga0182005_1000424 | 3300015265 | Bacteria | 22547 |
| 198 | Ga0182005_1002188 | 3300015265 | Bacteria | 7184 |
| 199 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 200 | Ga0183360_10002 | 3300015689 | Bacteria | 953821 |
| 201 | Ga0163161_10026249 | 3300017792 | Bacteria | 4127 |
| 202 | Ga0206353_11697107 | 3300020082 | Bacteria | 856 |
| 203 | Ga0209435_108199 | 3300025206 | Bacteria | 1152 |
| 204 | Ga0209760_101163 | 3300025207 | Bacteria | 2964 |
| 205 | Ga0209784_100068 | 3300025224 | Bacteria | 152526 |
| 206 | Ga0209566_103158 | 3300025225 | Bacteria | 2644 |
| 207 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 208 | Ga0209674_100247 | 3300025226 | Bacteria | 45826 |
| 209 | Ga0209674_101344 | 3300025226 | Bacteria | 6729 |
| 210 | Ga0209674_101766 | 3300025226 | Bacteria | 5250 |
| 211 | Ga0209674_112671 | 3300025226 | Bacteria | 813 |
| 212 | Ga0209672_100029 | 3300025228 | Bacteria | 339298 |
| 213 | Ga0209672_100049 | 3300025228 | Bacteria | 238787 |
| 214 | Ga0209672_100828 | 3300025228 | Bacteria | 14455 |
| 215 | Ga0209672_101400 | 3300025228 | Bacteria | 8851 |
| 216 | Ga0209563_100051 | 3300025230 | Bacteria | 340545 |
| 217 | Ga0207427_100118 | 3300025231 | Bacteria | 102109 |
| 218 | Ga0207427_100120 | 3300025231 | Bacteria | 101516 |
| 219 | Ga0207427_100140 | 3300025231 | Bacteria | 84637 |
| 220 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 221 | Ga0209437_100147 | 3300025233 | Bacteria | 161997 |
| 222 | Ga0209437_100193 | 3300025233 | Bacteria | 122027 |
| 223 | Ga0209437_100231 | 3300025233 | Bacteria | 94387 |
| 224 | Ga0209437_106636 | 3300025233 | Bacteria | 1918 |
| 225 | Ga0209437_113991 | 3300025233 | Bacteria | 1132 |
| 226 | Ga0209258_100053 | 3300025242 | Bacteria | 339233 |
| 227 | Ga0209258_100087 | 3300025242 | Bacteria | 238787 |
| 228 | Ga0209258_100149 | 3300025242 | Bacteria | 162184 |
| 229 | Ga0209258_100360 | 3300025242 | Bacteria | 61533 |
| 230 | Ga0209258_101666 | 3300025242 | Bacteria | 7106 |
| 231 | Ga0209258_111253 | 3300025242 | Bacteria | 1133 |
| 232 | Ga0209646_1001031 | 3300025246 | Bacteria | 8416 |
| 233 | Ga0209646_1001535 | 3300025246 | Bacteria | 6093 |
| 234 | Ga0209026_1000037 | 3300025250 | Bacteria | 282562 |
| 235 | Ga0209026_1000060 | 3300025250 | Bacteria | 220052 |
| 236 | Ga0209026_1000099 | 3300025250 | Bacteria | 161750 |
| 237 | Ga0209026_1000122 | 3300025250 | Bacteria | 126140 |
| 238 | Ga0209026_1010796 | 3300025250 | Bacteria | 1683 |
| 239 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 240 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 241 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 242 | Ga0209148_1000096 | 3300025254 | Bacteria | 238787 |
| 243 | Ga0209148_1000143 | 3300025254 | Bacteria | 162184 |
| 244 | Ga0209148_1001326 | 3300025254 | Bacteria | 13150 |
| 245 | Ga0209759_1000295 | 3300025256 | Bacteria | 69093 |
| 246 | Ga0209759_1000755 | 3300025256 | Bacteria | 27927 |
| 247 | Ga0209759_1005891 | 3300025256 | Bacteria | 4195 |
| 248 | Ga0209759_1011516 | 3300025256 | Bacteria | 2508 |
| 249 | Ga0209759_1018361 | 3300025256 | Bacteria | 1690 |
| 250 | Ga0209759_1039457 | 3300025256 | Bacteria | 829 |
| 251 | Ga0209129_1001547 | 3300025258 | Bacteria | 12668 |
| 252 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 253 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 254 | Ga0209233_1000147 | 3300025261 | Bacteria | 186517 |
| 255 | Ga0209233_1016709 | 3300025261 | Bacteria | 2016 |
| 256 | Ga0209233_1019288 | 3300025261 | Bacteria | 1816 |
| 257 | Ga0209565_1000002 | 3300025263 | Bacteria | 1423083 |
| 258 | Ga0209565_1013220 | 3300025263 | Bacteria | 1939 |
| 259 | Ga0209455_1000060 | 3300025272 | Bacteria | 339298 |
| 260 | Ga0209455_1000086 | 3300025272 | Bacteria | 244650 |
| 261 | Ga0209455_1000088 | 3300025272 | Bacteria | 238787 |
| 262 | Ga0209455_1000323 | 3300025272 | Bacteria | 47398 |
| 263 | Ga0209455_1003818 | 3300025272 | Bacteria | 5164 |
| 264 | Ga0209673_1000002 | 3300025273 | Bacteria | 1423083 |
| 265 | Ga0209673_1005616 | 3300025273 | Bacteria | 6264 |
| 266 | Ga0209675_1000002 | 3300025291 | Bacteria | 1423083 |
| 267 | Ga0209564_1000004 | 3300025295 | Bacteria | 1424639 |
| 268 | Ga0209758_1003144 | 3300025297 | Bacteria | 15527 |
| 269 | Ga0209758_1024338 | 3300025297 | Bacteria | 2702 |
| 270 | Ga0209758_1104395 | 3300025297 | Bacteria | 798 |
| 271 | Ga0209758_1137551 | 3300025297 | Bacteria | 637 |
| 272 | Ga0209050_1007094 | 3300025298 | Bacteria | 6406 |
| 273 | Ga0209256_1000004 | 3300025299 | Bacteria | 1424643 |
| 274 | Ga0209256_1001298 | 3300025299 | Bacteria | 26918 |
| 275 | Ga0209051_1036057 | 3300025303 | Bacteria | 1832 |
| 276 | Ga0209051_1056415 | 3300025303 | Bacteria | 1267 |
| 277 | Ga0209257_1004442 | 3300025304 | Bacteria | 10862 |
| 278 | Ga0207656_10006823 | 3300025321 | Bacteria | 4129 |
| 279 | Ga0207655_1005575 | 3300025728 | Bacteria | 8528 |
| 280 | Ga0207692_10105317 | 3300025898 | Bacteria | 1556 |
| 281 | Ga0207710_10030777 | 3300025900 | Bacteria | 2343 |
| 282 | Ga0207647_10000008 | 3300025904 | Bacteria | 192602 |
| 283 | Ga0207647_10010279 | 3300025904 | Bacteria | 6611 |
| 284 | Ga0207647_10017679 | 3300025904 | Bacteria | 4843 |
| 285 | Ga0207647_10025555 | 3300025904 | Bacteria | 3877 |
| 286 | Ga0207705_10065518 | 3300025909 | Bacteria | 2626 |
| 287 | Ga0207705_10445480 | 3300025909 | Bacteria | 1004 |
| 288 | Ga0207707_10031108 | 3300025912 | Bacteria | 4670 |
| 289 | Ga0207707_10049060 | 3300025912 | Bacteria | 3678 |
| 290 | Ga0207707_10065252 | 3300025912 | Bacteria | 3171 |
| 291 | Ga0207707_10445638 | 3300025912 | Bacteria | 1108 |
| 292 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 293 | Ga0207695_10002140 | 3300025913 | Bacteria | 29914 |
| 294 | Ga0207695_10004510 | 3300025913 | Bacteria | 18950 |
| 295 | Ga0207695_10004697 | 3300025913 | Bacteria | 18500 |
