F469723

General Info

Members Datasets Scaffolds Average Seq Length
618 210 1236 748

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10001000|Ga0105251_100010003
Length 839
Sequence MYPPAFVAWVGFAWYQRCRGTFHAASAFVALYVEMTRRLARHVEITGLGRDASHDAPPASLLNPQPIYDSKTVDSMNRRNRNTRTGMDKTSTAAITGSDMHDASIDAQCAREPIHIPGGIQPHGVLFGVDAHCHIVQVSANVAQFAHVAPDACLGRALSAVLGQPAAERASAGLAXLTHGPVAIVVHRHEGLLFVEVEPAQDTADVFSTIYPLVRSFVTDVQSMRTIEQLCQFAADEIARITGFGRTLVYRFDEEGNGNVLAEAVEPGYPSYLNQHFPASDIPAQARELYRKNRIRLISNADYEAAPLVPALHPATGRPTDLTYASLRSVSPVHLQYMRNMGTLASMSMSILVDDKLWGLISCHHATPRLPPFEVRTACEHVAQIVSLQIEARESQGEAHYRLEDASDLLGFTRSSGAAVIFEGRTSLVGLTPGEHGVTALVDWLDDQSEDVVMSDRASQECPALADSPDVAGFLAVSISKIYRNYVIWFRREVVQTIEWAGDPRAKLTGLADSLSPRVSFDTWTDVVRHRSLPWRAAEREIALEFRAAVLGIVLRRAEEIAQLATELGRANHELEGFSYTVSHDLRAPLRHIVSFADLLKQMDGDKLSERGRGYLERIVTSARFGGRLVDDLLSFAQLGRAALRPHKVDVYALVHTVIQNDIDEHASARVRWKVDALPSIEGDLVFLHVAFANIMSNAVKFSAQREQPAIEIGAYEGTGELIGHVVYFVRDNGAGFDMRYVDKLFGVFQRLHVNEKFDGTGIGLANVRRIIERHGGKAWAEGTPDRGATFYMALPKQFRPESGVRRDTAATALARLAAGTGGAGHDIDQLIKRSEEKR

