F469716

General Info

Members Datasets Scaffolds Average Seq Length
618 288 1236 462

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100136047|Ga0070706_1001360472
Length 498
Sequence MKSGRLLIMRRGFVTCAPPFARQPFRAAFGQRLRAGLKACAPAALIAASLTTACTVGPDYKRPPVVAPETFRAAESAAAGTPAASFADDRWVDVFQDDSLRELIKTALTQNYDVRIAATRILQAEAQYGVTRADRFPTVTGQVQTQEQHGTVTGGRSLPTIGFGQINASLSWELDFWGKYRRASESARAVILASEWGRRAILTSLVSRVASGYFALRSLDLELEIATRTLASRQESLDLTQVRERGGVTALVDVRQAEQLVYSANAQIVDVQREIEQQENFISVLLGQNPGAIARGRALTDQPHAPDVPAGLPSALLDRRPDIQQAEQLIVAANAQIGVAKAAYFPQITLTGSGGVASSALATLFKTGTWAVAGGIVQPIFTAGRTKSQVALAKAQTEEAALIYQQTIQQAFREVSDALVGYRRSRELRATQELLVRSAQDALRLAEVRYRGGATSYLEVLDSDTRLFSAQLDLVQAQFSELAAFVEIYRALGGGWQS

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
127 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
128 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
197 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
282 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
283 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
287 2739367700 Dyella sp. YR388 Isolate Unclassified
288 2928963466 Dyella japonica 1073 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0.97
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.31
Nodule 0
Rhizoplane 5.99
Rhizosphere 86.41
Stem 0
Stem Tuber 0
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100136047 3300005467 Bacteria 2294
2 JGI25162J39368_1000128 3300002737 Bacteria 83781
3 JGI25162J39368_1001176 3300002737 Bacteria 15499
4 JGI25157J39369_1000211 3300002741 Bacteria 48410
5 JGI25163J39215_1000200 3300002771 Bacteria 23294
6 JGI25163J39215_1001338 3300002771 Bacteria 4244
7 JGI25164J39214_1000067 3300002772 Bacteria 103259
8 JGI25165J46597_1000167 3300003214 Bacteria 103259
9 Ga0055538_1000516 3300003751 Bacteria 13801
10 Ga0055535_1000074 3300003761 Bacteria 111974
11 Ga0055542_1000206 3300003762 Bacteria 72609
12 Ga0055542_1000234 3300003762 Bacteria 63993
13 Ga0055529_1000024 3300003763 Bacteria 305218
14 Ga0055529_1000121 3300003763 Bacteria 114639
15 JGI25405J52794_10008510 3300003911 Bacteria 1918
16 Ga0058861_11640852 3300004800 Unclassified 1789
17 Ga0065715_10105847 3300005293 Bacteria 2867
18 Ga0070683_100000143 3300005329 Bacteria 45950
19 Ga0070683_100000220 3300005329 Bacteria 39059
20 Ga0070683_100005639 3300005329 Bacteria 10461
21 Ga0070683_100026423 3300005329 Bacteria 5227
22 Ga0070683_100115491 3300005329 Bacteria 2534
23 Ga0070670_100000972 3300005331 Bacteria 22469
24 Ga0070670_100089350 3300005331 Bacteria 2648
25 Ga0068869_100026825 3300005334 Bacteria 4012
26 Ga0070666_10020079 3300005335 Bacteria 4317
27 Ga0068868_100046836 3300005338 Plasmid 3385
28 Ga0068868_100214099 3300005338 Bacteria 1611
29 Ga0070689_100003398 3300005340 Bacteria 10581
30 Ga0070689_100005894 3300005340 Bacteria 8426
31 Ga0070691_10048834 3300005341 Bacteria 2015
32 Ga0070661_100000234 3300005344 Bacteria 45713
33 Ga0070661_100063920 3300005344 Bacteria 2704
34 Ga0070668_100006458 3300005347 Bacteria 8692
35 Ga0070669_100051261 3300005353 Bacteria 3016
36 Ga0070675_100007961 3300005354 Bacteria 8215
37 Ga0070671_100004457 3300005355 Bacteria 11082
38 Ga0070671_100062557 3300005355 Bacteria 3099
39 Ga0070671_100099243 3300005355 Bacteria 2442
40 Ga0070674_100004308 3300005356 Bacteria 8101
41 Ga0070673_100001149 3300005364 Bacteria 15194
42 Ga0070673_100004449 3300005364 Bacteria 8859
43 Ga0070673_100006426 3300005364 Bacteria 7639
44 Ga0070688_100021948 3300005365 Bacteria 3734
45 Ga0070667_100009506 3300005367 Bacteria 8062
46 Ga0070667_100012251 3300005367 Bacteria 7094
47 Ga0070667_100055953 3300005367 Bacteria 3331
48 Ga0070667_100160608 3300005367 Bacteria 1979
49 Ga0070667_100245313 3300005367 Bacteria 1600
50 Ga0070709_10025690 3300005434 Bacteria 3482
51 Ga0070709_10062035 3300005434 Bacteria 2382
52 Ga0070714_100000383 3300005435 Bacteria 33019
53 Ga0070714_100001461 3300005435 Bacteria 17208
54 Ga0070714_100030653 3300005435 Bacteria 4479
55 Ga0070714_100116363 3300005435 Bacteria 2373
56 Ga0070713_100027183 3300005436 Bacteria 4502
57 Ga0070713_100064738 3300005436 Bacteria 3069
58 Ga0070713_100128805 3300005436 Bacteria 2229
59 Ga0070711_100000026 3300005439 Bacteria 109906
60 Ga0070711_100056848 3300005439 Unclassified 2707
61 Ga0070711_100124799 3300005439 Bacteria 1909
62 Ga0070705_100066413 3300005440 Bacteria 2163
63 Ga0070700_100076592 3300005441 Bacteria 2149
64 Ga0070694_100034789 3300005444 Bacteria 3325
65 Ga0070708_100001652 3300005445 Bacteria 17107
66 Ga0070708_100009863 3300005445 Bacteria 7715
67 Ga0070708_100015699 3300005445 Bacteria 6258
68 Ga0070708_100031701 3300005445 Bacteria 4577
69 Ga0070708_100045550 3300005445 Bacteria 3865
70 Ga0070708_100053282 3300005445 Bacteria 3589
71 Ga0070663_100000408 3300005455 Bacteria 22563
72 Ga0070663_100014026 3300005455 Bacteria 5132
73 Ga0070678_100020767 3300005456 Bacteria 4315
74 Ga0070681_10000040 3300005458 Bacteria 92043
75 Ga0068867_100089249 3300005459 Bacteria 2337
76 Ga0070685_10080636 3300005466 Bacteria 1950
77 Ga0070706_100005515 3300005467 Bacteria 12045
78 Ga0070706_100015004 3300005467 Bacteria 7154
79 Ga0070706_100022703 3300005467 Bacteria 5778
80 Ga0070706_100025991 3300005467 Bacteria 5387
81 Ga0070706_100081970 3300005467 Bacteria 2988
82 Ga0070707_100000274 3300005468 Bacteria 50831
83 Ga0070707_100001189 3300005468 Bacteria 25625
84 Ga0070707_100007926 3300005468 Bacteria 9862
85 Ga0070707_100021662 3300005468 Bacteria 6076
86 Ga0070707_100028942 3300005468 Bacteria 5273
87 Ga0070707_100035708 3300005468 Bacteria 4743
88 Ga0070698_100001736 3300005471 Bacteria 24317
89 Ga0070698_100004837 3300005471 Bacteria 14786
90 Ga0070698_100005889 3300005471 Bacteria 13382
91 Ga0070698_100049157 3300005471 Bacteria 4306
92 Ga0070698_100125256 3300005471 Bacteria 2526
93 Ga0070699_100000340 3300005518 Bacteria 45329
94 Ga0070699_100010464 3300005518 Bacteria 8026
95 Ga0070699_100101875 3300005518 Unclassified 2517
96 Ga0070699_100130055 3300005518 Bacteria 2219
97 Ga0070699_100294297 3300005518 Bacteria 1456
98 Ga0070679_100006419 3300005530 Bacteria 10953
99 Ga0070684_100000160 3300005535 Bacteria 45822
100 Ga0070684_100000182 3300005535 Bacteria 43378
101 Ga0070684_100015303 3300005535 Bacteria 6243
102 Ga0070697_100000045 3300005536 Bacteria 92181
103 Ga0070697_100001897 3300005536 Bacteria 15980
104 Ga0070697_100001951 3300005536 Bacteria 15788
105 Ga0070697_100004850 3300005536 Bacteria 10315
106 Ga0070697_100006853 3300005536 Bacteria 8849
107 Ga0070697_100025873 3300005536 Bacteria 4680