| 296 | Ga0207695_10005651 | 3300025913 | Bacteria | 16501 |
| 297 | Ga0207695_10016227 | 3300025913 | Bacteria | 8729 |
| 298 | Ga0207695_10017458 | 3300025913 | Bacteria | 8351 |
| 299 | Ga0207695_10445277 | 3300025913 | Bacteria | 1178 |
| 300 | Ga0207671_10000021 | 3300025914 | Bacteria | 300409 |
| 301 | Ga0207671_10000570 | 3300025914 | Bacteria | 49510 |
| 302 | Ga0207671_10014511 | 3300025914 | Bacteria | 6222 |
| 303 | Ga0207671_10209588 | 3300025914 | Bacteria | 1524 |
| 304 | Ga0207671_10638963 | 3300025914 | Bacteria | 848 |
| 305 | Ga0207663_10158070 | 3300025916 | Bacteria | 1597 |
| 306 | Ga0207660_10382622 | 3300025917 | Bacteria | 1131 |
| 307 | Ga0207657_10122040 | 3300025919 | Bacteria | 2143 |
| 308 | Ga0207657_10505889 | 3300025919 | Bacteria | 946 |
| 309 | Ga0207657_10831361 | 3300025919 | Bacteria | 713 |
| 310 | Ga0207657_10854408 | 3300025919 | Bacteria | 702 |
| 311 | Ga0207657_11016520 | 3300025919 | Bacteria | 636 |
| 312 | Ga0207649_10024302 | 3300025920 | Bacteria | 3521 |
| 313 | Ga0207649_10127093 | 3300025920 | Bacteria | 1727 |
| 314 | Ga0207649_10314006 | 3300025920 | Bacteria | 1149 |
| 315 | Ga0207652_10437223 | 3300025921 | Bacteria | 1179 |
| 316 | Ga0207652_10510715 | 3300025921 | Bacteria | 1081 |
| 317 | Ga0207694_10022646 | 3300025924 | Bacteria | 4766 |
| 318 | Ga0207694_10044760 | 3300025924 | Bacteria | 3417 |
| 319 | Ga0207694_10100021 | 3300025924 | Bacteria | 2297 |
| 320 | Ga0207700_10102431 | 3300025928 | Bacteria | 2286 |
| 321 | Ga0207664_10000026 | 3300025929 | Bacteria | 194571 |
| 322 | Ga0207664_10001232 | 3300025929 | Bacteria | 16942 |
| 323 | Ga0207664_10014498 | 3300025929 | Bacteria | 5694 |
| 324 | Ga0207690_10003519 | 3300025932 | Bacteria | 9330 |
| 325 | Ga0207690_10026092 | 3300025932 | Bacteria | 3677 |
| 326 | Ga0207690_10026659 | 3300025932 | Bacteria | 3641 |
| 327 | Ga0207690_10030691 | 3300025932 | Bacteria | 3431 |
| 328 | Ga0207690_10190131 | 3300025932 | Bacteria | 1552 |
| 329 | Ga0207706_10016229 | 3300025933 | Bacteria | 6730 |
| 330 | Ga0207706_11299653 | 3300025933 | Bacteria | 601 |
| 331 | Ga0207670_10003742 | 3300025936 | Bacteria | 8081 |
| 332 | Ga0207667_10000141 | 3300025949 | Bacteria | 109666 |
| 333 | Ga0207667_10004475 | 3300025949 | Bacteria | 17112 |
| 334 | Ga0207667_10030752 | 3300025949 | Bacteria | 5802 |
| 335 | Ga0207667_10036239 | 3300025949 | Bacteria | 5288 |
| 336 | Ga0207667_10815264 | 3300025949 | Bacteria | 929 |
| 337 | Ga0207668_10058790 | 3300025972 | Bacteria | 2689 |
| 338 | Ga0207640_10000268 | 3300025981 | Bacteria | 35119 |
| 339 | Ga0207640_10005600 | 3300025981 | Bacteria | 6847 |
| 340 | Ga0207640_10076565 | 3300025981 | Bacteria | 2271 |
| 341 | Ga0207640_10299994 | 3300025981 | Bacteria | 1270 |
| 342 | Ga0207640_10726831 | 3300025981 | Bacteria | 854 |
| 343 | Ga0207703_10042601 | 3300026035 | Bacteria | 3642 |
| 344 | Ga0207703_11895906 | 3300026035 | Unclassified | 572 |
| 345 | Ga0207639_10012868 | 3300026041 | Bacteria | 5838 |
| 346 | Ga0207639_10411095 | 3300026041 | Bacteria | 1221 |
| 347 | Ga0207639_10495673 | 3300026041 | Bacteria | 1115 |
| 348 | Ga0207678_10021249 | 3300026067 | Bacteria | 5690 |
| 349 | Ga0207678_10199974 | 3300026067 | Bacteria | 1708 |
| 350 | Ga0207678_10335394 | 3300026067 | Bacteria | 1302 |
| 351 | Ga0207678_10420241 | 3300026067 | Bacteria | 1159 |
| 352 | Ga0207702_10000143 | 3300026078 | Bacteria | 84903 |
| 353 | Ga0207702_10005861 | 3300026078 | Bacteria | 10687 |
| 354 | Ga0207702_10104281 | 3300026078 | Bacteria | 2509 |
| 355 | Ga0207702_10248718 | 3300026078 | Bacteria | 1669 |
| 356 | Ga0207648_11637421 | 3300026089 | Bacteria | 605 |
| 357 | Ga0207674_10018823 | 3300026116 | Bacteria | 7492 |
| 358 | Ga0207674_10028427 | 3300026116 | Bacteria | 5902 |
| 359 | Ga0207674_10053534 | 3300026116 | Bacteria | 4113 |
| 360 | Ga0207683_10537747 | 3300026121 | Bacteria | 1080 |
| 361 | Ga0207698_10050414 | 3300026142 | Bacteria | 3175 |
| 362 | Ga0207698_10146895 | 3300026142 | Bacteria | 2040 |
| 363 | Ga0209389_1002696 | 3300027296 | Bacteria | 13795 |
| 364 | Ga0209371_1028278 | 3300027312 | Bacteria | 1253 |
| 365 | Ga0268266_10067831 | 3300028379 | Bacteria | 3088 |
| 366 | Ga0268265_10047181 | 3300028380 | Bacteria | 3226 |
| 367 | Ga0268256_1031109 | 3300030500 | Bacteria | 1285 |
| 368 | Ga0316575_10120433 | 3300031665 | Bacteria | 1073 |
| 369 | Ga0307412_10001089 | 3300031911 | Bacteria | 15538 |
| 370 | Ga0307412_10009657 | 3300031911 | Bacteria | 5539 |
| 371 | Ga0307414_10006721 | 3300032004 | Bacteria | 6434 |
| 372 | Ga0307414_11436015 | 3300032004 | Bacteria | 641 |
| 373 | Ga0395899_0049847 | 3300037312 | Bacteria | 3111 |
| 374 | Ga0395899_0078980 | 3300037312 | Bacteria | 2397 |
| 375 | Ga0395899_0289097 | 3300037312 | Bacteria | 1112 |
| 376 | Ga0395900_0000012 | 3300037418 | Bacteria | 401198 |
| 377 | Ga0395900_0043991 | 3300037418 | Bacteria | 4602 |
| 378 | Ga0395900_0094855 | 3300037418 | Bacteria | 3065 |
| 379 | Ga0395898_0000144 | 3300037466 | Bacteria | 187889 |
| 380 | Ga0395898_0000278 | 3300037466 | Bacteria | 124490 |
| 381 | Ga0395898_0047872 | 3300037466 | Bacteria | 4193 |
| 382 | Ga0395898_0195278 | 3300037466 | Bacteria | 1933 |
| 383 | Ga0395898_0215239 | 3300037466 | Bacteria | 1832 |
| 384 | Ga0395898_0250134 | 3300037466 | Bacteria | 1690 |
| 385 | Ga0395905_0065805 | 3300037471 | Bacteria | 3394 |
| 386 | Ga0395901_0002971 | 3300038443 | Bacteria | 17103 |
| 387 | Ga0395901_0003001 | 3300038443 | Bacteria | 17020 |
| 388 | Ga0395901_0043917 | 3300038443 | Bacteria | 4635 |
| 389 | Ga0395901_0064734 | 3300038443 | Bacteria | 3806 |
| 390 | Ga0395901_0085942 | 3300038443 | Bacteria | 3288 |
| 391 | Ga0395901_0163441 | 3300038443 | Bacteria | 2338 |
| 392 | Ga0395901_0297520 | 3300038443 | Bacteria | 1673 |
| 393 | Ga0395901_0308117 | 3300038443 | Bacteria | 1640 |