Samples

Sample ID Description Type Environment
1 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
16 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
17 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
18 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
19 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
20 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
25 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
26 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
27 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
28 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
31 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
33 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
43 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
47 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
52 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
53 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
54 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
57 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
58 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
59 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
60 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
61 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
62 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
63 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
66 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
67 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
68 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
69 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
73 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
74 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
75 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
76 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
77 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
78 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
79 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
80 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
81 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
82 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
83 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
84 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
85 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
86 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
90 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
91 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
92 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
93 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
94 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
95 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
96 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
104 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
114 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
118 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
133 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
134 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
135 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
140 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
141 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
167 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
172 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
173 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
174 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
175 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
176 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
177 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
178 2643221556 Massilia sp. Root1485 Isolate Unclassified
179 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
180 2643221684 Massilia sp. Root133 Isolate Unclassified
181 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
182 2738541297 Duganella sp. GV083 Isolate Unclassified
183 2738541357 Duganella sp. GV053 Isolate Unclassified
184 2738543003 Duganella sp. GV066 Isolate Unclassified
185 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
186 2738543026 Duganella sp. GV089 Isolate Unclassified
187 2738543029 Duganella sp. GV039 Isolate Unclassified
188 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
189 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
190 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
191 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
192 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
193 2821131069 Duganella sp. 1224 Isolate Unclassified
194 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
195 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
196 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
197 2857553236 Duganella sp. R-74557 Isolate Unclassified
198 2857564685 Duganella sp. R-74599 Isolate Unclassified
199 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
200 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
201 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
202 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
203 2919476304 Duganella sp. 3397 Isolate Unclassified
204 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
205 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
206 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
207 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
208 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
209 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
210 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.85
Metatranscriptomes 0
Isolates 6.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0.97
Rhizoplane 4.69
Rhizosphere 83.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105251_10001000 3300009011 Bacteria 24743
2 JGI24735J21928_10002481 3300002067 Bacteria 6403
3 JGI25156J39149_1000439 3300002705 Bacteria 25558
4 Ga0055525_1000001 3300003759 Bacteria 1016948
5 Ga0055524_1000021 3300003775 Bacteria 227578
6 Ga0055524_1000099 3300003775 Bacteria 107171
7 Ga0058692_1004338 3300003856 Bacteria 4217
8 Ga0065165_1000723 3300005262 Bacteria 46190
9 Ga0065714_10066246 3300005288 Bacteria 7283
10 Ga0070658_10063937 3300005327 Bacteria 3001
11 Ga0070680_100000360 3300005336 Bacteria 30651
12 Ga0070660_100000463 3300005339 Bacteria 26996
13 Ga0070661_100000011 3300005344 Bacteria 175355
14 Ga0070678_100037543 3300005456 Bacteria 3403
15 Ga0070679_100000008 3300005530 Bacteria 194672
16 Ga0079104_1005968 3300006946 Bacteria 4723
17 Ga0099826_10000002 3300006948 Bacteria 1125830
18 Ga0105251_10000001 3300009011 Bacteria 466643
19 Ga0105251_10000244 3300009011 Bacteria 54761
20 Ga0105251_10000739 3300009011 Bacteria 29954
21 Ga0105250_10000082 3300009092 Bacteria 82954
22 Ga0105241_10006969 3300009174 Bacteria 8314
23 Ga0157373_10007570 3300013100 Bacteria 8071
24 Ga0157371_10000001 3300013102 Bacteria 1162285
25 Ga0157371_10000086 3300013102 Bacteria 146397
26 Ga0157371_10000157 3300013102 Bacteria 99794
27 Ga0157370_10002669 3300013104 Bacteria 21392
28 Ga0163162_10001130 3300013306 Bacteria 24846
29 Ga0182008_10013217 3300014497 Bacteria 4341
30 Ga0182006_1000044 3300015261 Bacteria 197442
31 Ga0182005_1000018 3300015265 Bacteria 324307
32 Ga0183361_10021 3300016635 Bacteria 114065
33 Ga0163161_10009376 3300017792 Bacteria 6776
34 Ga0209563_100007 3300025230 Bacteria 1579402
35 Ga0209148_1000575 3300025254 Bacteria 34103
36 Ga0209759_1000250 3300025256 Bacteria 80232
37 Ga0209256_1000044 3300025299 Bacteria 337264
38 Ga0207426_1004702 3300025302 Bacteria 6534
39 Ga0207696_1000219 3300025711 Bacteria 83088
40 Ga0207655_1005775 3300025728 Bacteria 8336
41 Ga0207713_1000071 3300025735 Bacteria 186255
42 Ga0207713_1000107 3300025735 Bacteria 137841
43 Ga0207713_1002426 3300025735 Bacteria 13600
44 Ga0207713_1022304 3300025735 Bacteria 3009
45 Ga0207660_10001011 3300025917 Bacteria 18633
46 Ga0207657_10012351 3300025919 Bacteria 8435
47 Ga0207649_10000038 3300025920 Bacteria 129260
48 Ga0207652_10000008 3300025921 Bacteria 286698