108 Ga0070697_100066734 3300005536 Bacteria 2942
109 Ga0070697_100088138 3300005536 Bacteria 2563
110 Ga0070697_100155990 3300005536 Bacteria 1927
111 Ga0068853_100013827 3300005539 Bacteria 6597
112 Ga0070672_100001716 3300005543 Bacteria 13684
113 Ga0070672_100003685 3300005543 Bacteria 9960
114 Ga0070672_100016576 3300005543 Bacteria 5279
115 Ga0070672_100023172 3300005543 Bacteria 4573
116 Ga0070672_100053664 3300005543 Bacteria 3152
117 Ga0070672_100156575 3300005543 Bacteria 1887
118 Ga0070695_100002697 3300005545 Bacteria 10282
119 Ga0070695_100111260 3300005545 Bacteria 1859
120 Ga0070696_100127949 3300005546 Bacteria 1845
121 Ga0070693_100005047 3300005547 Bacteria 6304
122 Ga0070665_100000734 3300005548 Bacteria 43660
123 Ga0070665_100001926 3300005548 Bacteria 23413
124 Ga0070665_100002722 3300005548 Bacteria 19153
125 Ga0070665_100076068 3300005548 Bacteria 3364
126 Ga0070665_100218671 3300005548 Bacteria 1905
127 Ga0070704_100004872 3300005549 Bacteria 7785
128 Ga0070704_100076574 3300005549 Bacteria 2447
129 Ga0070704_100093090 3300005549 Bacteria 2251
130 Ga0070704_100170820 3300005549 Bacteria 1729
131 Ga0068855_100000096 3300005563 Bacteria 106521
132 Ga0070664_100000167 3300005564 Bacteria 45686
133 Ga0070664_100000620 3300005564 Bacteria 27121
134 Ga0070664_100016720 3300005564 Bacteria 6017
135 Ga0068857_100000125 3300005577 Bacteria 46141
136 Ga0068857_100008749 3300005577 Bacteria 8767
137 Ga0068854_100038799 3300005578 Bacteria 3352
138 Ga0068854_100145637 3300005578 Unclassified 1822
139 Ga0068856_100003482 3300005614 Bacteria 15891
140 Ga0068859_100001693 3300005617 Bacteria 22469
141 Ga0068859_100006073 3300005617 Bacteria 12264
142 Ga0068859_100169337 3300005617 Bacteria 2265
143 Ga0068859_100204974 3300005617 Bacteria 2057
144 Ga0068864_100000279 3300005618 Bacteria 45714
145 Ga0068864_100034752 3300005618 Bacteria 4289
146 Ga0068864_100091196 3300005618 Bacteria 2688
147 Ga0068866_10007755 3300005718 Bacteria 4503
148 Ga0068861_100155450 3300005719 Bacteria 1881
149 Ga0068863_100001947 3300005841 Bacteria 20517
150 Ga0068863_100007533 3300005841 Bacteria 10647
151 Ga0068863_100012882 3300005841 Bacteria 8064
152 Ga0068858_100020187 3300005842 Bacteria 6230
153 Ga0068858_100152627 3300005842 Bacteria 2172
154 Ga0068858_100161870 3300005842 Bacteria 2107
155 Ga0068858_100176517 3300005842 Bacteria 2016
156 Ga0068860_100004356 3300005843 Bacteria 14466
157 Ga0068860_100032463 3300005843 Bacteria 5016
158 Ga0068860_100131542 3300005843 Bacteria 2402
159 Ga0068860_100314288 3300005843 Bacteria 1536
160 Ga0068862_100003738 3300005844 Bacteria 12983
161 Ga0068862_100074968 3300005844 Bacteria 2925
162 Ga0081455_10002001 3300005937 Bacteria 24346
163 Ga0081455_10008910 3300005937 Bacteria 10374
164 Ga0081455_10010810 3300005937 Bacteria 9222
165 Ga0081538_10005759 3300005981 Bacteria 11064
166 Ga0081538_10042632 3300005981 Bacteria 2860
167 Ga0081539_10016496 3300005985 Bacteria 5267
168 Ga0070717_10007895 3300006028 Bacteria 7925
169 Ga0070717_10018326 3300006028 Bacteria 5463
170 Ga0070717_10027707 3300006028 Bacteria 4530
171 Ga0070717_10030976 3300006028 Bacteria 4300
172 Ga0070717_10134476 3300006028 Bacteria 2128
173 Ga0070717_10178085 3300006028 Bacteria 1852
174 Ga0075368_10025470 3300006042 Bacteria 2270
175 Ga0075364_10003231 3300006051 Bacteria 9230
176 Ga0070712_100006132 3300006175 Bacteria 7437
177 Ga0075367_10021051 3300006178 Bacteria 3640
178 Ga0075366_10015720 3300006195 Bacteria 4343
179 Ga0097621_100000301 3300006237 Bacteria 33429
180 Ga0097621_100004998 3300006237 Bacteria 9299
181 Ga0097621_100005937 3300006237 Bacteria 8631
182 Ga0068871_100000026 3300006358 Bacteria 79197
183 Ga0068871_100007939 3300006358 Bacteria 7609
184 Ga0075428_100002023 3300006844 Bacteria 21873
185 Ga0075428_100027619 3300006844 Bacteria 6278
186 Ga0075428_100067834 3300006844 Bacteria 3903
187 Ga0075428_100084289 3300006844 Bacteria 3468
188 Ga0075428_100189977 3300006844 Bacteria 2221
189 Ga0075430_100002944 3300006846 Bacteria 14245
190 Ga0075430_100086787 3300006846 Bacteria 2619
191 Ga0075431_100107966 3300006847 Bacteria 2872
192 Ga0075431_100123417 3300006847 Bacteria 2672
193 Ga0075431_100222910 3300006847 Bacteria 1923
194 Ga0075433_10000750 3300006852 Bacteria 22261
195 Ga0075433_10001290 3300006852 Bacteria 18330
196 Ga0075433_10005934 3300006852 Bacteria 9618
197 Ga0075433_10094948 3300006852 Bacteria 2639
198 Ga0075434_100000235 3300006871 Bacteria 38289
199 Ga0075434_100001017 3300006871 Bacteria 22825
200 Ga0075434_100018769 3300006871 Bacteria 6685
201 Ga0075434_100227661 3300006871 Bacteria 1884
202 Ga0075434_100232804 3300006871 Bacteria 1862
203 Ga0075429_100010584 3300006880 Bacteria 7979
204 Ga0075429_100048204 3300006880 Bacteria 3706
205 Ga0075429_100171138 3300006880 Bacteria 1902
206 Ga0068865_100029696 3300006881 Bacteria 3630
207 Ga0068865_100117707 3300006881 Bacteria 1970
208 Ga0075436_100001682 3300006914 Bacteria 15120
209 Ga0075436_100023661 3300006914 Bacteria 4219
210 Ga0097620_100001693 3300006931 Bacteria 22469
211 Ga0097620_100006073 3300006931 Bacteria 12264
212 Ga0097620_100169336 3300006931 Bacteria 2265
213 Ga0097620_100204968 3300006931 Bacteria 2057
214 Ga0075435_100000452 3300007076 Bacteria 25128
215 Ga0075435_100000913 3300007076 Bacteria 18604
216 Ga0075435_100017459 3300007076 Bacteria 5434
217 Ga0105240_10000820 3300009093 Bacteria 56524
218 Ga0105240_10015398 3300009093 Bacteria 10395
219 Ga0105240_10052578 3300009093 Bacteria 5119
220 Ga0111539_10137608 3300009094 Bacteria 2860
221 Ga0111539_10149258 3300009094 Bacteria 2736
222 Ga0111539_10216146 3300009094 Bacteria 2233
223 Ga0111539_10216652 3300009094 Bacteria 2230
224 Ga0105245_10001771 3300009098 Bacteria 19665
225 Ga0105245_10017902 3300009098 Bacteria 6187
226 Ga0105245_10191177 3300009098 Bacteria 1961
227 Ga0105247_10063331 3300009101 Bacteria 2295
228 Ga0114129_10001204 3300009147 Bacteria 34336
229 Ga0114129_10002242 3300009147 Bacteria 26684
230 Ga0114129_10038983 3300009147 Bacteria 6698
231 Ga0114129_10080587 3300009147 Bacteria 4525
232 Ga0114129_10134928 3300009147 Bacteria 3387
233 Ga0114129_10138739 3300009147 Bacteria 3335
234 Ga0114129_10143333 3300009147 Bacteria 3274
235 Ga0114129_10230398 3300009147 Bacteria 2495
236 Ga0114129_10304527 3300009147 Bacteria 2123
237 Ga0105242_10018683 3300009176 Bacteria 5423
238 Ga0105242_10032235 3300009176 Bacteria 4190
239 Ga0105242_10035862 3300009176 Bacteria 3977
240 Ga0105242_10102011 3300009176 Bacteria 2433
241 Ga0105248_10003003 3300009177 Bacteria 18714