| 394 | Ga0395901_0517473 | 3300038443 | Bacteria | 1213 |
| 395 | Ga0436361_0457520 | 3300039447 | Bacteria | 1109 |
| 396 | Ga0439436_0000022 | 3300041404 | Bacteria | 60408 |
| 397 | Ga0451793_0109338 | 3300041452 | Bacteria | 4138 |
| 398 | Ga0439445_0045814 | 3300042004 | Bacteria | 1171 |
| 399 | Ga0439448_0043018 | 3300042005 | Bacteria | 1466 |
| 400 | Ga0439448_0139858 | 3300042005 | Bacteria | 837 |
| 401 | Ga0450911_003004 | 3300042115 | Bacteria | 3102 |
| 402 | Ga0451577_0013048 | 3300042876 | Bacteria | 7795 |
| 403 | Ga0466969_0011768 | 3300044656 | Bacteria | 4627 |
| 404 | Ga0466969_0096507 | 3300044656 | Bacteria | 1395 |
| 405 | Ga0466969_0160241 | 3300044656 | Bacteria | 1034 |
| 406 | Ga0466969_0173790 | 3300044656 | Bacteria | 987 |
| 407 | Ga0466972_0016889 | 3300044658 | Bacteria | 3650 |
| 408 | Ga0466975_0097397 | 3300044661 | Bacteria | 2094 |
| 409 | Ga0466982_0000005 | 3300044672 | Bacteria | 364340 |
| 410 | Ga0466966_0001494 | 3300044684 | Bacteria | 14996 |
| 411 | Ga0466961_0000566 | 3300044693 | Bacteria | 23533 |
| 412 | Ga0466961_0016490 | 3300044693 | Bacteria | 4746 |
| 413 | Ga0466961_0048925 | 3300044693 | Bacteria | 2702 |
| 414 | Ga0466961_0097893 | 3300044693 | Bacteria | 1849 |
| 415 | Ga0466961_0116544 | 3300044693 | Bacteria | 1678 |
| 416 | Ga0466961_0135840 | 3300044693 | Bacteria | 1541 |
| 417 | Ga0466964_0031182 | 3300044706 | Bacteria | 2112 |
| 418 | Ga0466971_0005312 | 3300044719 | Bacteria | 5586 |
| 419 | Ga0466971_0010066 | 3300044719 | Bacteria | 4130 |
| 420 | Ga0466971_0210131 | 3300044719 | Bacteria | 920 |
| 421 | Ga0466968_0001781 | 3300044735 | Bacteria | 7770 |
| 422 | Ga0466970_0005776 | 3300044765 | Bacteria | 6151 |
| 423 | Ga0466970_0077536 | 3300044765 | Bacteria | 1791 |
| 424 | Ga0466970_0345714 | 3300044765 | Bacteria | 843 |
| 425 | Ga0466957_0057654 | 3300044842 | Bacteria | 2377 |
| 426 | Ga0466957_0114747 | 3300044842 | Bacteria | 1712 |
| 427 | Ga0466957_0168536 | 3300044842 | Bacteria | 1425 |
| 428 | Ga0466957_0892428 | 3300044842 | Bacteria | 635 |
| 429 | Ga0466960_0011759 | 3300044901 | Bacteria | 3674 |
| 430 | Ga0466959_0000204 | 3300045049 | Bacteria | 38407 |
| 431 | Ga0466959_0008851 | 3300045049 | Bacteria | 7136 |
| 432 | Ga0466959_0015619 | 3300045049 | Bacteria | 5535 |
| 433 | Ga0466959_0023999 | 3300045049 | Bacteria | 4515 |
| 434 | Ga0466959_0093158 | 3300045049 | Bacteria | 2162 |
| 435 | Ga0466958_0008283 | 3300045836 | Bacteria | 5755 |
| 436 | Ga0466958_0015594 | 3300045836 | Bacteria | 4358 |
| 437 | Ga0466958_0026658 | 3300045836 | Bacteria | 3416 |
| 438 | Ga0466967_1939174 | 3300045976 | Bacteria | 586 |
| 439 | Ga0495617_000120 | 3300046452 | Bacteria | 52244 |
| 440 | Ga0495617_000348 | 3300046452 | Bacteria | 25506 |
| 441 | Ga0495638_0000007 | 3300046460 | Bacteria | 602783 |
| 442 | Ga0495638_0000194 | 3300046460 | Bacteria | 88601 |
| 443 | Ga0495638_0000213 | 3300046460 | Bacteria | 81547 |
| 444 | Ga0495638_0000498 | 3300046460 | Bacteria | 46678 |
| 445 | Ga0495638_0018390 | 3300046460 | Bacteria | 4641 |
| 446 | Ga0495650_0000202 | 3300046471 | Bacteria | 129910 |
| 447 | Ga0495650_0000703 | 3300046471 | Bacteria | 42860 |
| 448 | Ga0495605_0051913 | 3300046474 | Bacteria | 1995 |
| 449 | Ga0495584_0000688 | 3300046491 | Bacteria | 22464 |
| 450 | Ga0495585_0000200 | 3300046492 | Bacteria | 62445 |
| 451 | Ga0495585_0004150 | 3300046492 | Bacteria | 9473 |
| 452 | Ga0495585_0296953 | 3300046492 | Bacteria | 795 |
| 453 | Ga0495607_0000090 | 3300046501 | Bacteria | 94252 |
| 454 | Ga0495607_0000244 | 3300046501 | Bacteria | 58158 |
| 455 | Ga0495607_0009076 | 3300046501 | Bacteria | 6758 |
| 456 | Ga0495607_0259168 | 3300046501 | Bacteria | 833 |
| 457 | Ga0495583_0058138 | 3300046506 | Bacteria | 1736 |
| 458 | Ga0495606_0000218 | 3300046507 | Bacteria | 101645 |
| 459 | Ga0495606_0001182 | 3300046507 | Bacteria | 36798 |
| 460 | Ga0495606_0001609 | 3300046507 | Bacteria | 29457 |
| 461 | Ga0495606_0045304 | 3300046507 | Bacteria | 2916 |
| 462 | Ga0495606_0197150 | 3300046507 | Bacteria | 1150 |
| 463 | Ga0495610_0001156 | 3300046512 | Bacteria | 24006 |
| 464 | Ga0495610_0061610 | 3300046512 | Bacteria | 1781 |
| 465 | Ga0495616_0000006 | 3300046513 | Bacteria | 234766 |
| 466 | Ga0495616_0006144 | 3300046513 | Bacteria | 7313 |
| 467 | Ga0495616_0429304 | 3300046513 | Bacteria | 538 |
| 468 | Ga0495620_0000806 | 3300046515 | Bacteria | 19267 |
| 469 | Ga0495631_0000398 | 3300046518 | Bacteria | 30055 |
| 470 | Ga0495631_0000820 | 3300046518 | Bacteria | 19864 |
| 471 | Ga0495631_0342553 | 3300046518 | Bacteria | 636 |
| 472 | Ga0495632_0001202 | 3300046519 | Bacteria | 21984 |
| 473 | Ga0495632_0011519 | 3300046519 | Bacteria | 5156 |
| 474 | Ga0495632_0022346 | 3300046519 | Bacteria | 3392 |
| 475 | Ga0495648_0000759 | 3300046524 | Bacteria | 34422 |
| 476 | Ga0495648_0002324 | 3300046524 | Bacteria | 17692 |
| 477 | Ga0495663_0008452 | 3300046525 | Bacteria | 2851 |
| 478 | Ga0495633_0024804 | 3300046558 | Bacteria | 2959 |
| 479 | Ga0495668_0002024 | 3300046616 | Bacteria | 17702 |
| 480 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 481 | Ga0495611_0000126 | 3300046648 | Bacteria | 53596 |
| 482 | Ga0495625_0000200 | 3300046660 | Bacteria | 95445 |
| 483 | Ga0495625_0004350 | 3300046660 | Bacteria | 13456 |
| 484 | Ga0495625_0027318 | 3300046660 | Bacteria | 4298 |
| 485 | Ga0495625_0046163 | 3300046660 | Bacteria | 3144 |
| 486 | Ga0495625_0055139 | 3300046660 | Bacteria | 2836 |
| 487 | Ga0495661_0000316 | 3300046665 | Bacteria | 54198 |
| 488 | Ga0495661_0033224 | 3300046665 | Bacteria | 3255 |
| 489 | Ga0495670_0000526 | 3300046691 | Bacteria | 18161 |
| 490 | Ga0495670_0001971 | 3300046691 | Bacteria | 10084 |
| 491 | Ga0495670_0368421 | 3300046691 | Bacteria | 774 |
| 492 | Ga0495671_0000457 | 3300046692 | Bacteria | 32058 |