49 Ga0207690_10033263 3300025932 Bacteria 3314
50 Ga0207683_10039493 3300026121 Bacteria 4118
51 Ga0209281_1004893 3300027111 Bacteria 3866
52 Ga0209371_1000032 3300027312 Bacteria 392355
53 Ga0209996_1001002 3300027395 Bacteria 3351
54 Ga0209982_1001160 3300027552 Bacteria 3541
55 Ga0209282_1000001 3300027666 Bacteria 2450367
56 Ga0209971_1002107 3300027682 Bacteria 4843
57 Ga0316177_1196908 3300030731 Bacteria 7020
58 Ga0395900_0000404 3300037418 Bacteria 62102
59 Ga0395900_0000695 3300037418 Bacteria 44888
60 Ga0395900_0004023 3300037418 Bacteria 15689
61 Ga0395900_0065514 3300037418 Bacteria 3732
62 Ga0395898_0089011 3300037466 Bacteria 2971
63 Ga0395905_0000009 3300037471 Bacteria 488729
64 Ga0395905_0011175 3300037471 Bacteria 8679
65 Ga0395901_0000491 3300038443 Bacteria 45939
66 Ga0395901_0003247 3300038443 Bacteria 16359
67 Ga0439448_0002711 3300042005 Bacteria 4841
68 Ga0439464_0007016 3300042439 Bacteria 2943
69 Ga0466972_0019768 3300044658 Bacteria 3367
70 Ga0466965_0005219 3300044683 Bacteria 5839
71 Ga0466966_0053248 3300044684 Bacteria 2567
72 Ga0466964_0003568 3300044706 Bacteria 5685
73 Ga0466968_0000683 3300044735 Bacteria 11685
74 Ga0466970_0024152 3300044765 Bacteria 3178
75 Ga0466957_0000089 3300044842 Bacteria 36497
76 Ga0466959_0003194 3300045049 Bacteria 10649
77 Ga0466959_0009528 3300045049 Bacteria 6910
78 Ga0466958_0000236 3300045836 Bacteria 21167
79 Ga0466967_0011636 3300045976 Bacteria 6682
80 Ga0495617_000007 3300046452 Bacteria 369986
81 Ga0495617_000070 3300046452 Bacteria 84436
82 Ga0495617_002457 3300046452 Bacteria 7364
83 Ga0495627_000006 3300046453 Bacteria 581750
84 Ga0495627_000050 3300046453 Bacteria 162327
85 Ga0495627_000054 3300046453 Bacteria 151899
86 Ga0495627_000201 3300046453 Bacteria 65296
87 Ga0495627_005149 3300046453 Bacteria 5327
88 Ga0495627_007850 3300046453 Bacteria 4054
89 Ga0495603_0042882 3300046455 Bacteria 2703
90 Ga0495590_0000060 3300046457 Bacteria 89639
91 Ga0495590_0000932 3300046457 Bacteria 12972
92 Ga0495590_0000949 3300046457 Bacteria 12812
93 Ga0495590_0004205 3300046457 Bacteria 5821
94 Ga0495590_0012307 3300046457 Bacteria 3177
95 Ga0495591_000002 3300046458 Bacteria 455013
96 Ga0495591_000156 3300046458 Bacteria 72588
97 Ga0495591_000190 3300046458 Bacteria 63717
98 Ga0495591_000217 3300046458 Bacteria 57816
99 Ga0495591_000954 3300046458 Bacteria 19774
100 Ga0495591_003889 3300046458 Bacteria 7530
101 Ga0495629_0000334 3300046459 Bacteria 40256
102 Ga0495629_0036480 3300046459 Bacteria 3469
103 Ga0495629_0048153 3300046459 Bacteria 2989
104 Ga0495629_0052084 3300046459 Bacteria 2864
105 Ga0495638_0001947 3300046460 Bacteria 17708
106 Ga0495638_0004134 3300046460 Bacteria 11100
107 Ga0495638_0010808 3300046460 Bacteria 6313
108 Ga0495638_0024774 3300046460 Bacteria 3906
109 Ga0495653_0000073 3300046463 Bacteria 84617
110 Ga0495653_0000124 3300046463 Bacteria 65049
111 Ga0495653_0011015 3300046463 Bacteria 7394
112 Ga0495653_0013782 3300046463 Bacteria 6588
113 Ga0495653_0026981 3300046463 Bacteria 4600
114 Ga0495653_0058963 3300046463 Bacteria 2916
115 Ga0495650_0000048 3300046471 Bacteria 334427
116 Ga0495650_0000534 3300046471 Bacteria 54800
117 Ga0495650_0000611 3300046471 Bacteria 48647
118 Ga0495650_0000649 3300046471 Bacteria 45800
119 Ga0495650_0000939 3300046471 Bacteria 33805
120 Ga0495650_0000999 3300046471 Bacteria 32018
121 Ga0495650_0005410 3300046471 Bacteria 8302
122 Ga0495650_0007818 3300046471 Bacteria 6358
123 Ga0495650_0008894 3300046471 Bacteria 5787
124 Ga0495580_0000760 3300046472 Bacteria 27683
125 Ga0495580_0028197 3300046472 Bacteria 4083
126 Ga0495582_0002717 3300046473 Bacteria 9881
127 Ga0495605_0000002 3300046474 Bacteria 522417
128 Ga0495605_0000066 3300046474 Bacteria 139260
129 Ga0495605_0000154 3300046474 Bacteria 88757
130 Ga0495605_0000161 3300046474 Bacteria 86062
131 Ga0495605_0000550 3300046474 Bacteria 30682
132 Ga0495605_0001113 3300046474 Bacteria 17901
133 Ga0495605_0002075 3300046474 Bacteria 12634
134 Ga0495605_0005360 3300046474 Bacteria 7475
135 Ga0495605_0005464 3300046474 Bacteria 7403
136 Ga0495605_0006659 3300046474 Bacteria 6619
137 Ga0495605_0027512 3300046474 Bacteria 2945
138 Ga0495584_0000275 3300046491 Bacteria 36555
139 Ga0495584_0000479 3300046491 Bacteria 27467
140 Ga0495584_0001475 3300046491 Bacteria 14106
141 Ga0495584_0003036 3300046491 Bacteria 9314
142 Ga0495584_0006780 3300046491 Bacteria 5979
143 Ga0495584_0007255 3300046491 Bacteria 5784
144 Ga0495584_0015960 3300046491 Bacteria 3832
145 Ga0495584_0029691 3300046491 Bacteria 2772
146 Ga0495585_0000122 3300046492 Bacteria 84570
147 Ga0495585_0000215 3300046492 Bacteria 60187
148 Ga0495585_0001183 3300046492 Bacteria 21180
149 Ga0495585_0001430 3300046492 Bacteria 18739
150 Ga0495585_0002329 3300046492 Bacteria 13677
151 Ga0495585_0003354 3300046492 Bacteria 10843
152 Ga0495585_0003989 3300046492 Bacteria 9730
153 Ga0495585_0005312 3300046492 Bacteria 8132
154 Ga0495585_0011299 3300046492 Bacteria 5287
155 Ga0495585_0012231 3300046492 Bacteria 5056
156 Ga0495585_0013364 3300046492 Bacteria 4808
157 Ga0495585_0013704 3300046492 Bacteria 4739
158 Ga0495585_0015507 3300046492 Bacteria 4429
159 Ga0495585_0017291 3300046492 Bacteria 4169
160 Ga0495594_0000417 3300046499 Bacteria 21466
161 Ga0495594_0002989 3300046499 Bacteria 8762
162 Ga0495594_0003795 3300046499 Bacteria 7750
163 Ga0495594_0017180 3300046499 Bacteria 3819
164 Ga0495596_0001326 3300046500 Bacteria 14247
165 Ga0495596_0003138 3300046500 Bacteria 8520
166 Ga0495596_0003580 3300046500 Bacteria 7818
167 Ga0495596_0003855 3300046500 Bacteria 7448
168 Ga0495596_0005899 3300046500 Bacteria 5720
169 Ga0495596_0006665 3300046500 Bacteria 5287
170 Ga0495596_0006886 3300046500 Bacteria 5178
171 Ga0495596_0007586 3300046500 Bacteria 4888
172 Ga0495607_0000045 3300046501 Bacteria 125217
173 Ga0495607_0000085 3300046501 Bacteria 96340
174 Ga0495607_0000245 3300046501 Bacteria 58061
175 Ga0495607_0000311 3300046501 Bacteria 50626
176 Ga0495607_0000619 3300046501 Bacteria 34447
177 Ga0495607_0001872 3300046501 Bacteria 17844
178 Ga0495607_0001900 3300046501 Bacteria 17710
179 Ga0495607_0002110 3300046501 Bacteria 16605
180 Ga0495607_0002316 3300046501 Bacteria 15620
181 Ga0495607_0003938 3300046501 Bacteria 11172
182 Ga0495607_0006661 3300046501 Bacteria 8094
183 Ga0495607_0007985 3300046501 Bacteria 7273
184 Ga0495607_0008671 3300046501 Bacteria 6932
185 Ga0495607_0015018 3300046501 Bacteria 5030
186 Ga0495607_0032990 3300046501 Bacteria 3154
187 Ga0495607_0069702 3300046501 Bacteria 1967
188 Ga0495583_0000012 3300046506 Bacteria 324839
189 Ga0495583_0000295 3300046506 Bacteria 79005
190 Ga0495583_0000339 3300046506 Bacteria 73715
191 Ga0495583_0000754 3300046506 Bacteria 41124
192 Ga0495583_0000791 3300046506 Bacteria 39222
193 Ga0495583_0000810 3300046506 Bacteria 38509
194 Ga0495583_0001302 3300046506 Bacteria 25950
195 Ga0495583_0001736 3300046506 Bacteria 20846
196 Ga0495583_0001877 3300046506 Bacteria 19534
197 Ga0495583_0003406 3300046506 Bacteria 12155
198 Ga0495583_0004079 3300046506 Bacteria 10718
199 Ga0495583_0016728 3300046506 Bacteria 3929
200 Ga0495606_0000028 3300046507 Bacteria 251032
201 Ga0495606_0000084 3300046507 Bacteria 158428
202 Ga0495606_0000146 3300046507 Bacteria 122515
203 Ga0495606_0000184 3300046507 Bacteria 110347
204 Ga0495606_0000291 3300046507 Bacteria 86832
205 Ga0495606_0000768 3300046507 Bacteria 49245
206 Ga0495606_0001412 3300046507 Bacteria 32317
207 Ga0495606_0005294 3300046507 Bacteria 12430
208 Ga0495606_0009751 3300046507 Bacteria 8077
209 Ga0495606_0012748 3300046507 Bacteria 6701
210 Ga0495606_0027199 3300046507 Bacteria 4061
211 Ga0495606_0029102 3300046507 Bacteria 3884
212 Ga0495606_0042633 3300046507 Bacteria 3033
213 Ga0495610_0000004 3300046512 Bacteria 1006135
214 Ga0495610_0001651 3300046512 Bacteria 19626
215 Ga0495610_0002702 3300046512 Bacteria 14622
216 Ga0495610_0005961 3300046512 Bacteria 8531
217 Ga0495610_0010963 3300046512 Bacteria 5583
218 Ga0495616_0000231 3300046513 Bacteria 45493
219 Ga0495616_0000406 3300046513 Bacteria 33248
220 Ga0495616_0001202 3300046513 Bacteria 18277