242 Ga0105248_10006995 3300009177 Bacteria 12357
243 Ga0105248_10009394 3300009177 Bacteria 10767
244 Ga0105248_10036582 3300009177 Bacteria 5490
245 Ga0105248_10082000 3300009177 Bacteria 3626
246 Ga0105248_10160000 3300009177 Bacteria 2540
247 Ga0105248_10429214 3300009177 Bacteria 1488
248 Ga0105238_10000548 3300009551 Bacteria 39283
249 Ga0105238_10047273 3300009551 Bacteria 4341
250 Ga0105238_10109773 3300009551 Bacteria 2740
251 Ga0105249_10093537 3300009553 Bacteria 2816
252 Ga0105239_10039491 3300010375 Bacteria 5171
253 Ga0105239_10350360 3300010375 Unclassified 1667
254 Ga0157371_10132784 3300013102 Bacteria 1772
255 Ga0157370_10074852 3300013104 Bacteria 3194
256 Ga0157369_10000041 3300013105 Bacteria 181798
257 Ga0157374_10000078 3300013296 Bacteria 97051
258 Ga0157374_10001634 3300013296 Bacteria 18762
259 Ga0157374_10149582 3300013296 Bacteria 2269
260 Ga0157378_10001275 3300013297 Bacteria 22626
261 Ga0157378_10004118 3300013297 Bacteria 12841
262 Ga0157378_10014844 3300013297 Bacteria 6816
263 Ga0163162_10005538 3300013306 Bacteria 12206
264 Ga0163162_10010864 3300013306 Bacteria 8863
265 Ga0163162_10160217 3300013306 Bacteria 2372
266 Ga0157372_10002437 3300013307 Bacteria 20152
267 Ga0157372_10005509 3300013307 Bacteria 13457
268 Ga0157375_10001114 3300013308 Bacteria 23310
269 Ga0157375_10009404 3300013308 Bacteria 8581
270 Ga0157375_10149763 3300013308 Bacteria 2468
271 Ga0163163_10000331 3300014325 Bacteria 45717
272 Ga0163163_10016677 3300014325 Bacteria 6832
273 Ga0163163_10074280 3300014325 Bacteria 3391
274 Ga0163163_10089395 3300014325 Bacteria 3092
275 Ga0163163_10272376 3300014325 Bacteria 1744
276 Ga0157380_10026440 3300014326 Bacteria 4406
277 Ga0157380_10090002 3300014326 Bacteria 2530
278 Ga0157380_10224577 3300014326 Unclassified 1682
279 Ga0157377_10006200 3300014745 Bacteria 5686
280 Ga0157379_10000724 3300014968 Bacteria 26731
281 Ga0157379_10015700 3300014968 Bacteria 6655
282 Ga0157376_10001052 3300014969 Bacteria 18092
283 Ga0157376_10062359 3300014969 Bacteria 3136
284 Ga0163161_10005720 3300017792 Bacteria 8618
285 Ga0163161_10085781 3300017792 Bacteria 2323
286 Ga0206352_10240259 3300020078 Bacteria 1947
287 Ga0206352_11333410 3300020078 Bacteria 6181
288 Ga0206350_11529353 3300020080 Bacteria 6238
289 Ga0224712_10002894 3300022467 Bacteria 4342
290 Ga0209760_100141 3300025207 Bacteria 45264
291 Ga0209784_100011 3300025224 Bacteria 546770
292 Ga0209672_100261 3300025228 Bacteria 39032
293 Ga0207427_100026 3300025231 Bacteria 412764
294 Ga0207427_101003 3300025231 Bacteria 11846
295 Ga0209437_100202 3300025233 Bacteria 118709
296 Ga0209437_100217 3300025233 Bacteria 105424
297 Ga0209258_100027 3300025242 Bacteria 518449
298 Ga0209258_102798 3300025242 Bacteria 4189
299 Ga0209646_1000336 3300025246 Bacteria 35028
300 Ga0209026_1000018 3300025250 Bacteria 381351
301 Ga0209148_1000001 3300025254 Bacteria 2545271
302 Ga0209148_1000005 3300025254 Bacteria 1806504
303 Ga0209759_1000066 3300025256 Bacteria 184163
304 Ga0209233_1000002 3300025261 Bacteria 2501366
305 Ga0209455_1000019 3300025272 Bacteria 705658
306 Ga0207697_10002151 3300025315 Bacteria 10326
307 Ga0207653_10020498 3300025885 Bacteria 2093
308 Ga0207642_10010531 3300025899 Bacteria 3265
309 Ga0207710_10040663 3300025900 Bacteria 2060
310 Ga0207688_10012322 3300025901 Bacteria 4654
311 Ga0207699_10056729 3300025906 Bacteria 2336
312 Ga0207684_10002967 3300025910 Bacteria 16814
313 Ga0207684_10003814 3300025910 Bacteria 14535
314 Ga0207684_10013800 3300025910 Bacteria 6979
315 Ga0207684_10023532 3300025910 Bacteria 5260
316 Ga0207684_10211338 3300025910 Bacteria 1674
317 Ga0207707_10000194 3300025912 Bacteria 64241
318 Ga0207695_10030006 3300025913 Bacteria 5995
319 Ga0207693_10005450 3300025915 Bacteria 10611
320 Ga0207663_10058077 3300025916 Unclassified 2440
321 Ga0207657_10115716 3300025919 Unclassified 2210
322 Ga0207649_10000108 3300025920 Bacteria 69077
323 Ga0207652_10024558 3300025921 Bacteria 5002
324 Ga0207646_10000016 3300025922 Bacteria 337048
325 Ga0207646_10000335 3300025922 Bacteria 63591
326 Ga0207646_10002569 3300025922 Bacteria 21439
327 Ga0207646_10004403 3300025922 Bacteria 15314
328 Ga0207646_10020331 3300025922 Bacteria 6153
329 Ga0207646_10040771 3300025922 Bacteria 4175
330 Ga0207646_10123518 3300025922 Bacteria 2327
331 Ga0207681_10039774 3300025923 Plasmid 3124
332 Ga0207694_10001056 3300025924 Bacteria 23987
333 Ga0207694_10094167 3300025924 Bacteria 2367
334 Ga0207650_10000333 3300025925 Bacteria 45762
335 Ga0207659_10001340 3300025926 Bacteria 14736
336 Ga0207659_10003444 3300025926 Bacteria 9486
337 Ga0207659_10077299 3300025926 Bacteria 2450
338 Ga0207659_10101459 3300025926 Bacteria 2170
339 Ga0207687_10036946 3300025927 Bacteria 3330
340 Ga0207687_10048410 3300025927 Bacteria 2951
341 Ga0207700_10002445 3300025928 Bacteria 10665
342 Ga0207700_10021583 3300025928 Bacteria 4400
343 Ga0207664_10002981 3300025929 Bacteria 11242
344 Ga0207664_10003389 3300025929 Bacteria 10605
345 Ga0207664_10188661 3300025929 Bacteria 1773
346 Ga0207644_10026662 3300025931 Bacteria 3985
347 Ga0207644_10156734 3300025931 Unclassified 1766
348 Ga0207706_10001028 3300025933 Bacteria 28347
349 Ga0207706_10055322 3300025933 Bacteria 3500
350 Ga0207670_10000990 3300025936 Bacteria 15029
351 Ga0207670_10007523 3300025936 Bacteria 6084
352 Ga0207669_10016842 3300025937 Bacteria 3730
353 Ga0207669_10074988 3300025937 Bacteria 2142
354 Ga0207704_10015597 3300025938 Bacteria 3877
355 Ga0207665_10084589 3300025939 Bacteria 2189
356 Ga0207691_10002492 3300025940 Bacteria 18006
357 Ga0207691_10004264 3300025940 Bacteria 13884
358 Ga0207691_10028144 3300025940 Bacteria 5264
359 Ga0207691_10052616 3300025940 Bacteria 3719
360 Ga0207691_10094590 3300025940 Bacteria 2673
361 Ga0207711_10014458 3300025941 Bacteria 6558
362 Ga0207711_10014880 3300025941 Bacteria 6463
363 Ga0207711_10022583 3300025941 Bacteria 5263
364 Ga0207711_10047537 3300025941 Bacteria 3669
365 Ga0207711_10055795 3300025941 Bacteria 3393
366 Ga0207689_10001315 3300025942 Bacteria 23936
367 Ga0207661_10000383 3300025944 Bacteria 28533
368 Ga0207661_10002659 3300025944 Bacteria 12298
369 Ga0207661_10064106 3300025944 Bacteria 2978
370 Ga0207679_10000144 3300025945 Bacteria 58810
371 Ga0207679_10002530 3300025945 Bacteria 11264
372 Ga0207679_10045970 3300025945 Bacteria 3161
373 Ga0207667_10004696 3300025949 Bacteria 16718
374 Ga0207651_10001698 3300025960 Bacteria 10155
375 Ga0207651_10008303 3300025960 Bacteria 5602
376 Ga0207651_10029259 3300025960 Bacteria 3488
377 Ga0207651_10208640 3300025960 Bacteria 1571