| 493 | Ga0495649_0013789 | 3300046694 | Bacteria | 4652 |
| 494 | Ga0495649_0041214 | 3300046694 | Bacteria | 2526 |
| 495 | Ga0495589_0000008 | 3300046794 | Bacteria | 266071 |
| 496 | Ga0495660_0000129 | 3300046810 | Bacteria | 83044 |
| 497 | Ga0495660_0000133 | 3300046810 | Bacteria | 81572 |
| 498 | Ga0495683_0004255 | 3300047323 | Bacteria | 8171 |
| 499 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 500 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 501 | Ga0495673_0000041 | 3300047469 | Bacteria | 296723 |
| 502 | Ga0495673_0002539 | 3300047469 | Bacteria | 12740 |
| 503 | Ga0495673_0089300 | 3300047469 | Bacteria | 1262 |
| 504 | Ga0495681_0203478 | 3300047470 | Bacteria | 802 |
| 505 | Ga0495686_0003220 | 3300047472 | Bacteria | 14363 |
| 506 | Ga0495686_0015252 | 3300047472 | Bacteria | 5256 |
| 507 | Ga0495686_0021874 | 3300047472 | Bacteria | 4237 |
| 508 | Ga0496100_0053164 | 3300048903 | Bacteria | 2636 |
| 509 | Ga0496100_0107225 | 3300048903 | Bacteria | 1935 |
| 510 | Ga0496101_0000399 | 3300048904 | Bacteria | 28414 |
| 511 | Ga0496101_0066354 | 3300048904 | Bacteria | 2632 |
| 512 | Ga0496104_0029148 | 3300048907 | Bacteria | 5119 |
| 513 | Ga0496104_0177553 | 3300048907 | Bacteria | 2040 |
| 514 | Ga0496105_0004228 | 3300048908 | Bacteria | 10787 |
| 515 | Ga0496105_0780361 | 3300048908 | Bacteria | 728 |
| 516 | Ga0496106_0023931 | 3300048909 | Bacteria | 4538 |
| 517 | Ga0496106_0127954 | 3300048909 | Bacteria | 1990 |
| 518 | Ga0496106_0218359 | 3300048909 | Bacteria | 1520 |
| 519 | Ga0496106_0249028 | 3300048909 | Bacteria | 1420 |
| 520 | Ga0496106_0784324 | 3300048909 | Bacteria | 756 |
| 521 | Ga0496113_0011972 | 3300048916 | Bacteria | 5815 |
| 522 | Ga0496113_0056358 | 3300048916 | Bacteria | 2950 |
| 523 | Ga0496113_0748372 | 3300048916 | Bacteria | 778 |
| 524 | Ga0496114_0174869 | 3300048917 | Bacteria | 1873 |
| 525 | Ga0496115_0000206 | 3300048918 | Bacteria | 54824 |
| 526 | Ga0496115_0000490 | 3300048918 | Bacteria | 31241 |
| 527 | Ga0496115_0014801 | 3300048918 | Bacteria | 5915 |
| 528 | Ga0496115_0085921 | 3300048918 | Bacteria | 2566 |
| 529 | Ga0496116_0000871 | 3300048919 | Bacteria | 37596 |
| 530 | Ga0496116_0056772 | 3300048919 | Bacteria | 2564 |
| 531 | Ga0496116_0088819 | 3300048919 | Bacteria | 1887 |
| 532 | Ga0496116_0092516 | 3300048919 | Bacteria | 1834 |
| 533 | Ga0496117_0007421 | 3300048920 | Bacteria | 10711 |
| 534 | Ga0496117_0016893 | 3300048920 | Bacteria | 6123 |
| 535 | Ga0496117_0023348 | 3300048920 | Bacteria | 4932 |
| 536 | Ga0496117_0249295 | 3300048920 | Bacteria | 969 |
| 537 | Ga0496117_0411350 | 3300048920 | Unclassified | 679 |
| 538 | Ga0496118_0009407 | 3300048921 | Bacteria | 9870 |
| 539 | Ga0496118_0013752 | 3300048921 | Bacteria | 7631 |
| 540 | Ga0496118_0016111 | 3300048921 | Bacteria | 6875 |
| 541 | Ga0496118_0021066 | 3300048921 | Bacteria | 5755 |
| 542 | Ga0496118_0072559 | 3300048921 | Bacteria | 2471 |
| 543 | Ga0496118_0180092 | 3300048921 | Bacteria | 1278 |
| 544 | Ga0496119_0000690 | 3300048922 | Bacteria | 45185 |
| 545 | Ga0496119_0003147 | 3300048922 | Bacteria | 17350 |
| 546 | Ga0496119_0014114 | 3300048922 | Bacteria | 6286 |
| 547 | Ga0496119_0182883 | 3300048922 | Bacteria | 1098 |
| 548 | Ga0496120_0000386 | 3300048923 | Bacteria | 71308 |
| 549 | Ga0496120_0001439 | 3300048923 | Bacteria | 28598 |
| 550 | Ga0496120_0076881 | 3300048923 | Bacteria | 1818 |
| 551 | Ga0496120_0210877 | 3300048923 | Bacteria | 934 |
| 552 | Ga0496121_0001076 | 3300048924 | Bacteria | 48261 |
| 553 | Ga0496121_0001343 | 3300048924 | Bacteria | 42115 |
| 554 | Ga0496121_0001490 | 3300048924 | Bacteria | 39440 |
| 555 | Ga0496121_0001516 | 3300048924 | Bacteria | 38982 |
| 556 | Ga0496121_0003543 | 3300048924 | Bacteria | 22104 |
| 557 | Ga0496121_0005789 | 3300048924 | Bacteria | 15685 |
| 558 | Ga0496121_0033540 | 3300048924 | Bacteria | 4644 |
| 559 | Ga0496121_0085144 | 3300048924 | Bacteria | 2489 |
| 560 | Ga0496121_0095222 | 3300048924 | Bacteria | 2314 |
| 561 | Ga0496121_0099959 | 3300048924 | Bacteria | 2240 |
| 562 | Ga0496121_0113718 | 3300048924 | Bacteria | 2059 |
| 563 | Ga0496121_0121717 | 3300048924 | Bacteria | 1970 |
| 564 | Ga0496121_0140148 | 3300048924 | Bacteria | 1795 |
| 565 | Ga0496122_0059905 | 3300048925 | Bacteria | 2808 |
| 566 | Ga0496122_0070816 | 3300048925 | Bacteria | 2488 |
| 567 | Ga0496122_0182488 | 3300048925 | Bacteria | 1250 |
| 568 | Ga0496122_0544003 | 3300048925 | Bacteria | 555 |
| 569 | Ga0496123_0002220 | 3300048926 | Bacteria | 24637 |
| 570 | Ga0496123_0015659 | 3300048926 | Bacteria | 6205 |
| 571 | Ga0496123_0018729 | 3300048926 | Bacteria | 5487 |
| 572 | Ga0496123_0029338 | 3300048926 | Bacteria | 4052 |
| 573 | Ga0496123_0123842 | 3300048926 | Bacteria | 1447 |
| 574 | Ga0496124_0001682 | 3300048927 | Bacteria | 31370 |
| 575 | Ga0496124_0002165 | 3300048927 | Bacteria | 26338 |
| 576 | Ga0496124_0207846 | 3300048927 | Bacteria | 1483 |
| 577 | Ga0496124_0704787 | 3300048927 | Bacteria | 639 |
| 578 | Ga0496125_0002769 | 3300048928 | Bacteria | 22183 |
| 579 | Ga0496125_0012798 | 3300048928 | Bacteria | 8294 |
| 580 | Ga0496125_0042580 | 3300048928 | Bacteria | 3864 |
| 581 | Ga0496125_0043432 | 3300048928 | Bacteria | 3815 |
| 582 | Ga0496126_0007673 | 3300048929 | Bacteria | 11776 |
| 583 | Ga0496126_0010754 | 3300048929 | Bacteria | 9555 |
| 584 | Ga0496126_0027844 | 3300048929 | Bacteria | 5391 |
| 585 | Ga0496126_0031552 | 3300048929 | Bacteria | 5003 |
| 586 | Ga0496126_0073690 | 3300048929 | Bacteria | 3035 |
| 587 | Ga0496126_0106924 | 3300048929 | Bacteria | 2441 |
| 588 | Ga0496126_0191547 | 3300048929 | Bacteria | 1731 |
| 589 | Ga0495678_000158 | 3300049459 | Bacteria | 81058 |
| 590 | Ga0495678_058029 | 3300049459 | Bacteria | 1464 |
| 591 | Ga0495678_201012 | 3300049459 | Bacteria | 614 |
| 592 | Ga0495682_0001065 | 3300049460 | Bacteria | 16148 |