221 Ga0495616_0007198 3300046513 Bacteria 6669
222 Ga0495616_0008187 3300046513 Bacteria 6210
223 Ga0495616_0009079 3300046513 Bacteria 5833
224 Ga0495616_0010711 3300046513 Bacteria 5292
225 Ga0495616_0020203 3300046513 Bacteria 3627
226 Ga0495616_0020606 3300046513 Bacteria 3583
227 Ga0495620_0000010 3300046515 Bacteria 173604
228 Ga0495620_0000089 3300046515 Bacteria 74701
229 Ga0495620_0001678 3300046515 Bacteria 13056
230 Ga0495628_0002705 3300046516 Bacteria 15870
231 Ga0495630_0028018 3300046517 Bacteria 4185
232 Ga0495631_0000319 3300046518 Bacteria 33378
233 Ga0495631_0001533 3300046518 Bacteria 13901
234 Ga0495631_0001920 3300046518 Bacteria 12223
235 Ga0495631_0004918 3300046518 Bacteria 7041
236 Ga0495631_0011809 3300046518 Bacteria 4284
237 Ga0495631_0013391 3300046518 Bacteria 3982
238 Ga0495632_0000147 3300046519 Bacteria 72673
239 Ga0495632_0000287 3300046519 Bacteria 49069
240 Ga0495632_0000451 3300046519 Bacteria 39172
241 Ga0495632_0000514 3300046519 Bacteria 36429
242 Ga0495632_0002591 3300046519 Bacteria 13630
243 Ga0495632_0006152 3300046519 Bacteria 7775
244 Ga0495632_0007894 3300046519 Bacteria 6613
245 Ga0495632_0032880 3300046519 Bacteria 2668
246 Ga0495637_0000004 3300046520 Bacteria 589740
247 Ga0495637_0000068 3300046520 Bacteria 85556
248 Ga0495637_0000243 3300046520 Bacteria 42642
249 Ga0495637_0000510 3300046520 Bacteria 28210
250 Ga0495637_0002543 3300046520 Bacteria 10042
251 Ga0495637_0011237 3300046520 Bacteria 4307
252 Ga0495637_0017359 3300046520 Bacteria 3355
253 Ga0495643_0000366 3300046522 Bacteria 61541
254 Ga0495643_0000787 3300046522 Bacteria 35192
255 Ga0495643_0001961 3300046522 Bacteria 17285
256 Ga0495643_0006502 3300046522 Bacteria 7691
257 Ga0495643_0008496 3300046522 Bacteria 6493
258 Ga0495643_0011252 3300046522 Bacteria 5462
259 Ga0495643_0013121 3300046522 Bacteria 4974
260 Ga0495644_0001236 3300046523 Bacteria 10460
261 Ga0495644_0001723 3300046523 Bacteria 8846
262 Ga0495644_0006066 3300046523 Bacteria 4706
263 Ga0495644_0008032 3300046523 Bacteria 4057
264 Ga0495644_0009180 3300046523 Bacteria 3810
265 Ga0495648_0000287 3300046524 Bacteria 57221
266 Ga0495648_0000530 3300046524 Bacteria 41137
267 Ga0495648_0002664 3300046524 Bacteria 16151
268 Ga0495648_0006543 3300046524 Bacteria 9485
269 Ga0495648_0007071 3300046524 Bacteria 9043
270 Ga0495648_0008538 3300046524 Bacteria 8047
271 Ga0495648_0010430 3300046524 Bacteria 7077
272 Ga0495648_0016426 3300046524 Bacteria 5339
273 Ga0495648_0018603 3300046524 Bacteria 4911
274 Ga0495648_0018988 3300046524 Bacteria 4849
275 Ga0495666_0002975 3300046526 Bacteria 8498
276 Ga0495666_0003091 3300046526 Bacteria 8361
277 Ga0495666_0013643 3300046526 Bacteria 4052
278 Ga0495666_0020570 3300046526 Bacteria 3268
279 Ga0495642_0000060 3300046528 Bacteria 65690
280 Ga0495642_0000420 3300046528 Bacteria 22511
281 Ga0495642_0000690 3300046528 Bacteria 16756
282 Ga0495642_0002154 3300046528 Bacteria 8117
283 Ga0495642_0004198 3300046528 Bacteria 5607
284 Ga0495642_0004452 3300046528 Bacteria 5435
285 Ga0495642_0010654 3300046528 Bacteria 3520
286 Ga0495642_0013427 3300046528 Bacteria 3167
287 Ga0495652_0008237 3300046529 Bacteria 9529
288 Ga0495652_0036857 3300046529 Bacteria 4247
289 Ga0495654_0000004 3300046530 Bacteria 515304
290 Ga0495654_0000505 3300046530 Bacteria 31841
291 Ga0495654_0000509 3300046530 Bacteria 31668
292 Ga0495654_0005451 3300046530 Bacteria 7386
293 Ga0495654_0008617 3300046530 Bacteria 5623
294 Ga0495654_0023949 3300046530 Bacteria 3159
295 Ga0495665_0000011 3300046531 Bacteria 71017
296 Ga0495665_0000773 3300046531 Bacteria 16656
297 Ga0495640_0018889 3300046533 Bacteria 5100
298 Ga0495586_0002299 3300046535 Bacteria 10395
299 Ga0495587_0040515 3300046536 Bacteria 2784
300 Ga0495609_0000008 3300046538 Bacteria 383025
301 Ga0495609_0000037 3300046538 Bacteria 185912
302 Ga0495609_0000059 3300046538 Bacteria 142403
303 Ga0495609_0000125 3300046538 Bacteria 83190
304 Ga0495609_0002474 3300046538 Bacteria 11344
305 Ga0495609_0003112 3300046538 Bacteria 9708
306 Ga0495609_0007067 3300046538 Bacteria 5650
307 Ga0495609_0008215 3300046538 Bacteria 5123
308 Ga0495609_0010014 3300046538 Bacteria 4565
309 Ga0495609_0016474 3300046538 Bacteria 3444
310 Ga0495609_0020868 3300046538 Bacteria 3023
311 Ga0495609_0021166 3300046538 Bacteria 3000
312 Ga0495597_0000023 3300046542 Bacteria 149302
313 Ga0495597_0000274 3300046542 Bacteria 46959
314 Ga0495597_0000287 3300046542 Bacteria 45422
315 Ga0495597_0000418 3300046542 Bacteria 36595
316 Ga0495597_0001337 3300046542 Bacteria 17937
317 Ga0495597_0003953 3300046542 Bacteria 8346
318 Ga0495597_0006019 3300046542 Bacteria 6323
319 Ga0495597_0014049 3300046542 Bacteria 3820
320 Ga0495597_0015186 3300046542 Bacteria 3648
321 Ga0495645_0001130 3300046543 Bacteria 18053
322 Ga0495645_0029711 3300046543 Bacteria 3976
323 Ga0495645_0033331 3300046543 Bacteria 3757
324 Ga0495622_0002322 3300046557 Bacteria 9259
325 Ga0495633_0000009 3300046558 Bacteria 293183
326 Ga0495633_0001655 3300046558 Bacteria 16798
327 Ga0495633_0002254 3300046558 Bacteria 13809
328 Ga0495633_0006777 3300046558 Bacteria 6724
329 Ga0495633_0019562 3300046558 Bacteria 3423
330 Ga0495656_0002581 3300046615 Bacteria 6039
331 Ga0495668_0000682 3300046616 Bacteria 40861
332 Ga0495668_0000991 3300046616 Bacteria 30808
333 Ga0495668_0001339 3300046616 Bacteria 24223
334 Ga0495668_0005692 3300046616 Bacteria 8345
335 Ga0495668_0006427 3300046616 Bacteria 7695
336 Ga0495611_0000328 3300046648 Bacteria 31136
337 Ga0495611_0002243 3300046648 Bacteria 8968
338 Ga0495611_0003190 3300046648 Bacteria 7260
339 Ga0495611_0005439 3300046648 Bacteria 5444
340 Ga0495611_0009620 3300046648 Bacteria 4083
341 Ga0495611_0011825 3300046648 Bacteria 3704
342 Ga0495625_0000071 3300046660 Bacteria 166966
343 Ga0495625_0006934 3300046660 Bacteria 9992
344 Ga0495635_0002087 3300046663 Bacteria 13566
345 Ga0495635_0002762 3300046663 Bacteria 12033
346 Ga0495661_0000029 3300046665 Bacteria 173899
347 Ga0495661_0000080 3300046665 Bacteria 117162
348 Ga0495661_0000259 3300046665 Bacteria 60869
349 Ga0495661_0000298 3300046665 Bacteria 56265
350 Ga0495661_0000736 3300046665 Bacteria 31925
351 Ga0495661_0001030 3300046665 Bacteria 24764
352 Ga0495661_0001214 3300046665 Bacteria 22356
353 Ga0495661_0002304 3300046665 Bacteria 14735
354 Ga0495661_0003343 3300046665 Bacteria 11883
355 Ga0495661_0003617 3300046665 Bacteria 11388
356 Ga0495661_0012822 3300046665 Bacteria 5653
357 Ga0495661_0013780 3300046665 Bacteria 5425
358 Ga0495661_0017180 3300046665 Bacteria 4780
359 Ga0495661_0023144 3300046665 Bacteria 4036
360 Ga0495661_0024950 3300046665 Bacteria 3868
361 Ga0495661_0029006 3300046665 Bacteria 3535
362 Ga0495661_0062896 3300046665 Bacteria 2196
363 Ga0495588_0000137 3300046674 Bacteria 114279
364 Ga0495588_0001831 3300046674 Bacteria 9062
365 Ga0495588_0005877 3300046674 Bacteria 5498
366 Ga0495599_0008580 3300046678 Bacteria 6221
367 Ga0495623_0015705 3300046679 Bacteria 4893
368 Ga0495669_0000120 3300046684 Bacteria 50677
369 Ga0495669_0002259 3300046684 Bacteria 7902
370 Ga0495669_0003452 3300046684 Bacteria 6514
371 Ga0495669_0004750 3300046684 Bacteria 5631
372 Ga0495669_0005577 3300046684 Bacteria 5250
373 Ga0495669_0011389 3300046684 Bacteria 3776
374 Ga0495624_0003062 3300046690 Bacteria 12515
375 Ga0495624_0004455 3300046690 Bacteria 10244
376 Ga0495624_0004854 3300046690 Bacteria 9770
377 Ga0495670_0000383 3300046691 Bacteria 21096
378 Ga0495670_0000759 3300046691 Bacteria 15501
379 Ga0495670_0001026 3300046691 Bacteria 13564
380 Ga0495670_0002435 3300046691 Bacteria 9189
381 Ga0495670_0012447 3300046691 Bacteria 4184
382 Ga0495670_0013469 3300046691 Bacteria 4023
383 Ga0495671_0000149 3300046692 Bacteria 61282
384 Ga0495671_0000275 3300046692 Bacteria 43068
385 Ga0495671_0000421 3300046692 Bacteria 33756
386 Ga0495671_0000604 3300046692 Bacteria 26403
387 Ga0495671_0001756 3300046692 Bacteria 14047
388 Ga0495671_0004624 3300046692 Bacteria 8165
389 Ga0495649_0000122 3300046694 Bacteria 68254
390 Ga0495649_0000883 3300046694 Bacteria 23980