378 Ga0207668_10107730 3300025972 Bacteria 2084
379 Ga0207658_10008251 3300025986 Bacteria 7096
380 Ga0207658_10019734 3300025986 Bacteria 4662
381 Ga0207658_10035674 3300025986 Bacteria 3563
382 Ga0207658_10061328 3300025986 Bacteria 2810
383 Ga0207703_10015707 3300026035 Bacteria 5906
384 Ga0207703_10044380 3300026035 Bacteria 3573
385 Ga0207703_10140524 3300026035 Bacteria 2095
386 Ga0207639_10044711 3300026041 Bacteria 3331
387 Ga0207678_10000287 3300026067 Bacteria 45710
388 Ga0207678_10109839 3300026067 Bacteria 2352
389 Ga0207708_10036263 3300026075 Bacteria 3754
390 Ga0207702_10000275 3300026078 Bacteria 59296
391 Ga0207702_10015385 3300026078 Bacteria 6340
392 Ga0207641_10000375 3300026088 Bacteria 53080
393 Ga0207641_10003732 3300026088 Bacteria 13397
394 Ga0207648_10029646 3300026089 Plasmid 4852
395 Ga0207648_10035374 3300026089 Bacteria 4399
396 Ga0207676_10000177 3300026095 Bacteria 56007
397 Ga0207676_10026068 3300026095 Bacteria 4344
398 Ga0207676_10031199 3300026095 Bacteria 4007
399 Ga0207674_10003119 3300026116 Bacteria 20448
400 Ga0207674_10039957 3300026116 Bacteria 4861
401 Ga0207675_100118448 3300026118 Bacteria 2504
402 Ga0207683_10000986 3300026121 Bacteria 26081
403 Ga0207683_10011183 3300026121 Bacteria 7652
404 Ga0207683_10137484 3300026121 Bacteria 2200
405 Ga0207428_10024561 3300027907 Bacteria 5061
406 Ga0207428_10058563 3300027907 Bacteria 3056
407 Ga0268266_10002594 3300028379 Bacteria 19148
408 Ga0268266_10008071 3300028379 Bacteria 9403
409 Ga0268266_10013775 3300028379 Bacteria 6963
410 Ga0268266_10045651 3300028379 Bacteria 3748
411 Ga0268265_10001584 3300028380 Bacteria 18839
412 Ga0268264_10023654 3300028381 Bacteria 5010
413 Ga0268264_10052506 3300028381 Bacteria 3398
414 Ga0268264_10166832 3300028381 Bacteria 1988
415 Ga0265760_10000025 3300031090 Bacteria 64249
416 Ga0373934_0000563 3300035086 Bacteria 13066
417 Ga0373923_0001500 3300035111 Bacteria 6719
418 Ga0373954_0017599 3300035118 Bacteria 3211
419 Ga0373954_0068771 3300035118 Unclassified 1680
420 Ga0373943_0003287 3300035170 Bacteria 7349
421 Ga0373955_0006748 3300035172 Bacteria 5241
422 Ga0373935_0025603 3300035692 Bacteria 3635
423 Ga0373927_0003343 3300035695 Bacteria 11538
424 Ga0373927_0007323 3300035695 Bacteria 7477
425 Ga0373933_0001011 3300035724 Bacteria 17083
426 Ga0373947_0003851 3300035725 Bacteria 8831
427 Ga0373937_0002596 3300036401 Bacteria 15030
428 Ga0373937_0129160 3300036401 Bacteria 2359
429 Ga0373925_0002846 3300037068 Bacteria 13657
430 Ga0373925_0131752 3300037068 Bacteria 1950
431 Ga0395900_0252419 3300037418 Unclassified 1765
432 Ga0395905_0005346 3300037471 Bacteria 13121
433 Ga0395905_0006549 3300037471 Bacteria 11707
434 Ga0436363_1330608 3300039450 Unclassified 1328
435 Ga0436363_1550405 3300039450 Bacteria 1826
436 Ga0450908_011193 3300042184 Bacteria 1645
437 Ga0439460_0020902 3300042461 Bacteria 1784
438 Ga0453683_0015215 3300044673 Bacteria 4986
439 Ga0466957_0086600 3300044842 Bacteria 1958
440 Ga0451576_0274352 3300045051 Bacteria 1763
441 Ga0466967_0001387 3300045976 Bacteria 13988
442 Ga0495638_0000100 3300046460 Bacteria 139296
443 Ga0495638_0000322 3300046460 Bacteria 61567
444 Ga0495638_0000497 3300046460 Bacteria 46775
445 Ga0495651_0002157 3300046462 Bacteria 15237
446 Ga0495651_0034780 3300046462 Bacteria 3927
447 Ga0495651_0186824 3300046462 Unclassified 1462
448 Ga0495653_0003589 3300046463 Bacteria 12508
449 Ga0495650_0000064 3300046471 Bacteria 275412
450 Ga0495580_0023348 3300046472 Bacteria 4544
451 Ga0495580_0204511 3300046472 Unclassified 1360
452 Ga0495664_0000934 3300046477 Bacteria 15085
453 Ga0495606_0000016 3300046507 Bacteria 284865
454 Ga0495608_0022403 3300046511 Bacteria 4331
455 Ga0495643_0001973 3300046522 Bacteria 17211
456 Ga0495652_0003580 3300046529 Bacteria 15245
457 Ga0495665_0099925 3300046531 Unclassified 1523
458 Ga0495587_0000925 3300046536 Bacteria 19321
459 Ga0495645_0001037 3300046543 Bacteria 18913
460 Ga0495622_0020005 3300046557 Bacteria 3116
461 Ga0495667_0036703 3300046559 Bacteria 3269
462 Ga0495657_0088394 3300046675 Bacteria 1992
463 Ga0495599_0009443 3300046678 Bacteria 5963
464 Ga0495623_0004525 3300046679 Bacteria 9125
465 Ga0495658_0014310 3300046683 Bacteria 4052
466 Ga0495669_0005987 3300046684 Bacteria 5070
467 Ga0495649_0000560 3300046694 Bacteria 31484
468 Ga0495649_0012441 3300046694 Bacteria 4948
469 Ga0495672_0020918 3300047320 Bacteria 4277
470 Ga0495680_0070430 3300047322 Bacteria 2667
471 Ga0495675_0000752 3300047444 Bacteria 20276
472 Ga0495684_0005970 3300047471 Bacteria 9462
473 Ga0495593_0144305 3300047673 Unclassified 1205
474 Ga0495602_0004317 3300048088 Bacteria 14807
475 Ga0495602_0116154 3300048088 Unclassified 2163
476 Ga0495602_0207499 3300048088 Unclassified 1490
477 Ga0496100_0003050 3300048903 Bacteria 8648
478 Ga0496100_0098728 3300048903 Bacteria 2008
479 Ga0496101_0000139 3300048904 Bacteria 63989
480 Ga0496102_0038807 3300048905 Bacteria 4301
481 Ga0496102_0046811 3300048905 Bacteria 3929
482 Ga0496104_0004150 3300048907 Bacteria 12580
483 Ga0496104_0004311 3300048907 Bacteria 12374
484 Ga0496104_0254354 3300048907 Unclassified 1669
485 Ga0496105_0027545 3300048908 Bacteria 4644
486 Ga0496105_0038508 3300048908 Bacteria 3939
487 Ga0496105_0177197 3300048908 Bacteria 1746
488 Ga0496106_0006560 3300048909 Bacteria 8620
489 Ga0496106_0101101 3300048909 Bacteria 2236
490 Ga0496108_0000308 3300048911 Bacteria 42004
491 Ga0496108_0016439 3300048911 Bacteria 6035
492 Ga0496109_0000311 3300048912 Bacteria 45781
493 Ga0496109_0040282 3300048912 Bacteria 4231
494 Ga0496110_0001625 3300048913 Bacteria 16479
495 Ga0496110_0118887 3300048913 Bacteria 2380
496 Ga0496110_0119846 3300048913 Bacteria 2370
497 Ga0496111_0027177 3300048914 Bacteria 4046
498 Ga0496111_0052548 3300048914 Bacteria 2943
499 Ga0496112_0000135 3300048915 Bacteria 45822
500 Ga0496112_0000268 3300048915 Bacteria 33513
501 Ga0496112_0000895 3300048915 Bacteria 21451
502 Ga0496112_0056387 3300048915 Bacteria 3866
503 Ga0496112_0060142 3300048915 Bacteria 3743
504 Ga0496112_0142914 3300048915 Bacteria 2362
505 Ga0496113_0000131 3300048916 Bacteria 32371
506 Ga0496113_0001699 3300048916 Bacteria 12480
507 Ga0496114_0000577 3300048917 Bacteria 27102
508 Ga0496114_0044494 3300048917 Bacteria 3684
509 Ga0496114_0119435 3300048917 Bacteria 2266
510 Ga0496115_0004221 3300048918 Bacteria 10386
511 Ga0496115_0011685 3300048918 Bacteria 6590
512 Ga0496115_0083131 3300048918 Bacteria 2609
513 Ga0496115_0095496 3300048918 Bacteria 2433