| 593 | Ga0495682_0010193 | 3300049460 | Bacteria | 3650 |
| 594 | Ga0501036_1417372 | 3300049572 | Bacteria | 563 |
| 595 | Ga0501037_0760215 | 3300049573 | Bacteria | 642 |
| 596 | Ga0501047_0810947 | 3300049581 | Bacteria | 751 |
| 597 | Ga0501048_0015431 | 3300049582 | Bacteria | 5642 |
| 598 | Ga0501035_0099195 | 3300049822 | Bacteria | 2557 |
| 599 | Ga0501044_0044040 | 3300049823 | Bacteria | 4634 |
| 600 | Ga0501044_0270253 | 3300049823 | Bacteria | 1636 |
| 601 | Ga0501044_0408565 | 3300049823 | Bacteria | 1269 |
| 602 | Ga0501044_0702292 | 3300049823 | Bacteria | 897 |
| 603 | nmdc:mga0sz30_120486_c1 | 3300050516 | Bacteria | 1153 |
| 604 | Ga0500643_000140 | 3300053087 | Bacteria | 72592 |
| 605 | Ga0500555_000327 | 3300053103 | Bacteria | 20441 |
| 606 | Ga0500562_000937 | 3300053108 | Bacteria | 7099 |
| 607 | Ga0500586_096669 | 3300053145 | Bacteria | 1035 |
| 608 | Ga0500633_0001235 | 3300053160 | Bacteria | 4693 |
| 609 | Ga0500634_0030361 | 3300053161 | Bacteria | 2946 |
| 610 | Ga0500645_001152 | 3300053730 | Bacteria | 14285 |
| 611 | Ga0466962_0006730 | 3300061719 | Bacteria | 5509 |
| 612 | 2538832171 | 2537561836 | Bacteria | 3910579 |
| 613 | 2721026184 | 2718218334 | Bacteria | 4765486 |
| 614 | 2739732041 | 2739367700 | Bacteria | 4747630 |
| 615 | 2884413818 | 2884411467 | Bacteria | 5246714 |
| 616 | 2895398036 | 2895395659 | Bacteria | 3983269 |
| 617 | 2928964735 | 2928963466 | Bacteria | 5165703 |
| 618 | 2941494180 | 2941489479 | Bacteria | 6313767 |
| 619 | rootL2_10081353 | |||
| 620 | 2214811339 | |||
| 621 | JGI24739J22299_10007614 | |||
| 622 | JGI24739J22299_10049283 | |||
| 623 | JGI24737J22298_10006842 | |||
| 624 | JGI24737J22298_10013559 | |||
| 625 | JGI24735J21928_10004826 | |||
| 626 | JGI25156J39149_1024196 | |||
| 627 | JGI25162J39368_1000138 | |||
| 628 | JGI25162J39368_1000605 | |||
| 629 | JGI25162J39368_1001369 | |||
| 630 | JGI25162J39368_1001619 | |||
| 631 | JGI25162J39368_1002664 | |||
| 632 | JGI25157J39369_1000182 | |||
| 633 | JGI25157J39369_1000253 | |||
| 634 | JGI25157J39369_1001032 | |||
| 635 | JGI25157J39369_1006786 | |||
| 636 | JGI25157J39369_1010147 | |||
| 637 | JGI25163J39215_1000444 | |||
| 638 | JGI25164J39214_1000170 | |||
| 639 | JGI25164J39214_1000390 | |||
| 640 | JGI25164J39214_1000439 | |||
| 641 | JGI25165J46597_1000224 | |||
| 642 | JGI25165J46597_1000725 | |||
| 643 | JGI25165J46597_1004499 | |||
| 644 | JGI25153J46596_10012356 | |||
| 645 | rootH2_10063399 | |||
| 646 | rootH2_10208949 | |||
| 647 | Ga0006562J51391_1016133 | |||
| 648 | Ga0006562J51391_1016134 | |||
| 649 | Ga0055538_1002329 | |||
| 650 | Ga0055533_1000506 | |||
| 651 | Ga0055533_1004350 | |||
| 652 | Ga0055525_1000164 | |||
| 653 | Ga0055527_1000065 | |||
| 654 | Ga0055527_1000272 | |||
| 655 | Ga0055527_1000317 | |||
| 656 | Ga0055535_1000216 | |||
| 657 | Ga0055535_1000690 | |||
| 658 | Ga0055535_1000716 | |||
| 659 | Ga0055535_1000949 | |||
| 660 | Ga0055542_1000097 | |||
| 661 | Ga0055542_1000136 | |||
| 662 | Ga0055542_1000140 | |||
| 663 | Ga0055542_1000179 | |||
| 664 | Ga0055542_1000932 | |||
| 665 | Ga0055529_1000189 | |||
| 666 | Ga0055529_1000335 | |||
| 667 | Ga0055529_1008619 | |||
| 668 | Ga0055537_1000021 | |||
| 669 | Ga0055524_1000037 | |||
| 670 | Ga0055524_1028565 | |||
| 671 | Ga0055534_1000006 | |||
| 672 | Ga0055528_1000006 | |||
| 673 | Ga0055531_10003887 | |||
| 674 | Ga0065165_1000566 | |||
| 675 | Ga0065165_1003025 | |||
| 676 | Ga0065716_1009210 | |||
| 677 | Ga0070658_10114304 | |||
| 678 | Ga0070658_10199149 | |||
| 679 | Ga0070680_100328929 | |||
| 680 | Ga0070682_100027250 | |||
| 681 | Ga0070682_100275457 | |||
| 682 | Ga0070682_100312909 | |||
| 683 | Ga0070660_100021077 | |||
| 684 | Ga0070660_100131048 | |||
| 685 | Ga0070660_100191114 | |||
| 686 | Ga0070660_100317864 | |||
| 687 | Ga0070660_100509730 | |||
| 688 | Ga0070660_100647956 | |||
| 689 | Ga0070660_100915801 | |||
| 690 | Ga0070661_100029573 | |||
| 691 | Ga0070661_101646289 | |||
| 692 | Ga0070659_100191664 | |||
| 693 | Ga0070659_100231405 | |||
| 694 | Ga0070659_100326043 | |||
| 695 | Ga0070659_100777757 | |||
| 696 | Ga0070659_101945863 | |||
| 697 | Ga0070714_100000030 | |||
| 698 | Ga0070714_100092470 | |||
| 699 | Ga0070713_100001474 | |||
| 700 | Ga0070711_100130051 | |||
| 701 | Ga0070694_100069688 | |||
| 702 | Ga0070663_100705725 | |||
| 703 | Ga0070662_100055644 | |||
| 704 | Ga0070681_10040856 | |||
| 705 | Ga0070681_10269327 | |||
| 706 | Ga0070681_10627521 | |||
| 707 | Ga0068867_101433101 | |||
| 708 | Ga0070685_10000461 | |||
| 709 | Ga0070679_100039770 | |||
| 710 | Ga0070679_100149893 | |||
| 711 | Ga0070684_101167710 | |||
| 712 | Ga0068853_100018029 | |||
| 713 | Ga0068853_100243644 | |||
| 714 | Ga0068853_101040921 | |||
| 715 | Ga0070696_100015121 | |||
| 716 | Ga0070696_100106855 | |||
| 717 | Ga0070693_100659557 | |||
| 718 | Ga0070665_100071137 | |||
| 719 | Ga0068855_100066875 | |||
| 720 | Ga0068855_100148459 | |||
| 721 | Ga0068855_101869141 | |||
| 722 | Ga0068857_100012027 | |||
| 723 | Ga0068857_100033648 | |||
| 724 | Ga0068857_100279182 | |||
| 725 | Ga0068854_100001248 | |||
| 726 | Ga0068854_100062286 | |||
| 727 | Ga0068854_100161396 | |||
| 728 | Ga0068854_100242675 | |||
| 729 | Ga0068856_100001493 | |||
| 730 | Ga0068856_100260833 | |||
| 731 | Ga0068856_100545950 | |||
| 732 | Ga0068852_100067297 | |||
| 733 | Ga0068852_100165028 | |||
| 734 | Ga0068851_10024532 | |||
| 735 | Ga0068851_10692160 | |||
| 736 | Ga0068858_100108278 | |||
| 737 | Ga0068858_102202718 | |||
| 738 | Ga0068862_100400578 | |||
| 739 | Ga0099823_1000028 | |||
| 740 | Ga0105244_10028766 | |||
| 741 | Ga0105250_10056527 | |||
| 742 | Ga0105240_10000609 | |||
| 743 | Ga0105240_10002324 | |||
| 744 | Ga0105240_10005495 | |||
| 745 | Ga0105240_10023541 | |||
| 746 | Ga0105240_10027518 | |||