391 Ga0495649_0002172 3300046694 Bacteria 14034
392 Ga0495649_0013255 3300046694 Bacteria 4761
393 Ga0495649_0026765 3300046694 Bacteria 3204
394 Ga0495649_0035884 3300046694 Bacteria 2726
395 Ga0495649_0040492 3300046694 Bacteria 2551
396 Ga0495589_0000052 3300046794 Bacteria 111467
397 Ga0495589_0000185 3300046794 Bacteria 55116
398 Ga0495589_0000444 3300046794 Bacteria 30492
399 Ga0495589_0000945 3300046794 Bacteria 17807
400 Ga0495589_0001148 3300046794 Bacteria 15764
401 Ga0495589_0003041 3300046794 Bacteria 9203
402 Ga0495589_0007511 3300046794 Bacteria 5711
403 Ga0495589_0011078 3300046794 Bacteria 4679
404 Ga0495589_0035876 3300046794 Bacteria 2486
405 Ga0495660_0000081 3300046810 Bacteria 101754
406 Ga0495660_0000120 3300046810 Bacteria 85153
407 Ga0495660_0000154 3300046810 Bacteria 74753
408 Ga0495660_0000666 3300046810 Bacteria 26493
409 Ga0495660_0000725 3300046810 Bacteria 25210
410 Ga0495660_0004107 3300046810 Bacteria 8879
411 Ga0495660_0008195 3300046810 Bacteria 6131
412 Ga0495660_0008533 3300046810 Bacteria 5998
413 Ga0495660_0008836 3300046810 Bacteria 5885
414 Ga0495660_0009062 3300046810 Bacteria 5811
415 Ga0495660_0018894 3300046810 Bacteria 3956
416 Ga0495660_0020425 3300046810 Bacteria 3796
417 Ga0495660_0039847 3300046810 Bacteria 2606
418 Ga0495581_0015692 3300047315 Bacteria 4397
419 Ga0495604_0000942 3300047317 Bacteria 24235
420 Ga0495604_0009011 3300047317 Bacteria 7893
421 Ga0495604_0015085 3300047317 Bacteria 6165
422 Ga0495604_0024321 3300047317 Bacteria 4831
423 Ga0495672_0000132 3300047320 Bacteria 111537
424 Ga0495672_0000237 3300047320 Bacteria 78194
425 Ga0495672_0000579 3300047320 Bacteria 41410
426 Ga0495672_0000603 3300047320 Bacteria 40496
427 Ga0495672_0002433 3300047320 Bacteria 17150
428 Ga0495672_0005235 3300047320 Bacteria 10335
429 Ga0495676_0000003 3300047321 Bacteria 318463
430 Ga0495676_0000243 3300047321 Bacteria 43967
431 Ga0495680_0003789 3300047322 Bacteria 14702
432 Ga0495680_0013376 3300047322 Bacteria 7162
433 Ga0495680_0013632 3300047322 Bacteria 7081
434 Ga0495680_0022039 3300047322 Bacteria 5319
435 Ga0495683_0000042 3300047323 Bacteria 137528
436 Ga0495683_0000296 3300047323 Bacteria 42776
437 Ga0495683_0001934 3300047323 Bacteria 12924
438 Ga0495683_0002972 3300047323 Bacteria 10010
439 Ga0495683_0007680 3300047323 Bacteria 5800
440 Ga0495683_0012516 3300047323 Bacteria 4453
441 Ga0495683_0013987 3300047323 Bacteria 4182
442 Ga0495687_000018 3300047443 Bacteria 342973
443 Ga0495687_000022 3300047443 Bacteria 327353
444 Ga0495687_000087 3300047443 Bacteria 142540
445 Ga0495687_000226 3300047443 Bacteria 79404
446 Ga0495687_000263 3300047443 Bacteria 70773
447 Ga0495687_000275 3300047443 Bacteria 68138
448 Ga0495687_000695 3300047443 Bacteria 37969
449 Ga0495687_000831 3300047443 Bacteria 32963
450 Ga0495687_006310 3300047443 Bacteria 7300
451 Ga0495687_013062 3300047443 Bacteria 4352
452 Ga0495675_0005100 3300047444 Bacteria 7995
453 Ga0495675_0022214 3300047444 Bacteria 4044
454 Ga0495677_0000033 3300047445 Bacteria 83783
455 Ga0495677_0001007 3300047445 Bacteria 11341
456 Ga0495677_0001524 3300047445 Bacteria 9329
457 Ga0495677_0001560 3300047445 Bacteria 9242
458 Ga0495677_0002332 3300047445 Bacteria 7466
459 Ga0495677_0004293 3300047445 Bacteria 5480
460 Ga0495677_0005504 3300047445 Bacteria 4801
461 Ga0495677_0009065 3300047445 Bacteria 3679
462 Ga0495679_000060 3300047446 Bacteria 109240
463 Ga0495679_000097 3300047446 Bacteria 79231
464 Ga0495679_003784 3300047446 Bacteria 7175
465 Ga0495679_010219 3300047446 Bacteria 3697
466 Ga0495673_0000017 3300047469 Bacteria 574970
467 Ga0495673_0000543 3300047469 Bacteria 38551
468 Ga0495673_0000965 3300047469 Bacteria 25969
469 Ga0495673_0001187 3300047469 Bacteria 21906
470 Ga0495673_0001714 3300047469 Bacteria 16768
471 Ga0495673_0003244 3300047469 Bacteria 10839
472 Ga0495673_0005340 3300047469 Bacteria 7792
473 Ga0495681_0000264 3300047470 Bacteria 42342
474 Ga0495681_0000387 3300047470 Bacteria 34422
475 Ga0495681_0006224 3300047470 Bacteria 7867
476 Ga0495681_0007233 3300047470 Bacteria 7134
477 Ga0495686_0000282 3300047472 Bacteria 89471
478 Ga0495686_0000364 3300047472 Bacteria 73360
479 Ga0495686_0000862 3300047472 Bacteria 38920
480 Ga0495686_0014764 3300047472 Bacteria 5366
481 Ga0495686_0017810 3300047472 Bacteria 4780
482 Ga0495593_0002966 3300047673 Bacteria 10206
483 Ga0495593_0004972 3300047673 Bacteria 7875
484 Ga0495602_0002768 3300048088 Bacteria 17919
485 Ga0495602_0005859 3300048088 Bacteria 12898
486 Ga0495602_0008290 3300048088 Bacteria 10859
487 Ga0495602_0055359 3300048088 Bacteria 3493
488 Ga0495614_0001040 3300048089 Bacteria 11858
489 Ga0495614_0004226 3300048089 Bacteria 6470
490 Ga0495614_0009006 3300048089 Bacteria 4429
491 Ga0495615_0000717 3300048090 Bacteria 4638
492 Ga0495626_0000010 3300048091 Bacteria 270265
493 Ga0495626_0000085 3300048091 Bacteria 125255
494 Ga0495626_0000316 3300048091 Bacteria 50961
495 Ga0495626_0001826 3300048091 Bacteria 16044
496 Ga0495626_0003073 3300048091 Bacteria 10949
497 Ga0495626_0004316 3300048091 Bacteria 8766
498 Ga0495626_0006519 3300048091 Bacteria 6633
499 Ga0495626_0007254 3300048091 Bacteria 6187
500 Ga0495626_0009596 3300048091 Bacteria 5221
501 Ga0495626_0015739 3300048091 Bacteria 3863
502 Ga0495626_0017213 3300048091 Bacteria 3656
503 Ga0495626_0023273 3300048091 Bacteria 3053
504 Ga0495626_0023941 3300048091 Bacteria 2999
505 Ga0496100_0003088 3300048903 Bacteria 8618
506 Ga0496100_0003840 3300048903 Bacteria 7878
507 Ga0496101_0002681 3300048904 Bacteria 10929
508 Ga0496101_0013972 3300048904 Bacteria 5392
509 Ga0496102_0001740 3300048905 Bacteria 19063
510 Ga0496102_0026745 3300048905 Bacteria 5149
511 Ga0496103_0000926 3300048906 Bacteria 21055
512 Ga0496103_0004797 3300048906 Bacteria 8175
513 Ga0496103_0013964 3300048906 Bacteria 4766
514 Ga0496104_0039656 3300048907 Bacteria 4410
515 Ga0496104_0075930 3300048907 Bacteria 3200
516 Ga0496105_0015126 3300048908 Bacteria 6141
517 Ga0496106_0001536 3300048909 Bacteria 17366
518 Ga0496106_0003429 3300048909 Bacteria 11816
519 Ga0496106_0005468 3300048909 Bacteria 9403
520 Ga0496106_0035010 3300048909 Bacteria 3754
521 Ga0496107_0017440 3300048910 Bacteria 5051
522 Ga0496107_0045947 3300048910 Bacteria 3142
523 Ga0496109_0018171 3300048912 Bacteria 6174
524 Ga0496110_0000181 3300048913 Bacteria 39279
525 Ga0496110_0009787 3300048913 Bacteria 7764
526 Ga0496111_0012159 3300048914 Bacteria 5822
527 Ga0496111_0045388 3300048914 Bacteria 3162
528 Ga0496112_0033739 3300048915 Bacteria 4976
529 Ga0496113_0024674 3300048916 Bacteria 4277
530 Ga0496114_0051147 3300048917 Bacteria 3440
531 Ga0496115_0005800 3300048918 Bacteria 8992
532 Ga0496116_0005143 3300048919 Bacteria 12280
533 Ga0496116_0010049 3300048919 Bacteria 7981
534 Ga0496117_0008252 3300048920 Bacteria 9926
535 Ga0496118_0029853 3300048921 Bacteria 4563
536 Ga0496121_0000646 3300048924 Bacteria 65142
537 Ga0496121_0002057 3300048924 Bacteria 31838
538 Ga0496121_0002431 3300048924 Bacteria 28477
539 Ga0496121_0006498 3300048924 Bacteria 14459
540 Ga0496121_0020933 3300048924 Bacteria 6437
541 Ga0496122_0000175 3300048925 Bacteria 153295
542 Ga0496122_0004448 3300048925 Bacteria 17378
543 Ga0496122_0006345 3300048925 Bacteria 13605
544 Ga0496122_0007239 3300048925 Bacteria 12410
545 Ga0496122_0009742 3300048925 Bacteria 10037
546 Ga0496123_0000079 3300048926 Bacteria 191201
547 Ga0496123_0002356 3300048926 Bacteria 23697
548 Ga0496123_0002598 3300048926 Bacteria 21956
549 Ga0496123_0017760 3300048926 Bacteria 5701
550 Ga0496124_0000229 3300048927 Bacteria 109277
551 Ga0496124_0001751 3300048927 Bacteria 30354
552 Ga0496124_0006520 3300048927 Bacteria 12698
553 Ga0496124_0011050 3300048927 Bacteria 9062
554 Ga0496124_0019363 3300048927 Bacteria 6336
555 Ga0496124_0020261 3300048927 Bacteria 6153
556 Ga0496124_0046944 3300048927 Bacteria 3697
557 Ga0496125_0003795 3300048928 Bacteria 17967
558 Ga0496125_0037306 3300048928 Bacteria 4227
559 Ga0496126_0027932 3300048929 Bacteria 5381
560 Ga0496126_0037511 3300048929 Bacteria 4521