514 Ga0501032_0002080 3300049569 Bacteria 15811
515 Ga0501033_0004640 3300049570 Bacteria 10998
516 Ga0501033_0013764 3300049570 Bacteria 6153
517 Ga0501033_0188278 3300049570 Bacteria 1478
518 Ga0501034_0020247 3300049571 Bacteria 6793
519 Ga0501034_0100384 3300049571 Bacteria 2888
520 Ga0501034_0112428 3300049571 Bacteria 2713
521 Ga0501036_0042489 3300049572 Bacteria 3848
522 Ga0501036_0065181 3300049572 Bacteria 3083
523 Ga0501037_0013387 3300049573 Bacteria 6042
524 Ga0501038_0005510 3300049574 Bacteria 11755
525 Ga0501038_0012667 3300049574 Bacteria 7707
526 Ga0501038_0024768 3300049574 Bacteria 5349
527 Ga0501038_0036687 3300049574 Bacteria 4301
528 Ga0501039_0016932 3300049575 Bacteria 5587
529 Ga0501039_0041518 3300049575 Bacteria 3553
530 Ga0501040_0086250 3300049576 Bacteria 2180
531 Ga0501043_0016936 3300049579 Bacteria 5712
532 Ga0501043_0027292 3300049579 Bacteria 4483
533 Ga0501043_0088461 3300049579 Bacteria 2434
534 Ga0501046_0005966 3300049580 Bacteria 10840
535 Ga0501046_0021755 3300049580 Bacteria 5287
536 Ga0501046_0036502 3300049580 Bacteria 3954
537 Ga0501046_0086177 3300049580 Bacteria 2421
538 Ga0501047_0005742 3300049581 Bacteria 11678
539 Ga0501047_0007175 3300049581 Bacteria 10472
540 Ga0501047_0078496 3300049581 Bacteria 3174
541 Ga0501048_0010716 3300049582 Bacteria 6836
542 Ga0501048_0054800 3300049582 Bacteria 2832
543 Ga0501067_0044131 3300049583 Bacteria 2477
544 Ga0501067_0061009 3300049583 Bacteria 2087
545 Ga0501068_0039125 3300049584 Bacteria 2843
546 Ga0501068_0090295 3300049584 Unclassified 1890
547 Ga0501069_0055440 3300049585 Bacteria 2208
548 Ga0501070_0043583 3300049586 Bacteria 3733
549 Ga0501073_0045341 3300049589 Bacteria 3096
550 Ga0501073_0056619 3300049589 Bacteria 2742
551 Ga0501073_0123108 3300049589 Bacteria 1797
552 Ga0501074_0002731 3300049590 Bacteria 12345
553 Ga0501074_0050006 3300049590 Bacteria 3017
554 Ga0501075_0023236 3300049591 Bacteria 4538
555 Ga0501076_0018898 3300049592 Bacteria 5259
556 Ga0501076_0049027 3300049592 Bacteria 3339
557 Ga0501079_0051743 3300049741 Bacteria 3171
558 Ga0501080_0002233 3300049742 Bacteria 16834
559 Ga0501080_0064448 3300049742 Bacteria 3408
560 Ga0501083_0012946 3300049744 Bacteria 5828
561 Ga0501083_0037541 3300049744 Bacteria 3299
562 Ga0501035_0024564 3300049822 Bacteria 5526
563 Ga0501035_0028614 3300049822 Bacteria 5086
564 Ga0501035_0035372 3300049822 Bacteria 4533
565 Ga0501045_0008793 3300049824 Bacteria 7050
566 nmdc:mga00v17_3718_c1 3300050491 Bacteria 6905
567 nmdc:mga0k408_25951_c1 3300050493 Bacteria 3320
568 nmdc:mga0k408_52591_c1 3300050493 Bacteria 2361
569 nmdc:mga07m45_23207_c1 3300050496 Bacteria 3390
570 nmdc:mga05p37_109018_c1 3300050507 Bacteria 3406
571 nmdc:mga05p37_113969_c1 3300050507 Bacteria 3324
572 nmdc:mga05p37_128959_c1 3300050507 Bacteria 3105
573 nmdc:mga05p37_13135_c1 3300050507 Bacteria 9915
574 nmdc:mga05p37_1400_c1 3300050507 Bacteria 28057
575 nmdc:mga05p37_15065_c1 3300050507 Bacteria 9283
576 nmdc:mga05p37_177139_c1 3300050507 Bacteria 2597
577 nmdc:mga09592_18118_c1 3300050508 Bacteria 5774
578 nmdc:mga09592_7980_c1 3300050508 Bacteria 8604
579 nmdc:mga0qj67_14073_c1 3300050509 Bacteria 6041
580 nmdc:mga0qj67_158099_c1 3300050509 Bacteria 1840
581 nmdc:mga0qj67_98412_c1 3300050509 Bacteria 2356
582 nmdc:mga06r32_141433_c1 3300050510 Unclassified 2383
583 nmdc:mga06r32_334208_c1 3300050510 Bacteria 1500
584 nmdc:mga08y16_73906_c1 3300050511 Bacteria 3552
585 nmdc:mga08y16_94256_c1 3300050511 Bacteria 3119
586 nmdc:mga0n895_15016_c1 3300050512 Bacteria 7056
587 nmdc:mga0n895_214561_c1 3300050512 Bacteria 1954
588 nmdc:mga0n895_29457_c1 3300050512 Bacteria 5237
589 nmdc:mga0n895_34276_c1 3300050512 Bacteria 4885
590 nmdc:mga0n895_755_c1 3300050512 Bacteria 22891
591 nmdc:mga0n895_863_c1 3300050512 Bacteria 21786
592 nmdc:mga0rr50_162890_c1 3300050513 Bacteria 1812
593 nmdc:mga0rr50_2897_c1 3300050513 Bacteria 9784
594 nmdc:mga0rr50_3628_c1 3300050513 Bacteria 8927
595 nmdc:mga08x19_2461_c2 3300050514 Bacteria 8409
596 nmdc:mga0a205_165095_c1 3300050515 Bacteria 2110
597 nmdc:mga0a205_449_c1 3300050515 Bacteria 31835
598 nmdc:mga0a205_49374_c1 3300050515 Bacteria 4062
599 nmdc:mga0a205_60533_c1 3300050515 Bacteria 3657
600 Ga0495601_0003529 3300053077 Bacteria 8994
601 Ga0495601_0039122 3300053077 Bacteria 2969
602 Ga0495601_0049019 3300053077 Bacteria 2662
603 Ga0495601_0059175 3300053077 Bacteria 2429
604 Ga0500555_000332 3300053103 Bacteria 20321
605 Ga0500555_000547 3300053103 Bacteria 14981
606 Ga0500616_0000167 3300053153 Bacteria 109823
607 Ga0500616_0000590 3300053153 Bacteria 44122
608 Ga0500645_000092 3300053730 Bacteria 69820
609 Ga0500645_000331 3300053730 Bacteria 33681
610 Ga0501084_0027692 3300054114 Bacteria 4735
611 Ga0501084_0192290 3300054114 Bacteria 1722
612 Ga0501082_0021762 3300060353 Bacteria 5528
613 Ga0501082_0035960 3300060353 Bacteria 4267
614 Ga0501082_0145196 3300060353 Bacteria 2059
615 Ga0530510_0110088 3300061734 Bacteria 2017
616 Ga0530510_0190909 3300061734 Bacteria 1521
617 2739730054 2739367700 Bacteria 4747630
618 2928965748 2928963466 Bacteria 5165703
619 Ga0070706_100136047
620 JGI25162J39368_1000128
621 JGI25162J39368_1001176
622 JGI25157J39369_1000211
623 JGI25163J39215_1000200
624 JGI25163J39215_1001338
625 JGI25164J39214_1000067
626 JGI25165J46597_1000167
627 Ga0055538_1000516
628 Ga0055535_1000074
629 Ga0055542_1000206
630 Ga0055542_1000234
631 Ga0055529_1000024
632 Ga0055529_1000121
633 JGI25405J52794_10008510
634 Ga0058861_11640852
635 Ga0065715_10105847
636 Ga0070683_100000143
637 Ga0070683_100000220
638 Ga0070683_100005639
639 Ga0070683_100026423
640 Ga0070683_100115491
641 Ga0070670_100000972
642 Ga0070670_100089350
643 Ga0068869_100026825
644 Ga0070666_10020079
645 Ga0068868_100046836
646 Ga0068868_100214099
647 Ga0070689_100003398
648 Ga0070689_100005894
649 Ga0070691_10048834
650 Ga0070661_100000234
651 Ga0070661_100063920
652 Ga0070668_100006458
653 Ga0070669_100051261
654 Ga0070675_100007961
655 Ga0070671_100004457
656 Ga0070671_100062557
657 Ga0070671_100099243
658 Ga0070674_100004308
659 Ga0070673_100001149
660 Ga0070673_100004449
661 Ga0070673_100006426
662 Ga0070688_100021948
663 Ga0070667_100009506
664 Ga0070667_100012251
665 Ga0070667_100055953
666 Ga0070667_100160608
667 Ga0070667_100245313
668 Ga0070709_10025690
669 Ga0070709_10062035
670 Ga0070714_100000383
671 Ga0070714_100001461
672 Ga0070714_100030653
673 Ga0070714_100116363
674 Ga0070713_100027183
675 Ga0070713_100064738
676 Ga0070713_100128805
677 Ga0070711_100000026
678 Ga0070711_100056848