| 747 | Ga0105240_10034726 | |||
| 748 | Ga0105240_10429652 | |||
| 749 | Ga0105247_10001759 | |||
| 750 | Ga0105241_10177031 | |||
| 751 | Ga0105241_10526954 | |||
| 752 | Ga0105241_12634373 | |||
| 753 | Ga0105237_10000150 | |||
| 754 | Ga0105237_10017018 | |||
| 755 | Ga0105237_10041409 | |||
| 756 | Ga0105237_10252220 | |||
| 757 | Ga0105238_10017721 | |||
| 758 | Ga0105238_10053232 | |||
| 759 | Ga0105238_10145302 | |||
| 760 | Ga0105238_10159548 | |||
| 761 | Ga0105238_10505221 | |||
| 762 | Ga0105249_10033072 | |||
| 763 | Ga0105239_10000043 | |||
| 764 | Ga0105239_10627913 | |||
| 765 | Ga0105239_11786623 | |||
| 766 | Ga0157314_1000939 | |||
| 767 | Ga0157373_10035698 | |||
| 768 | Ga0157373_10113517 | |||
| 769 | Ga0157373_10130462 | |||
| 770 | Ga0157373_10260475 | |||
| 771 | Ga0157373_10292167 | |||
| 772 | Ga0157373_10435508 | |||
| 773 | Ga0157373_10541377 | |||
| 774 | Ga0157371_10007045 | |||
| 775 | Ga0157371_10025302 | |||
| 776 | Ga0157371_10054194 | |||
| 777 | Ga0157371_10065001 | |||
| 778 | Ga0157370_10000662 | |||
| 779 | Ga0157370_10001955 | |||
| 780 | Ga0157370_10005446 | |||
| 781 | Ga0157370_10019836 | |||
| 782 | Ga0157370_10055639 | |||
| 783 | Ga0157370_10223059 | |||
| 784 | Ga0157370_10251118 | |||
| 785 | Ga0157370_10287348 | |||
| 786 | Ga0157370_10596023 | |||
| 787 | Ga0157370_11923945 | |||
| 788 | Ga0157369_10000580 | |||
| 789 | Ga0157369_10027481 | |||
| 790 | Ga0157369_10042069 | |||
| 791 | Ga0157369_10066969 | |||
| 792 | Ga0157369_10540879 | |||
| 793 | Ga0163162_10127993 | |||
| 794 | Ga0157372_10009430 | |||
| 795 | Ga0157372_10031116 | |||
| 796 | Ga0157372_10058048 | |||
| 797 | Ga0157372_10458414 | |||
| 798 | Ga0163163_12918942 | |||
| 799 | Ga0182008_10000262 | |||
| 800 | Ga0182008_10008655 | |||
| 801 | Ga0182008_10085561 | |||
| 802 | Ga0182008_10114951 | |||
| 803 | Ga0182008_10684538 | |||
| 804 | Ga0182008_10995007 | |||
| 805 | Ga0182006_1000031 | |||
| 806 | Ga0182006_1005217 | |||
| 807 | Ga0182006_1075906 | |||
| 808 | Ga0182006_1192280 | |||
| 809 | Ga0182007_10002777 | |||
| 810 | Ga0182007_10026485 | |||
| 811 | Ga0182007_10031851 | |||
| 812 | Ga0182007_10037606 | |||
| 813 | Ga0182007_10379145 | |||
| 814 | Ga0182005_1000352 | |||
| 815 | Ga0182005_1000424 | |||
| 816 | Ga0182005_1002188 | |||
| 817 | Ga0183368_1003 | |||
| 818 | Ga0183360_10002 | |||
| 819 | Ga0163161_10026249 | |||
| 820 | Ga0206353_11697107 | |||
| 821 | Ga0209435_108199 | |||
| 822 | Ga0209760_101163 | |||
| 823 | Ga0209784_100068 | |||
| 824 | Ga0209566_103158 | |||
| 825 | Ga0209674_100012 | |||
| 826 | Ga0209674_100247 | |||
| 827 | Ga0209674_101344 | |||
| 828 | Ga0209674_101766 | |||
| 829 | Ga0209674_112671 | |||
| 830 | Ga0209672_100029 | |||
| 831 | Ga0209672_100049 | |||
| 832 | Ga0209672_100828 | |||
| 833 | Ga0209672_101400 | |||
| 834 | Ga0209563_100051 | |||
| 835 | Ga0207427_100118 | |||
| 836 | Ga0207427_100120 | |||
| 837 | Ga0207427_100140 | |||
| 838 | Ga0209437_100020 | |||
| 839 | Ga0209437_100147 | |||
| 840 | Ga0209437_100193 | |||
| 841 | Ga0209437_100231 | |||
| 842 | Ga0209437_106636 | |||
| 843 | Ga0209437_113991 | |||
| 844 | Ga0209258_100053 | |||
| 845 | Ga0209258_100087 | |||
| 846 | Ga0209258_100149 | |||
| 847 | Ga0209258_100360 | |||
| 848 | Ga0209258_101666 | |||
| 849 | Ga0209258_111253 | |||
| 850 | Ga0209646_1001031 | |||
| 851 | Ga0209646_1001535 | |||
| 852 | Ga0209026_1000037 | |||
| 853 | Ga0209026_1000060 | |||
| 854 | Ga0209026_1000099 | |||
| 855 | Ga0209026_1000122 | |||
| 856 | Ga0209026_1010796 | |||
| 857 | Ga0209148_1000002 | |||
| 858 | Ga0209148_1000009 | |||
| 859 | Ga0209148_1000010 | |||
| 860 | Ga0209148_1000096 | |||
| 861 | Ga0209148_1000143 | |||
| 862 | Ga0209148_1001326 | |||
| 863 | Ga0209759_1000295 | |||
| 864 | Ga0209759_1000755 | |||
| 865 | Ga0209759_1005891 | |||
| 866 | Ga0209759_1011516 | |||
| 867 | Ga0209759_1018361 | |||
| 868 | Ga0209759_1039457 | |||
| 869 | Ga0209129_1001547 | |||
| 870 | Ga0209233_1000009 | |||
| 871 | Ga0209233_1000020 | |||
| 872 | Ga0209233_1000147 | |||
| 873 | Ga0209233_1016709 | |||
| 874 | Ga0209233_1019288 | |||
| 875 | Ga0209565_1000002 | |||
| 876 | Ga0209565_1013220 | |||
| 877 | Ga0209455_1000060 | |||
| 878 | Ga0209455_1000086 | |||
| 879 | Ga0209455_1000088 | |||
| 880 | Ga0209455_1000323 | |||
| 881 | Ga0209455_1003818 | |||
| 882 | Ga0209673_1000002 | |||
| 883 | Ga0209673_1005616 | |||
| 884 | Ga0209675_1000002 | |||
| 885 | Ga0209564_1000004 | |||
| 886 | Ga0209758_1003144 | |||
| 887 | Ga0209758_1024338 | |||
| 888 | Ga0209758_1104395 | |||
| 889 | Ga0209758_1137551 | |||
| 890 | Ga0209050_1007094 | |||
| 891 | Ga0209256_1000004 | |||
| 892 | Ga0209256_1001298 | |||
| 893 | Ga0209051_1036057 | |||
| 894 | Ga0209051_1056415 | |||
| 895 | Ga0209257_1004442 | |||
| 896 | Ga0207656_10006823 | |||
| 897 | Ga0207655_1005575 | |||
| 898 | Ga0207692_10105317 | |||
| 899 | Ga0207710_10030777 | |||
| 900 | Ga0207647_10000008 | |||
| 901 | Ga0207647_10010279 | |||
| 902 | Ga0207647_10017679 | |||
| 903 | Ga0207647_10025555 | |||
| 904 | Ga0207705_10065518 | |||
| 905 | Ga0207705_10445480 | |||
| 906 | Ga0207707_10031108 | |||
| 907 | Ga0207707_10049060 | |||
| 908 | Ga0207707_10065252 | |||
| 909 | Ga0207707_10445638 | |||
| 910 | Ga0207695_10000007 | |||
| 911 | Ga0207695_10002140 | |||
| 912 | Ga0207695_10004510 | |||
| 913 | Ga0207695_10004697 | |||
| 914 | Ga0207695_10005651 | |||
| 915 | Ga0207695_10016227 | |||
| 916 | Ga0207695_10017458 | |||
| 917 | Ga0207695_10445277 | |||
| 918 | Ga0207671_10000021 | |||
| 919 | Ga0207671_10000570 | |||
| 920 | Ga0207671_10014511 | |||
| 921 | Ga0207671_10209588 | |||
| 922 | Ga0207671_10638963 | |||
| 923 | Ga0207663_10158070 | |||
| 924 | Ga0207660_10382622 | |||
| 925 | Ga0207657_10122040 | |||
| 926 | Ga0207657_10505889 | |||
| 927 | Ga0207657_10831361 | |||
| 928 | Ga0207657_10854408 | |||