561 Ga0495678_000011 3300049459 Bacteria 335512
562 Ga0495678_000042 3300049459 Bacteria 174125
563 Ga0495678_000170 3300049459 Bacteria 75931
564 Ga0495678_000300 3300049459 Bacteria 53845
565 Ga0495678_000482 3300049459 Bacteria 39648
566 Ga0495678_000529 3300049459 Bacteria 37097
567 Ga0495678_000854 3300049459 Bacteria 27183
568 Ga0495678_001218 3300049459 Bacteria 21121
569 Ga0495678_001669 3300049459 Bacteria 16876
570 Ga0495678_026894 3300049459 Bacteria 2448
571 Ga0495682_0000023 3300049460 Bacteria 158998
572 Ga0495682_0000764 3300049460 Bacteria 20632
573 Ga0495682_0002815 3300049460 Bacteria 8023
574 Ga0501047_0066789 3300049581 Bacteria 3467
575 Ga0501035_0004771 3300049822 Bacteria 12868
576 Ga0501044_0107481 3300049823 Bacteria 2801
577 Ga0500618_000317 3300053125 Bacteria 35605
578 Ga0500618_001877 3300053125 Bacteria 8734
579 Ga0500573_0005058 3300053140 Bacteria 7019
580 Ga0500586_000202 3300053145 Bacteria 11556
581 2509128200 2508501125 Bacteria 7208311
582 2511386765 2511231026 Bacteria 5225445
583 2599975375 2599185307 Bacteria 6194719
584 2601624022 2600255283 Bacteria 6061572
585 2643801979 2643221556 Bacteria 7251154
586 2644026285 2643221603 Bacteria 6147767
587 2644473868 2643221684 Bacteria 7145183
588 2738692072 2738541271 Bacteria 5657310
589 2738825294 2738541297 Bacteria 6549566
590 2739149091 2738541357 Bacteria 6549408
591 2739191010 2738543003 Bacteria 6549560
592 2739267730 2738543016 Bacteria 5657564
593 2739317487 2738543026 Bacteria 6549408
594 2739335728 2738543029 Bacteria 6549249
595 2808970777 2808606384 Bacteria 8474373
596 2809005608 2808606390 Bacteria 8476311
597 2809012635 2808606391 Bacteria 8308166
598 2809145161 2808606418 Bacteria 6724496
599 2812370937 2811994881 Bacteria 6298475
600 2821133884 2821131069 Bacteria 6108407
601 2842806991 2842805378 Bacteria 5385175
602 2856288560 2856287931 Bacteria 7223934
603 2857367012 2857357740 Bacteria 9937880
604 2857553976 2857553236 Bacteria 6166726
605 2857565671 2857564685 Bacteria 6290584
606 2857576718 2857576091 Bacteria 5465855
607 2885085543 2885080285 Bacteria 6355622
608 2900635692 2900634093 Bacteria 10263517
609 2904435979 2904434214 Bacteria 6230908
610 2904437567 2904434214 Bacteria 6230908
611 2919481069 2919476304 Bacteria 5888696
612 2923525042 2923519811 Bacteria 6298479
613 3007254452 3007252601 Bacteria 4559114
614 3007315759 3007315729 Bacteria 5076637
615 642620843 642555113 Bacteria 8214658
616 8047674061 8047673197 Bacteria 7395230
617 8054287296 8054285046 Bacteria 6919322
618 8055882990 8055878733 Bacteria 5907058
619 Ga0105251_10001000
620 JGI24735J21928_10002481
621 JGI25156J39149_1000439
622 Ga0055525_1000001
623 Ga0055524_1000021
624 Ga0055524_1000099
625 Ga0058692_1004338
626 Ga0065165_1000723
627 Ga0065714_10066246
628 Ga0070658_10063937
629 Ga0070680_100000360
630 Ga0070660_100000463
631 Ga0070661_100000011
632 Ga0070678_100037543
633 Ga0070679_100000008
634 Ga0079104_1005968
635 Ga0099826_10000002
636 Ga0105251_10000001
637 Ga0105251_10000244
638 Ga0105251_10000739
639 Ga0105250_10000082
640 Ga0105241_10006969
641 Ga0157373_10007570
642 Ga0157371_10000001
643 Ga0157371_10000086
644 Ga0157371_10000157
645 Ga0157370_10002669
646 Ga0163162_10001130
647 Ga0182008_10013217
648 Ga0182006_1000044
649 Ga0182005_1000018
650 Ga0183361_10021
651 Ga0163161_10009376
652 Ga0209563_100007
653 Ga0209148_1000575
654 Ga0209759_1000250
655 Ga0209256_1000044
656 Ga0207426_1004702
657 Ga0207696_1000219
658 Ga0207655_1005775
659 Ga0207713_1000071
660 Ga0207713_1000107
661 Ga0207713_1002426
662 Ga0207713_1022304
663 Ga0207660_10001011
664 Ga0207657_10012351
665 Ga0207649_10000038
666 Ga0207652_10000008
667 Ga0207690_10033263
668 Ga0207683_10039493
669 Ga0209281_1004893
670 Ga0209371_1000032
671 Ga0209996_1001002
672 Ga0209982_1001160
673 Ga0209282_1000001
674 Ga0209971_1002107
675 Ga0316177_1196908
676 Ga0395900_0000404
677 Ga0395900_0000695
678 Ga0395900_0004023
679 Ga0395900_0065514
680 Ga0395898_0089011
681 Ga0395905_0000009
682 Ga0395905_0011175
683 Ga0395901_0000491
684 Ga0395901_0003247
685 Ga0439448_0002711
686 Ga0439464_0007016
687 Ga0466972_0019768
688 Ga0466965_0005219
689 Ga0466966_0053248
690 Ga0466964_0003568
691 Ga0466968_0000683
692 Ga0466970_0024152
693 Ga0466957_0000089
694 Ga0466959_0003194
695 Ga0466959_0009528
696 Ga0466958_0000236
697 Ga0466967_0011636
698 Ga0495617_000007
699 Ga0495617_000070
700 Ga0495617_002457
701 Ga0495627_000006
702 Ga0495627_000050
703 Ga0495627_000054
704 Ga0495627_000201
705 Ga0495627_005149
706 Ga0495627_007850
707 Ga0495603_0042882
708 Ga0495590_0000060
709 Ga0495590_0000932
710 Ga0495590_0000949
711 Ga0495590_0004205
712 Ga0495590_0012307
713 Ga0495591_000002
714 Ga0495591_000156
715 Ga0495591_000190
716 Ga0495591_000217
717 Ga0495591_000954
718 Ga0495591_003889
719 Ga0495629_0000334
720 Ga0495629_0036480
721 Ga0495629_0048153
722 Ga0495629_0052084
723 Ga0495638_0001947
724 Ga0495638_0004134
725 Ga0495638_0010808
726 Ga0495638_0024774
727 Ga0495653_0000073
728 Ga0495653_0000124
729 Ga0495653_0011015
730 Ga0495653_0013782
731 Ga0495653_0026981
732 Ga0495653_0058963
733 Ga0495650_0000048
734 Ga0495650_0000534
735 Ga0495650_0000611
736 Ga0495650_0000649
737 Ga0495650_0000939
738 Ga0495650_0000999
739 Ga0495650_0005410
740 Ga0495650_0007818
741 Ga0495650_0008894
742 Ga0495580_0000760
743 Ga0495580_0028197
744 Ga0495582_0002717
745 Ga0495605_0000002
746 Ga0495605_0000066
747 Ga0495605_0000154
748 Ga0495605_0000161
749 Ga0495605_0000550
750 Ga0495605_0001113
751 Ga0495605_0002075
752 Ga0495605_0005360
753 Ga0495605_0005464
754 Ga0495605_0006659
755 Ga0495605_0027512
756 Ga0495584_0000275
757 Ga0495584_0000479
758 Ga0495584_0001475
759 Ga0495584_0003036
760 Ga0495584_0006780
761 Ga0495584_0007255
762 Ga0495584_0015960
763 Ga0495584_0029691
764 Ga0495585_0000122
765 Ga0495585_0000215
766 Ga0495585_0001183
767 Ga0495585_0001430
768 Ga0495585_0002329
769 Ga0495585_0003354
770 Ga0495585_0003989
771 Ga0495585_0005312
772 Ga0495585_0011299
773 Ga0495585_0012231
774 Ga0495585_0013364
775 Ga0495585_0013704
776 Ga0495585_0015507
777 Ga0495585_0017291
778 Ga0495594_0000417
779 Ga0495594_0002989
780 Ga0495594_0003795
781 Ga0495594_0017180
782 Ga0495596_0001326
783 Ga0495596_0003138
784 Ga0495596_0003580
785 Ga0495596_0003855
786 Ga0495596_0005899
787 Ga0495596_0006665
788 Ga0495596_0006886
789 Ga0495596_0007586
790 Ga0495607_0000045
791 Ga0495607_0000085
792 Ga0495607_0000245
793 Ga0495607_0000311
794 Ga0495607_0000619
795 Ga0495607_0001872
796 Ga0495607_0001900
797 Ga0495607_0002110
798 Ga0495607_0002316
799 Ga0495607_0003938
800 Ga0495607_0006661
801 Ga0495607_0007985
802 Ga0495607_0008671
803 Ga0495607_0015018
804 Ga0495607_0032990
805 Ga0495607_0069702
806 Ga0495583_0000012
807 Ga0495583_0000295
808 Ga0495583_0000339
809 Ga0495583_0000754
810 Ga0495583_0000791
811 Ga0495583_0000810
812 Ga0495583_0001302
813 Ga0495583_0001736
814 Ga0495583_0001877
815 Ga0495583_0003406
816 Ga0495583_0004079
817 Ga0495583_0016728
818 Ga0495606_0000028
819 Ga0495606_0000084
820 Ga0495606_0000146
821 Ga0495606_0000184
822 Ga0495606_0000291
823 Ga0495606_0000768
824 Ga0495606_0001412
825 Ga0495606_0005294
826 Ga0495606_0009751
827 Ga0495606_0012748
828 Ga0495606_0027199
829 Ga0495606_0029102
830 Ga0495606_0042633
831 Ga0495610_0000004
832 Ga0495610_0001651
833 Ga0495610_0002702
834 Ga0495610_0005961
835 Ga0495610_0010963
836 Ga0495616_0000231
837 Ga0495616_0000406
838 Ga0495616_0001202
839 Ga0495616_0007198
840 Ga0495616_0008187
841 Ga0495616_0009079
842 Ga0495616_0010711
843 Ga0495616_0020203
844 Ga0495616_0020606
845 Ga0495620_0000010
846 Ga0495620_0000089
847 Ga0495620_0001678
848 Ga0495628_0002705
849 Ga0495630_0028018
850 Ga0495631_0000319
851 Ga0495631_0001533
852 Ga0495631_0001920
853 Ga0495631_0004918
854 Ga0495631_0011809
855 Ga0495631_0013391
856 Ga0495632_0000147
857 Ga0495632_0000287
858 Ga0495632_0000451
859 Ga0495632_0000514
860 Ga0495632_0002591
861 Ga0495632_0006152
862 Ga0495632_0007894
863 Ga0495632_0032880
864 Ga0495637_0000004
865 Ga0495637_0000068
866 Ga0495637_0000243
867 Ga0495637_0000510
868 Ga0495637_0002543