679 Ga0070711_100124799
680 Ga0070705_100066413
681 Ga0070700_100076592
682 Ga0070694_100034789
683 Ga0070708_100001652
684 Ga0070708_100009863
685 Ga0070708_100015699
686 Ga0070708_100031701
687 Ga0070708_100045550
688 Ga0070708_100053282
689 Ga0070663_100000408
690 Ga0070663_100014026
691 Ga0070678_100020767
692 Ga0070681_10000040
693 Ga0068867_100089249
694 Ga0070685_10080636
695 Ga0070706_100005515
696 Ga0070706_100015004
697 Ga0070706_100022703
698 Ga0070706_100025991
699 Ga0070706_100081970
700 Ga0070707_100000274
701 Ga0070707_100001189
702 Ga0070707_100007926
703 Ga0070707_100021662
704 Ga0070707_100028942
705 Ga0070707_100035708
706 Ga0070698_100001736
707 Ga0070698_100004837
708 Ga0070698_100005889
709 Ga0070698_100049157
710 Ga0070698_100125256
711 Ga0070699_100000340
712 Ga0070699_100010464
713 Ga0070699_100101875
714 Ga0070699_100130055
715 Ga0070699_100294297
716 Ga0070679_100006419
717 Ga0070684_100000160
718 Ga0070684_100000182
719 Ga0070684_100015303
720 Ga0070697_100000045
721 Ga0070697_100001897
722 Ga0070697_100001951
723 Ga0070697_100004850
724 Ga0070697_100006853
725 Ga0070697_100025873
726 Ga0070697_100066734
727 Ga0070697_100088138
728 Ga0070697_100155990
729 Ga0068853_100013827
730 Ga0070672_100001716
731 Ga0070672_100003685
732 Ga0070672_100016576
733 Ga0070672_100023172
734 Ga0070672_100053664
735 Ga0070672_100156575
736 Ga0070695_100002697
737 Ga0070695_100111260
738 Ga0070696_100127949
739 Ga0070693_100005047
740 Ga0070665_100000734
741 Ga0070665_100001926
742 Ga0070665_100002722
743 Ga0070665_100076068
744 Ga0070665_100218671
745 Ga0070704_100004872
746 Ga0070704_100076574
747 Ga0070704_100093090
748 Ga0070704_100170820
749 Ga0068855_100000096
750 Ga0070664_100000167
751 Ga0070664_100000620
752 Ga0070664_100016720
753 Ga0068857_100000125
754 Ga0068857_100008749
755 Ga0068854_100038799
756 Ga0068854_100145637
757 Ga0068856_100003482
758 Ga0068859_100001693
759 Ga0068859_100006073
760 Ga0068859_100169337
761 Ga0068859_100204974
762 Ga0068864_100000279
763 Ga0068864_100034752
764 Ga0068864_100091196
765 Ga0068866_10007755
766 Ga0068861_100155450
767 Ga0068863_100001947
768 Ga0068863_100007533
769 Ga0068863_100012882
770 Ga0068858_100020187
771 Ga0068858_100152627
772 Ga0068858_100161870
773 Ga0068858_100176517
774 Ga0068860_100004356
775 Ga0068860_100032463
776 Ga0068860_100131542
777 Ga0068860_100314288
778 Ga0068862_100003738
779 Ga0068862_100074968
780 Ga0081455_10002001
781 Ga0081455_10008910
782 Ga0081455_10010810
783 Ga0081538_10005759
784 Ga0081538_10042632
785 Ga0081539_10016496
786 Ga0070717_10007895
787 Ga0070717_10018326
788 Ga0070717_10027707
789 Ga0070717_10030976
790 Ga0070717_10134476
791 Ga0070717_10178085
792 Ga0075368_10025470
793 Ga0075364_10003231
794 Ga0070712_100006132
795 Ga0075367_10021051
796 Ga0075366_10015720
797 Ga0097621_100000301
798 Ga0097621_100004998
799 Ga0097621_100005937
800 Ga0068871_100000026
801 Ga0068871_100007939
802 Ga0075428_100002023
803 Ga0075428_100027619
804 Ga0075428_100067834
805 Ga0075428_100084289
806 Ga0075428_100189977
807 Ga0075430_100002944
808 Ga0075430_100086787
809 Ga0075431_100107966
810 Ga0075431_100123417
811 Ga0075431_100222910
812 Ga0075433_10000750
813 Ga0075433_10001290
814 Ga0075433_10005934
815 Ga0075433_10094948
816 Ga0075434_100000235
817 Ga0075434_100001017
818 Ga0075434_100018769
819 Ga0075434_100227661
820 Ga0075434_100232804
821 Ga0075429_100010584
822 Ga0075429_100048204
823 Ga0075429_100171138
824 Ga0068865_100029696
825 Ga0068865_100117707
826 Ga0075436_100001682
827 Ga0075436_100023661
828 Ga0097620_100001693
829 Ga0097620_100006073
830 Ga0097620_100169336
831 Ga0097620_100204968
832 Ga0075435_100000452
833 Ga0075435_100000913
834 Ga0075435_100017459
835 Ga0105240_10000820
836 Ga0105240_10015398
837 Ga0105240_10052578
838 Ga0111539_10137608
839 Ga0111539_10149258
840 Ga0111539_10216146
841 Ga0111539_10216652
842 Ga0105245_10001771
843 Ga0105245_10017902
844 Ga0105245_10191177
845 Ga0105247_10063331
846 Ga0114129_10001204
847 Ga0114129_10002242
848 Ga0114129_10038983
849 Ga0114129_10080587
850 Ga0114129_10134928
851 Ga0114129_10138739
852 Ga0114129_10143333
853 Ga0114129_10230398
854 Ga0114129_10304527
855 Ga0105242_10018683
856 Ga0105242_10032235
857 Ga0105242_10035862
858 Ga0105242_10102011
859 Ga0105248_10003003
860 Ga0105248_10006995
861 Ga0105248_10009394
862 Ga0105248_10036582
863 Ga0105248_10082000
864 Ga0105248_10160000
865 Ga0105248_10429214
866 Ga0105238_10000548
867 Ga0105238_10047273
868 Ga0105238_10109773
869 Ga0105249_10093537
870 Ga0105239_10039491
871 Ga0105239_10350360
872 Ga0157371_10132784
873 Ga0157370_10074852
874 Ga0157369_10000041
875 Ga0157374_10000078
876 Ga0157374_10001634
877 Ga0157374_10149582
878 Ga0157378_10001275
879 Ga0157378_10004118
880 Ga0157378_10014844
881 Ga0163162_10005538
882 Ga0163162_10010864
883 Ga0163162_10160217
884 Ga0157372_10002437
885 Ga0157372_10005509
886 Ga0157375_10001114
887 Ga0157375_10009404
888 Ga0157375_10149763
889 Ga0163163_10000331
890 Ga0163163_10016677
891 Ga0163163_10074280
892 Ga0163163_10089395
893 Ga0163163_10272376
894 Ga0157380_10026440
895 Ga0157380_10090002
896 Ga0157380_10224577
897 Ga0157377_10006200
898 Ga0157379_10000724
899 Ga0157379_10015700
900 Ga0157376_10001052
901 Ga0157376_10062359
902 Ga0163161_10005720
903 Ga0163161_10085781
904 Ga0206352_10240259
905 Ga0206352_11333410
906 Ga0206350_11529353
907 Ga0224712_10002894
908 Ga0209760_100141
909 Ga0209784_100011
910 Ga0209672_100261
911 Ga0207427_100026
912 Ga0207427_101003
913 Ga0209437_100202
914 Ga0209437_100217
915 Ga0209258_100027
916 Ga0209258_102798
917 Ga0209646_1000336
918 Ga0209026_1000018
919 Ga0209148_1000001
920 Ga0209148_1000005
921 Ga0209759_1000066
922 Ga0209233_1000002
923 Ga0209455_1000019
924 Ga0207697_10002151
925 Ga0207653_10020498
926 Ga0207642_10010531
927 Ga0207710_10040663
928 Ga0207688_10012322
929 Ga0207699_10056729
930 Ga0207684_10002967
931 Ga0207684_10003814
932 Ga0207684_10013800
933 Ga0207684_10023532
934 Ga0207684_10211338
935 Ga0207707_10000194
936 Ga0207695_10030006
937 Ga0207693_10005450
938 Ga0207663_10058077
939 Ga0207657_10115716
940 Ga0207649_10000108
941 Ga0207652_10024558
942 Ga0207646_10000016
943 Ga0207646_10000335
944 Ga0207646_10002569
945 Ga0207646_10004403
946 Ga0207646_10020331
947 Ga0207646_10040771
948 Ga0207646_10123518
949 Ga0207681_10039774
950 Ga0207694_10001056
951 Ga0207694_10094167
952 Ga0207650_10000333
953 Ga0207659_10001340
954 Ga0207659_10003444
955 Ga0207659_10077299
956 Ga0207659_10101459
957 Ga0207687_10036946
958 Ga0207687_10048410
959 Ga0207700_10002445