| 929 | Ga0207657_11016520 | |||
| 930 | Ga0207649_10024302 | |||
| 931 | Ga0207649_10127093 | |||
| 932 | Ga0207649_10314006 | |||
| 933 | Ga0207652_10437223 | |||
| 934 | Ga0207652_10510715 | |||
| 935 | Ga0207694_10022646 | |||
| 936 | Ga0207694_10044760 | |||
| 937 | Ga0207694_10100021 | |||
| 938 | Ga0207700_10102431 | |||
| 939 | Ga0207664_10000026 | |||
| 940 | Ga0207664_10001232 | |||
| 941 | Ga0207664_10014498 | |||
| 942 | Ga0207690_10003519 | |||
| 943 | Ga0207690_10026092 | |||
| 944 | Ga0207690_10026659 | |||
| 945 | Ga0207690_10030691 | |||
| 946 | Ga0207690_10190131 | |||
| 947 | Ga0207706_10016229 | |||
| 948 | Ga0207706_11299653 | |||
| 949 | Ga0207670_10003742 | |||
| 950 | Ga0207667_10000141 | |||
| 951 | Ga0207667_10004475 | |||
| 952 | Ga0207667_10030752 | |||
| 953 | Ga0207667_10036239 | |||
| 954 | Ga0207667_10815264 | |||
| 955 | Ga0207668_10058790 | |||
| 956 | Ga0207640_10000268 | |||
| 957 | Ga0207640_10005600 | |||
| 958 | Ga0207640_10076565 | |||
| 959 | Ga0207640_10299994 | |||
| 960 | Ga0207640_10726831 | |||
| 961 | Ga0207703_10042601 | |||
| 962 | Ga0207703_11895906 | |||
| 963 | Ga0207639_10012868 | |||
| 964 | Ga0207639_10411095 | |||
| 965 | Ga0207639_10495673 | |||
| 966 | Ga0207678_10021249 | |||
| 967 | Ga0207678_10199974 | |||
| 968 | Ga0207678_10335394 | |||
| 969 | Ga0207678_10420241 | |||
| 970 | Ga0207702_10000143 | |||
| 971 | Ga0207702_10005861 | |||
| 972 | Ga0207702_10104281 | |||
| 973 | Ga0207702_10248718 | |||
| 974 | Ga0207648_11637421 | |||
| 975 | Ga0207674_10018823 | |||
| 976 | Ga0207674_10028427 | |||
| 977 | Ga0207674_10053534 | |||
| 978 | Ga0207683_10537747 | |||
| 979 | Ga0207698_10050414 | |||
| 980 | Ga0207698_10146895 | |||
| 981 | Ga0209389_1002696 | |||
| 982 | Ga0209371_1028278 | |||
| 983 | Ga0268266_10067831 | |||
| 984 | Ga0268265_10047181 | |||
| 985 | Ga0268256_1031109 | |||
| 986 | Ga0316575_10120433 | |||
| 987 | Ga0307412_10001089 | |||
| 988 | Ga0307412_10009657 | |||
| 989 | Ga0307414_10006721 | |||
| 990 | Ga0307414_11436015 | |||
| 991 | Ga0395899_0049847 | |||
| 992 | Ga0395899_0078980 | |||
| 993 | Ga0395899_0289097 | |||
| 994 | Ga0395900_0000012 | |||
| 995 | Ga0395900_0043991 | |||
| 996 | Ga0395900_0094855 | |||
| 997 | Ga0395898_0000144 | |||
| 998 | Ga0395898_0000278 | |||
| 999 | Ga0395898_0047872 | |||
| 1000 | Ga0395898_0195278 | |||
| 1001 | Ga0395898_0215239 | |||
| 1002 | Ga0395898_0250134 | |||
| 1003 | Ga0395905_0065805 | |||
| 1004 | Ga0395901_0002971 | |||
| 1005 | Ga0395901_0003001 | |||
| 1006 | Ga0395901_0043917 | |||
| 1007 | Ga0395901_0064734 | |||
| 1008 | Ga0395901_0085942 | |||
| 1009 | Ga0395901_0163441 | |||
| 1010 | Ga0395901_0297520 | |||
| 1011 | Ga0395901_0308117 | |||
| 1012 | Ga0395901_0517473 | |||
| 1013 | Ga0436361_0457520 | |||
| 1014 | Ga0439436_0000022 | |||
| 1015 | Ga0451793_0109338 | |||
| 1016 | Ga0439445_0045814 | |||
| 1017 | Ga0439448_0043018 | |||
| 1018 | Ga0439448_0139858 | |||
| 1019 | Ga0450911_003004 | |||
| 1020 | Ga0451577_0013048 | |||
| 1021 | Ga0466969_0011768 | |||
| 1022 | Ga0466969_0096507 | |||
| 1023 | Ga0466969_0160241 | |||
| 1024 | Ga0466969_0173790 | |||
| 1025 | Ga0466972_0016889 | |||
| 1026 | Ga0466975_0097397 | |||
| 1027 | Ga0466982_0000005 | |||
| 1028 | Ga0466966_0001494 | |||
| 1029 | Ga0466961_0000566 | |||
| 1030 | Ga0466961_0016490 | |||
| 1031 | Ga0466961_0048925 | |||
| 1032 | Ga0466961_0097893 | |||
| 1033 | Ga0466961_0116544 | |||
| 1034 | Ga0466961_0135840 | |||
| 1035 | Ga0466964_0031182 | |||
| 1036 | Ga0466971_0005312 | |||
| 1037 | Ga0466971_0010066 | |||
| 1038 | Ga0466971_0210131 | |||
| 1039 | Ga0466968_0001781 | |||
| 1040 | Ga0466970_0005776 | |||
| 1041 | Ga0466970_0077536 | |||
| 1042 | Ga0466970_0345714 | |||
| 1043 | Ga0466957_0057654 | |||
| 1044 | Ga0466957_0114747 | |||
| 1045 | Ga0466957_0168536 | |||
| 1046 | Ga0466957_0892428 | |||
| 1047 | Ga0466960_0011759 | |||
| 1048 | Ga0466959_0000204 | |||
| 1049 | Ga0466959_0008851 | |||
| 1050 | Ga0466959_0015619 | |||
| 1051 | Ga0466959_0023999 | |||
| 1052 | Ga0466959_0093158 | |||
| 1053 | Ga0466958_0008283 | |||
| 1054 | Ga0466958_0015594 | |||
| 1055 | Ga0466958_0026658 | |||
| 1056 | Ga0466967_1939174 | |||
| 1057 | Ga0495617_000120 | |||
| 1058 | Ga0495617_000348 | |||
| 1059 | Ga0495638_0000007 | |||
| 1060 | Ga0495638_0000194 | |||
| 1061 | Ga0495638_0000213 | |||
| 1062 | Ga0495638_0000498 | |||
| 1063 | Ga0495638_0018390 | |||
| 1064 | Ga0495650_0000202 | |||
| 1065 | Ga0495650_0000703 | |||
| 1066 | Ga0495605_0051913 | |||
| 1067 | Ga0495584_0000688 | |||
| 1068 | Ga0495585_0000200 | |||
| 1069 | Ga0495585_0004150 | |||
| 1070 | Ga0495585_0296953 | |||
| 1071 | Ga0495607_0000090 | |||
| 1072 | Ga0495607_0000244 | |||
| 1073 | Ga0495607_0009076 | |||
| 1074 | Ga0495607_0259168 | |||
| 1075 | Ga0495583_0058138 | |||
| 1076 | Ga0495606_0000218 | |||
| 1077 | Ga0495606_0001182 | |||
| 1078 | Ga0495606_0001609 | |||
| 1079 | Ga0495606_0045304 | |||
| 1080 | Ga0495606_0197150 | |||
| 1081 | Ga0495610_0001156 | |||
| 1082 | Ga0495610_0061610 | |||
| 1083 | Ga0495616_0000006 | |||
| 1084 | Ga0495616_0006144 | |||
| 1085 | Ga0495616_0429304 | |||
| 1086 | Ga0495620_0000806 | |||
| 1087 | Ga0495631_0000398 | |||
| 1088 | Ga0495631_0000820 | |||
| 1089 | Ga0495631_0342553 | |||
| 1090 | Ga0495632_0001202 | |||
| 1091 | Ga0495632_0011519 | |||
| 1092 | Ga0495632_0022346 | |||
| 1093 | Ga0495648_0000759 | |||
| 1094 | Ga0495648_0002324 | |||
| 1095 | Ga0495663_0008452 | |||
| 1096 | Ga0495633_0024804 | |||
| 1097 | Ga0495668_0002024 | |||
| 1098 | Ga0495611_0000001 | |||
| 1099 | Ga0495611_0000126 | |||
| 1100 | Ga0495625_0000200 | |||
| 1101 | Ga0495625_0004350 | |||
| 1102 | Ga0495625_0027318 | |||
| 1103 | Ga0495625_0046163 | |||
| 1104 | Ga0495625_0055139 | |||
| 1105 | Ga0495661_0000316 | |||
| 1106 | Ga0495661_0033224 | |||
| 1107 | Ga0495670_0000526 | |||