869 Ga0495637_0011237
870 Ga0495637_0017359
871 Ga0495643_0000366
872 Ga0495643_0000787
873 Ga0495643_0001961
874 Ga0495643_0006502
875 Ga0495643_0008496
876 Ga0495643_0011252
877 Ga0495643_0013121
878 Ga0495644_0001236
879 Ga0495644_0001723
880 Ga0495644_0006066
881 Ga0495644_0008032
882 Ga0495644_0009180
883 Ga0495648_0000287
884 Ga0495648_0000530
885 Ga0495648_0002664
886 Ga0495648_0006543
887 Ga0495648_0007071
888 Ga0495648_0008538
889 Ga0495648_0010430
890 Ga0495648_0016426
891 Ga0495648_0018603
892 Ga0495648_0018988
893 Ga0495666_0002975
894 Ga0495666_0003091
895 Ga0495666_0013643
896 Ga0495666_0020570
897 Ga0495642_0000060
898 Ga0495642_0000420
899 Ga0495642_0000690
900 Ga0495642_0002154
901 Ga0495642_0004198
902 Ga0495642_0004452
903 Ga0495642_0010654
904 Ga0495642_0013427
905 Ga0495652_0008237
906 Ga0495652_0036857
907 Ga0495654_0000004
908 Ga0495654_0000505
909 Ga0495654_0000509
910 Ga0495654_0005451
911 Ga0495654_0008617
912 Ga0495654_0023949
913 Ga0495665_0000011
914 Ga0495665_0000773
915 Ga0495640_0018889
916 Ga0495586_0002299
917 Ga0495587_0040515
918 Ga0495609_0000008
919 Ga0495609_0000037
920 Ga0495609_0000059
921 Ga0495609_0000125
922 Ga0495609_0002474
923 Ga0495609_0003112
924 Ga0495609_0007067
925 Ga0495609_0008215
926 Ga0495609_0010014
927 Ga0495609_0016474
928 Ga0495609_0020868
929 Ga0495609_0021166
930 Ga0495597_0000023
931 Ga0495597_0000274
932 Ga0495597_0000287
933 Ga0495597_0000418
934 Ga0495597_0001337
935 Ga0495597_0003953
936 Ga0495597_0006019
937 Ga0495597_0014049
938 Ga0495597_0015186
939 Ga0495645_0001130
940 Ga0495645_0029711
941 Ga0495645_0033331
942 Ga0495622_0002322
943 Ga0495633_0000009
944 Ga0495633_0001655
945 Ga0495633_0002254
946 Ga0495633_0006777
947 Ga0495633_0019562
948 Ga0495656_0002581
949 Ga0495668_0000682
950 Ga0495668_0000991
951 Ga0495668_0001339
952 Ga0495668_0005692
953 Ga0495668_0006427
954 Ga0495611_0000328
955 Ga0495611_0002243
956 Ga0495611_0003190
957 Ga0495611_0005439
958 Ga0495611_0009620
959 Ga0495611_0011825
960 Ga0495625_0000071
961 Ga0495625_0006934
962 Ga0495635_0002087
963 Ga0495635_0002762
964 Ga0495661_0000029
965 Ga0495661_0000080
966 Ga0495661_0000259
967 Ga0495661_0000298
968 Ga0495661_0000736
969 Ga0495661_0001030
970 Ga0495661_0001214
971 Ga0495661_0002304
972 Ga0495661_0003343
973 Ga0495661_0003617
974 Ga0495661_0012822
975 Ga0495661_0013780
976 Ga0495661_0017180
977 Ga0495661_0023144
978 Ga0495661_0024950
979 Ga0495661_0029006
980 Ga0495661_0062896
981 Ga0495588_0000137
982 Ga0495588_0001831
983 Ga0495588_0005877
984 Ga0495599_0008580
985 Ga0495623_0015705
986 Ga0495669_0000120
987 Ga0495669_0002259
988 Ga0495669_0003452
989 Ga0495669_0004750
990 Ga0495669_0005577
991 Ga0495669_0011389
992 Ga0495624_0003062
993 Ga0495624_0004455
994 Ga0495624_0004854
995 Ga0495670_0000383
996 Ga0495670_0000759
997 Ga0495670_0001026
998 Ga0495670_0002435
999 Ga0495670_0012447
1000 Ga0495670_0013469
1001 Ga0495671_0000149
1002 Ga0495671_0000275
1003 Ga0495671_0000421
1004 Ga0495671_0000604
1005 Ga0495671_0001756
1006 Ga0495671_0004624
1007 Ga0495649_0000122
1008 Ga0495649_0000883
1009 Ga0495649_0002172
1010 Ga0495649_0013255
1011 Ga0495649_0026765
1012 Ga0495649_0035884
1013 Ga0495649_0040492
1014 Ga0495589_0000052
1015 Ga0495589_0000185
1016 Ga0495589_0000444
1017 Ga0495589_0000945
1018 Ga0495589_0001148
1019 Ga0495589_0003041
1020 Ga0495589_0007511
1021 Ga0495589_0011078
1022 Ga0495589_0035876
1023 Ga0495660_0000081
1024 Ga0495660_0000120
1025 Ga0495660_0000154
1026 Ga0495660_0000666
1027 Ga0495660_0000725
1028 Ga0495660_0004107
1029 Ga0495660_0008195
1030 Ga0495660_0008533
1031 Ga0495660_0008836
1032 Ga0495660_0009062
1033 Ga0495660_0018894
1034 Ga0495660_0020425
1035 Ga0495660_0039847
1036 Ga0495581_0015692
1037 Ga0495604_0000942
1038 Ga0495604_0009011
1039 Ga0495604_0015085
1040 Ga0495604_0024321
1041 Ga0495672_0000132
1042 Ga0495672_0000237
1043 Ga0495672_0000579
1044 Ga0495672_0000603
1045 Ga0495672_0002433
1046 Ga0495672_0005235
1047 Ga0495676_0000003
1048 Ga0495676_0000243
1049 Ga0495680_0003789
1050 Ga0495680_0013376
1051 Ga0495680_0013632
1052 Ga0495680_0022039
1053 Ga0495683_0000042
1054 Ga0495683_0000296
1055 Ga0495683_0001934
1056 Ga0495683_0002972
1057 Ga0495683_0007680
1058 Ga0495683_0012516
1059 Ga0495683_0013987
1060 Ga0495687_000018
1061 Ga0495687_000022
1062 Ga0495687_000087
1063 Ga0495687_000226
1064 Ga0495687_000263
1065 Ga0495687_000275
1066 Ga0495687_000695
1067 Ga0495687_000831
1068 Ga0495687_006310
1069 Ga0495687_013062
1070 Ga0495675_0005100
1071 Ga0495675_0022214
1072 Ga0495677_0000033
1073 Ga0495677_0001007
1074 Ga0495677_0001524
1075 Ga0495677_0001560
1076 Ga0495677_0002332
1077 Ga0495677_0004293
1078 Ga0495677_0005504
1079 Ga0495677_0009065
1080 Ga0495679_000060
1081 Ga0495679_000097
1082 Ga0495679_003784
1083 Ga0495679_010219
1084 Ga0495673_0000017
1085 Ga0495673_0000543
1086 Ga0495673_0000965
1087 Ga0495673_0001187
1088 Ga0495673_0001714
1089 Ga0495673_0003244
1090 Ga0495673_0005340
1091 Ga0495681_0000264
1092 Ga0495681_0000387
1093 Ga0495681_0006224
1094 Ga0495681_0007233
1095 Ga0495686_0000282
1096 Ga0495686_0000364
1097 Ga0495686_0000862
1098 Ga0495686_0014764
1099 Ga0495686_0017810
1100 Ga0495593_0002966
1101 Ga0495593_0004972
1102 Ga0495602_0002768
1103 Ga0495602_0005859
1104 Ga0495602_0008290
1105 Ga0495602_0055359
1106 Ga0495614_0001040
1107 Ga0495614_0004226
1108 Ga0495614_0009006
1109 Ga0495615_0000717
1110 Ga0495626_0000010
1111 Ga0495626_0000085
1112 Ga0495626_0000316
1113 Ga0495626_0001826
1114 Ga0495626_0003073
1115 Ga0495626_0004316
1116 Ga0495626_0006519
1117 Ga0495626_0007254
1118 Ga0495626_0009596
1119 Ga0495626_0015739
1120 Ga0495626_0017213
1121 Ga0495626_0023273
1122 Ga0495626_0023941
1123 Ga0496100_0003088
1124 Ga0496100_0003840
1125 Ga0496101_0002681
1126 Ga0496101_0013972
1127 Ga0496102_0001740
1128 Ga0496102_0026745
1129 Ga0496103_0000926
1130 Ga0496103_0004797
1131 Ga0496103_0013964
1132 Ga0496104_0039656
1133 Ga0496104_0075930
1134 Ga0496105_0015126
1135 Ga0496106_0001536
1136 Ga0496106_0003429
1137 Ga0496106_0005468
1138 Ga0496106_0035010
1139 Ga0496107_0017440
1140 Ga0496107_0045947
1141 Ga0496109_0018171
1142 Ga0496110_0000181
1143 Ga0496110_0009787
1144 Ga0496111_0012159
1145 Ga0496111_0045388
1146 Ga0496112_0033739
1147 Ga0496113_0024674
1148 Ga0496114_0051147
1149 Ga0496115_0005800
1150 Ga0496116_0005143
1151 Ga0496116_0010049
1152 Ga0496117_0008252
1153 Ga0496118_0029853
1154 Ga0496121_0000646
1155 Ga0496121_0002057
1156 Ga0496121_0002431
1157 Ga0496121_0006498
1158 Ga0496121_0020933
1159 Ga0496122_0000175
1160 Ga0496122_0004448
1161 Ga0496122_0006345
1162 Ga0496122_0007239
1163 Ga0496122_0009742
1164 Ga0496123_0000079
1165 Ga0496123_0002356
1166 Ga0496123_0002598
1167 Ga0496123_0017760
1168 Ga0496124_0000229
1169 Ga0496124_0001751
1170 Ga0496124_0006520
1171 Ga0496124_0011050
1172 Ga0496124_0019363
1173 Ga0496124_0020261
1174 Ga0496124_0046944
1175 Ga0496125_0003795
1176 Ga0496125_0037306
1177 Ga0496126_0027932
1178 Ga0496126_0037511
1179 Ga0495678_000011
1180 Ga0495678_000042
1181 Ga0495678_000170
1182 Ga0495678_000300
1183 Ga0495678_000482
1184 Ga0495678_000529
1185 Ga0495678_000854
1186 Ga0495678_001218
1187 Ga0495678_001669
1188 Ga0495678_026894
1189 Ga0495682_0000023
1190 Ga0495682_0000764
1191 Ga0495682_0002815
1192 Ga0501047_0066789
1193 Ga0501035_0004771
1194 Ga0501044_0107481
1195 Ga0500618_000317
1196 Ga0500618_001877
1197 Ga0500573_0005058
1198 Ga0500586_000202
1199 2509128200
1200 2511386765
1201 2599975375
1202 2601624022
1203 2643801979
1204 2644026285
1205 2644473868
1206 2738692072
1207 2738825294
1208 2739149091
1209 2739191010
1210 2739267730
1211 2739317487
1212 2739335728
1213 2808970777
1214 2809005608
1215 2809012635
1216 2809145161
1217 2812370937
1218 2821133884
1219 2842806991
1220 2856288560
1221 2857367012
1222 2857553976
1223 2857565671
1224 2857576718
1225 2885085543
1226 2900635692
1227 2904435979
1228 2904437567
1229 2919481069
1230 2923525042
1231 3007254452
1232 3007315759
1233 642620843
1234 8047674061
1235 8054287296
1236 8055882990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00360