960 Ga0207700_10021583
961 Ga0207664_10002981
962 Ga0207664_10003389
963 Ga0207664_10188661
964 Ga0207644_10026662
965 Ga0207644_10156734
966 Ga0207706_10001028
967 Ga0207706_10055322
968 Ga0207670_10000990
969 Ga0207670_10007523
970 Ga0207669_10016842
971 Ga0207669_10074988
972 Ga0207704_10015597
973 Ga0207665_10084589
974 Ga0207691_10002492
975 Ga0207691_10004264
976 Ga0207691_10028144
977 Ga0207691_10052616
978 Ga0207691_10094590
979 Ga0207711_10014458
980 Ga0207711_10014880
981 Ga0207711_10022583
982 Ga0207711_10047537
983 Ga0207711_10055795
984 Ga0207689_10001315
985 Ga0207661_10000383
986 Ga0207661_10002659
987 Ga0207661_10064106
988 Ga0207679_10000144
989 Ga0207679_10002530
990 Ga0207679_10045970
991 Ga0207667_10004696
992 Ga0207651_10001698
993 Ga0207651_10008303
994 Ga0207651_10029259
995 Ga0207651_10208640
996 Ga0207668_10107730
997 Ga0207658_10008251
998 Ga0207658_10019734
999 Ga0207658_10035674
1000 Ga0207658_10061328
1001 Ga0207703_10015707
1002 Ga0207703_10044380
1003 Ga0207703_10140524
1004 Ga0207639_10044711
1005 Ga0207678_10000287
1006 Ga0207678_10109839
1007 Ga0207708_10036263
1008 Ga0207702_10000275
1009 Ga0207702_10015385
1010 Ga0207641_10000375
1011 Ga0207641_10003732
1012 Ga0207648_10029646
1013 Ga0207648_10035374
1014 Ga0207676_10000177
1015 Ga0207676_10026068
1016 Ga0207676_10031199
1017 Ga0207674_10003119
1018 Ga0207674_10039957
1019 Ga0207675_100118448
1020 Ga0207683_10000986
1021 Ga0207683_10011183
1022 Ga0207683_10137484
1023 Ga0207428_10024561
1024 Ga0207428_10058563
1025 Ga0268266_10002594
1026 Ga0268266_10008071
1027 Ga0268266_10013775
1028 Ga0268266_10045651
1029 Ga0268265_10001584
1030 Ga0268264_10023654
1031 Ga0268264_10052506
1032 Ga0268264_10166832
1033 Ga0265760_10000025
1034 Ga0373934_0000563
1035 Ga0373923_0001500
1036 Ga0373954_0017599
1037 Ga0373954_0068771
1038 Ga0373943_0003287
1039 Ga0373955_0006748
1040 Ga0373935_0025603
1041 Ga0373927_0003343
1042 Ga0373927_0007323
1043 Ga0373933_0001011
1044 Ga0373947_0003851
1045 Ga0373937_0002596
1046 Ga0373937_0129160
1047 Ga0373925_0002846
1048 Ga0373925_0131752
1049 Ga0395900_0252419
1050 Ga0395905_0005346
1051 Ga0395905_0006549
1052 Ga0436363_1330608
1053 Ga0436363_1550405
1054 Ga0450908_011193
1055 Ga0439460_0020902
1056 Ga0453683_0015215
1057 Ga0466957_0086600
1058 Ga0451576_0274352
1059 Ga0466967_0001387
1060 Ga0495638_0000100
1061 Ga0495638_0000322
1062 Ga0495638_0000497
1063 Ga0495651_0002157
1064 Ga0495651_0034780
1065 Ga0495651_0186824
1066 Ga0495653_0003589
1067 Ga0495650_0000064
1068 Ga0495580_0023348
1069 Ga0495580_0204511
1070 Ga0495664_0000934
1071 Ga0495606_0000016
1072 Ga0495608_0022403
1073 Ga0495643_0001973
1074 Ga0495652_0003580
1075 Ga0495665_0099925
1076 Ga0495587_0000925
1077 Ga0495645_0001037
1078 Ga0495622_0020005
1079 Ga0495667_0036703
1080 Ga0495657_0088394
1081 Ga0495599_0009443
1082 Ga0495623_0004525
1083 Ga0495658_0014310
1084 Ga0495669_0005987
1085 Ga0495649_0000560
1086 Ga0495649_0012441
1087 Ga0495672_0020918
1088 Ga0495680_0070430
1089 Ga0495675_0000752
1090 Ga0495684_0005970
1091 Ga0495593_0144305
1092 Ga0495602_0004317
1093 Ga0495602_0116154
1094 Ga0495602_0207499
1095 Ga0496100_0003050
1096 Ga0496100_0098728
1097 Ga0496101_0000139
1098 Ga0496102_0038807
1099 Ga0496102_0046811
1100 Ga0496104_0004150
1101 Ga0496104_0004311
1102 Ga0496104_0254354
1103 Ga0496105_0027545
1104 Ga0496105_0038508
1105 Ga0496105_0177197
1106 Ga0496106_0006560
1107 Ga0496106_0101101
1108 Ga0496108_0000308
1109 Ga0496108_0016439
1110 Ga0496109_0000311
1111 Ga0496109_0040282
1112 Ga0496110_0001625
1113 Ga0496110_0118887
1114 Ga0496110_0119846
1115 Ga0496111_0027177
1116 Ga0496111_0052548
1117 Ga0496112_0000135
1118 Ga0496112_0000268
1119 Ga0496112_0000895
1120 Ga0496112_0056387
1121 Ga0496112_0060142
1122 Ga0496112_0142914
1123 Ga0496113_0000131
1124 Ga0496113_0001699
1125 Ga0496114_0000577
1126 Ga0496114_0044494
1127 Ga0496114_0119435
1128 Ga0496115_0004221
1129 Ga0496115_0011685
1130 Ga0496115_0083131
1131 Ga0496115_0095496
1132 Ga0501032_0002080
1133 Ga0501033_0004640
1134 Ga0501033_0013764
1135 Ga0501033_0188278
1136 Ga0501034_0020247
1137 Ga0501034_0100384
1138 Ga0501034_0112428
1139 Ga0501036_0042489
1140 Ga0501036_0065181
1141 Ga0501037_0013387
1142 Ga0501038_0005510
1143 Ga0501038_0012667
1144 Ga0501038_0024768
1145 Ga0501038_0036687
1146 Ga0501039_0016932
1147 Ga0501039_0041518
1148 Ga0501040_0086250
1149 Ga0501043_0016936
1150 Ga0501043_0027292
1151 Ga0501043_0088461
1152 Ga0501046_0005966
1153 Ga0501046_0021755
1154 Ga0501046_0036502
1155 Ga0501046_0086177
1156 Ga0501047_0005742
1157 Ga0501047_0007175
1158 Ga0501047_0078496
1159 Ga0501048_0010716
1160 Ga0501048_0054800
1161 Ga0501067_0044131
1162 Ga0501067_0061009
1163 Ga0501068_0039125
1164 Ga0501068_0090295
1165 Ga0501069_0055440
1166 Ga0501070_0043583
1167 Ga0501073_0045341
1168 Ga0501073_0056619
1169 Ga0501073_0123108
1170 Ga0501074_0002731
1171 Ga0501074_0050006
1172 Ga0501075_0023236
1173 Ga0501076_0018898
1174 Ga0501076_0049027
1175 Ga0501079_0051743
1176 Ga0501080_0002233
1177 Ga0501080_0064448
1178 Ga0501083_0012946
1179 Ga0501083_0037541
1180 Ga0501035_0024564
1181 Ga0501035_0028614
1182 Ga0501035_0035372
1183 Ga0501045_0008793
1184 nmdc:mga00v17_3718_c1
1185 nmdc:mga0k408_25951_c1
1186 nmdc:mga0k408_52591_c1
1187 nmdc:mga07m45_23207_c1
1188 nmdc:mga05p37_109018_c1
1189 nmdc:mga05p37_113969_c1
1190 nmdc:mga05p37_128959_c1
1191 nmdc:mga05p37_13135_c1
1192 nmdc:mga05p37_1400_c1
1193 nmdc:mga05p37_15065_c1
1194 nmdc:mga05p37_177139_c1
1195 nmdc:mga09592_18118_c1
1196 nmdc:mga09592_7980_c1
1197 nmdc:mga0qj67_14073_c1
1198 nmdc:mga0qj67_158099_c1
1199 nmdc:mga0qj67_98412_c1
1200 nmdc:mga06r32_141433_c1
1201 nmdc:mga06r32_334208_c1
1202 nmdc:mga08y16_73906_c1
1203 nmdc:mga08y16_94256_c1
1204 nmdc:mga0n895_15016_c1
1205 nmdc:mga0n895_214561_c1
1206 nmdc:mga0n895_29457_c1
1207 nmdc:mga0n895_34276_c1
1208 nmdc:mga0n895_755_c1
1209 nmdc:mga0n895_863_c1
1210 nmdc:mga0rr50_162890_c1
1211 nmdc:mga0rr50_2897_c1
1212 nmdc:mga0rr50_3628_c1
1213 nmdc:mga08x19_2461_c2
1214 nmdc:mga0a205_165095_c1
1215 nmdc:mga0a205_449_c1
1216 nmdc:mga0a205_49374_c1
1217 nmdc:mga0a205_60533_c1
1218 Ga0495601_0003529
1219 Ga0495601_0039122
1220 Ga0495601_0049019
1221 Ga0495601_0059175
1222 Ga0500555_000332
1223 Ga0500555_000547
1224 Ga0500616_0000167
1225 Ga0500616_0000590
1226 Ga0500645_000092
1227 Ga0500645_000331
1228 Ga0501084_0027692
1229 Ga0501084_0192290
1230 Ga0501082_0021762
1231 Ga0501082_0035960
1232 Ga0501082_0145196
1233 Ga0530510_0110088
1234 Ga0530510_0190909
1235 2739730054
1236 2928965748