| 1108 | Ga0495670_0001971 | |||
| 1109 | Ga0495670_0368421 | |||
| 1110 | Ga0495671_0000457 | |||
| 1111 | Ga0495649_0013789 | |||
| 1112 | Ga0495649_0041214 | |||
| 1113 | Ga0495589_0000008 | |||
| 1114 | Ga0495660_0000129 | |||
| 1115 | Ga0495660_0000133 | |||
| 1116 | Ga0495683_0004255 | |||
| 1117 | Ga0495679_000004 | |||
| 1118 | Ga0495673_0000004 | |||
| 1119 | Ga0495673_0000041 | |||
| 1120 | Ga0495673_0002539 | |||
| 1121 | Ga0495673_0089300 | |||
| 1122 | Ga0495681_0203478 | |||
| 1123 | Ga0495686_0003220 | |||
| 1124 | Ga0495686_0015252 | |||
| 1125 | Ga0495686_0021874 | |||
| 1126 | Ga0496100_0053164 | |||
| 1127 | Ga0496100_0107225 | |||
| 1128 | Ga0496101_0000399 | |||
| 1129 | Ga0496101_0066354 | |||
| 1130 | Ga0496104_0029148 | |||
| 1131 | Ga0496104_0177553 | |||
| 1132 | Ga0496105_0004228 | |||
| 1133 | Ga0496105_0780361 | |||
| 1134 | Ga0496106_0023931 | |||
| 1135 | Ga0496106_0127954 | |||
| 1136 | Ga0496106_0218359 | |||
| 1137 | Ga0496106_0249028 | |||
| 1138 | Ga0496106_0784324 | |||
| 1139 | Ga0496113_0011972 | |||
| 1140 | Ga0496113_0056358 | |||
| 1141 | Ga0496113_0748372 | |||
| 1142 | Ga0496114_0174869 | |||
| 1143 | Ga0496115_0000206 | |||
| 1144 | Ga0496115_0000490 | |||
| 1145 | Ga0496115_0014801 | |||
| 1146 | Ga0496115_0085921 | |||
| 1147 | Ga0496116_0000871 | |||
| 1148 | Ga0496116_0056772 | |||
| 1149 | Ga0496116_0088819 | |||
| 1150 | Ga0496116_0092516 | |||
| 1151 | Ga0496117_0007421 | |||
| 1152 | Ga0496117_0016893 | |||
| 1153 | Ga0496117_0023348 | |||
| 1154 | Ga0496117_0249295 | |||
| 1155 | Ga0496117_0411350 | |||
| 1156 | Ga0496118_0009407 | |||
| 1157 | Ga0496118_0013752 | |||
| 1158 | Ga0496118_0016111 | |||
| 1159 | Ga0496118_0021066 | |||
| 1160 | Ga0496118_0072559 | |||
| 1161 | Ga0496118_0180092 | |||
| 1162 | Ga0496119_0000690 | |||
| 1163 | Ga0496119_0003147 | |||
| 1164 | Ga0496119_0014114 | |||
| 1165 | Ga0496119_0182883 | |||
| 1166 | Ga0496120_0000386 | |||
| 1167 | Ga0496120_0001439 | |||
| 1168 | Ga0496120_0076881 | |||
| 1169 | Ga0496120_0210877 | |||
| 1170 | Ga0496121_0001076 | |||
| 1171 | Ga0496121_0001343 | |||
| 1172 | Ga0496121_0001490 | |||
| 1173 | Ga0496121_0001516 | |||
| 1174 | Ga0496121_0003543 | |||
| 1175 | Ga0496121_0005789 | |||
| 1176 | Ga0496121_0033540 | |||
| 1177 | Ga0496121_0085144 | |||
| 1178 | Ga0496121_0095222 | |||
| 1179 | Ga0496121_0099959 | |||
| 1180 | Ga0496121_0113718 | |||
| 1181 | Ga0496121_0121717 | |||
| 1182 | Ga0496121_0140148 | |||
| 1183 | Ga0496122_0059905 | |||
| 1184 | Ga0496122_0070816 | |||
| 1185 | Ga0496122_0182488 | |||
| 1186 | Ga0496122_0544003 | |||
| 1187 | Ga0496123_0002220 | |||
| 1188 | Ga0496123_0015659 | |||
| 1189 | Ga0496123_0018729 | |||
| 1190 | Ga0496123_0029338 | |||
| 1191 | Ga0496123_0123842 | |||
| 1192 | Ga0496124_0001682 | |||
| 1193 | Ga0496124_0002165 | |||
| 1194 | Ga0496124_0207846 | |||
| 1195 | Ga0496124_0704787 | |||
| 1196 | Ga0496125_0002769 | |||
| 1197 | Ga0496125_0012798 | |||
| 1198 | Ga0496125_0042580 | |||
| 1199 | Ga0496125_0043432 | |||
| 1200 | Ga0496126_0007673 | |||
| 1201 | Ga0496126_0010754 | |||
| 1202 | Ga0496126_0027844 | |||
| 1203 | Ga0496126_0031552 | |||
| 1204 | Ga0496126_0073690 | |||
| 1205 | Ga0496126_0106924 | |||
| 1206 | Ga0496126_0191547 | |||
| 1207 | Ga0495678_000158 | |||
| 1208 | Ga0495678_058029 | |||
| 1209 | Ga0495678_201012 | |||
| 1210 | Ga0495682_0001065 | |||
| 1211 | Ga0495682_0010193 | |||
| 1212 | Ga0501036_1417372 | |||
| 1213 | Ga0501037_0760215 | |||
| 1214 | Ga0501047_0810947 | |||
| 1215 | Ga0501048_0015431 | |||
| 1216 | Ga0501035_0099195 | |||
| 1217 | Ga0501044_0044040 | |||
| 1218 | Ga0501044_0270253 | |||
| 1219 | Ga0501044_0408565 | |||
| 1220 | Ga0501044_0702292 | |||
| 1221 | nmdc:mga0sz30_120486_c1 | |||
| 1222 | Ga0500643_000140 | |||
| 1223 | Ga0500555_000327 | |||
| 1224 | Ga0500562_000937 | |||
| 1225 | Ga0500586_096669 | |||
| 1226 | Ga0500633_0001235 | |||
| 1227 | Ga0500634_0030361 | |||
| 1228 | Ga0500645_001152 | |||
| 1229 | Ga0466962_0006730 | |||
| 1230 | 2538832171 | |||
| 1231 | 2721026184 | |||
| 1232 | 2739732041 | |||
| 1233 | 2884413818 | |||
| 1234 | 2895398036 | |||
| 1235 | 2928964735 | |||
| 1236 | 2941494180 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ssu-assembly1.cif.gz_A | structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium | 0.8035 | 7 | 116 |
| 7szt-assembly1.cif.gz_A | crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) | 0.7717 | 7 | 116 |
| 8tgy-assembly1.cif.gz_E | crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea | 0.7672 | 7 | 119 |
| 7ssu-assembly1.cif.gz_A | structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium | 0.7552 | 7 | 116 |
| 8tgy-assembly1.cif.gz_E | crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea | 0.7347 | 7 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P23895_1_110_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.8722 | 7 | 116 | 1.10.3730.20 |
| af_P9WGF1_2_106_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.8516 | 7 | 120 | 1.10.3730.20 |
| af_P69210_8_109_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.8304 | 8 | 117 | 1.10.3730.20 |
| af_P9WGF1_2_106_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.822 | 7 | 120 | 1.10.3730.20 |
| af_Q47377_2_110_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.8202 | 7 | 118 | 1.10.3730.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A318SH63-F1-model_v4 | Multidrug transporter EmrE-like cation transporter | 0.9902 | 1 | 121 |
GO:0005886
GO:0022857 |
| AF-A0A2R4ED90-F1-model_v4 | deleted | 0.9896 | 1 | 123 |
|
| AF-A0A1Q4FY64-F1-model_v4 | EamA domain-containing protein | 0.9828 | 1 | 129 |
GO:0005886
GO:0009103 GO:0009245 GO:0022857 |
| AF-A0A5A7VNI1-F1-model_v4 | EamA family transporter | 0.9816 | 1 | 131 |
GO:0005886
GO:0022857 |
| AF-A0A5N7TUJ0-F1-model_v4 | deleted | 0.9815 | 1 | 132 |
|