PHY

Phytochrome region

384

559

0.92

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

683

798

0.92

PF00512

HisKA

His Kinase A (phospho-acceptor) domain

574

642

0.91

PF08446

PAS_2

PAS fold

109

200

0.83

PF01590

GAF

GAF domain

226

393

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ool-assembly1.cif.gz_A crystal structure of the chromophore-binding domain of an unusual bacteriophytochrome rpbphp3 from r. palustris 0.909 22 310
2o9c-assembly1.cif.gz_A crystal structure of bacteriophytochrome chromophore binding domain at 1.45 angstrom resolution 0.9059 20 308
3s7o-assembly1.cif.gz_A crystal structure of the infrared fluorescent d207h variant of deinococcus bacteriophytochrome chromophore binding domain at 1.24 angstrom resolution 0.9041 20 309
2ool-assembly1.cif.gz_B crystal structure of the chromophore-binding domain of an unusual bacteriophytochrome rpbphp3 from r. palustris 0.9024 23 309
4q0h-assembly1.cif.gz_A-2 deinococcus radiodurans bphp pas-gaf 0.9016 20 308
ID Description Score Start End Superfamily
4y3iA02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9773 126 308 3.30.450.40
4o01B01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9603 126 309 3.30.450.40
5llyA02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9533 123 303 3.30.450.40
4rq9A02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.95 120 305 3.30.450.40
4s21B01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.93 118 312 3.30.450.40
ID Description Score Start End GO Terms
AF-A0A174UNF0-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8987 608 710 GO:0000155
AF-A0A7C3PHH6-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8967 452 712 GO:0000155
GO:0000156
GO:0007234
GO:0030295
AF-A0A174UNF0-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8814 608 710 GO:0000155
AF-A0A4Q3UYH1-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8808 596 718 GO:0016301
AF-A0A4Q3UYH1-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8738 596 718 GO:0016301

Map