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02321

OEP

Outer membrane efflux protein

100

287

0.96

PF02321

OEP

Outer membrane efflux protein

309

493

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nik-assembly1.cif.gz_D structure of the macab-tolc abc-type tripartite multidrug efflux pump 0.9322 186 266
1wp1-assembly2.cif.gz_B crystal structure of the drug-discharge outer membrane protein, oprm 0.886 22 480
1wp1-assembly2.cif.gz_B crystal structure of the drug-discharge outer membrane protein, oprm 0.8632 22 480
5azs-assembly1.cif.gz_B crystal structure of a membrane protein from pseudomonas aeruginosa 0.8325 18 476
5azs-assembly1.cif.gz_A crystal structure of a membrane protein from pseudomonas aeruginosa 0.8323 18 476
ID Description Score Start End Superfamily
3fppA03 Special;Helix non-globular;Helix Hairpins; 0.9563 186 266 6.10.140.1990
5azsA01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.9417 18 476 1.20.1600.10
5azsA01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.9391 18 476 1.20.1600.10
4k7rA01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.9301 21 478 1.20.1600.10
1yc9A01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.9245 57 478 1.20.1600.10
ID Description Score Start End GO Terms
AF-A0A3D5IWQ2-F1-model_v4 Transporter 0.8718 362 477 GO:0009279
GO:0015288
GO:0015562
GO:1990281
AF-A0A2D7LAP5-F1-model_v4 deleted 0.8634 169 478
AF-A0A843MXG1-F1-model_v4 deleted 0.8594 153 479
AF-A0A149VEM4-F1-model_v4 Secretion protein 0.851 153 480 GO:0005886
GO:0015562
AF-A0A2D7LAP5-F1-model_v4 deleted 0.8452 169 478

Map