F469728

General Info

Members Datasets Scaffolds Average Seq Length
618 225 1236 128

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10106926|Ga0105242_101069262
Length 150
Sequence MERMGTLTAELEQQRMRPMTKFTMMLVATMTLATGFGGIEAPASAQAANSEITVFGNDPCPRSTSGEIYVCNRRPEAERYRLPKSQQLQGTRQQRQSWANKSRPLTTVGNTGTGSCSAVGPGGHTGCLIQEINQNRREVYEQTQTDQAPR

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
163 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
173 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
174 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
209 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
210 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
211 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
212 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
213 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
214 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
215 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
216 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
219 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
220 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
221 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
222 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
223 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 4.37
Rhizosphere 94.82
Stem 0
Stem Tuber 0
Unclassified 6.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10106926 3300009176 Bacteria 2379
2 JGI24747J21853_1008497 3300001978 Bacteria 1005
3 JGI24740J21852_10001189 3300001979 Bacteria 11731
4 JGI24739J22299_10002907 3300001989 Bacteria 6577
5 JGI24737J22298_10007110 3300001990 Bacteria 3792
6 JGI24737J22298_10070190 3300001990 Bacteria 1046
7 JGI24737J22298_10105277 3300001990 Bacteria 835
8 JGI24743J22301_10000629 3300001991 Bacteria 4299
9 JGI24743J22301_10023960 3300001991 Bacteria 1177
10 JGI24735J21928_10074341 3300002067 Bacteria 973
11 JGI24744J21845_10000141 3300002077 Bacteria 10274
12 JGI24742J22300_10008635 3300002244 Bacteria 1681
13 rootL2_10169548 3300003322 Bacteria 1113
14 Ga0070658_10015071 3300005327 Bacteria 6187
15 Ga0070658_10828889 3300005327 Bacteria 804
16 Ga0070658_11586612 3300005327 Bacteria 567
17 Ga0070676_10375583 3300005328 Unclassified 983
18 Ga0070683_100013737 3300005329 Bacteria 7069
19 Ga0070683_100037860 3300005329 Bacteria 4417
20 Ga0070683_101339074 3300005329 Bacteria 688
21 Ga0070690_100005416 3300005330 Bacteria 7167
22 Ga0070690_100206539 3300005330 Bacteria 1369
23 Ga0070670_100085951 3300005331 Bacteria 2703
24 Ga0070670_100147428 3300005331 Bacteria 2036
25 Ga0070670_100346567 3300005331 Bacteria 1304
26 Ga0070670_101004974 3300005331 Bacteria 759
27 Ga0070670_101659757 3300005331 Unclassified 588
28 Ga0070677_10001871 3300005333 Bacteria 6654
29 Ga0070677_10037334 3300005333 Bacteria 1895
30 Ga0070677_10135285 3300005333 Bacteria 1130
31 Ga0068869_100290432 3300005334 Bacteria 1317
32 Ga0068869_100328648 3300005334 Bacteria 1242
33 Ga0070666_10167003 3300005335 Bacteria 1540
34 Ga0070666_10325589 3300005335 Bacteria 1097
35 Ga0070666_11110697 3300005335 Bacteria 588
36 Ga0070680_100011270 3300005336 Bacteria 6913
37 Ga0070680_100626140 3300005336 Bacteria 924
38 Ga0070680_101033550 3300005336 Bacteria 710
39 Ga0070682_100517630 3300005337 Bacteria 927
40 Ga0070682_100920800 3300005337 Bacteria 720
41 Ga0068868_100085849 3300005338 Bacteria 2529
42 Ga0068868_100191188 3300005338 Bacteria 1702
43 Ga0068868_100248676 3300005338 Bacteria 1496
44 Ga0068868_100732985 3300005338 Bacteria 887
45 Ga0070660_100011977 3300005339 Bacteria 6187
46 Ga0070660_100083949 3300005339 Bacteria 2503
47 Ga0070660_100095438 3300005339 Bacteria 2351
48 Ga0070660_100190229 3300005339 Bacteria 1662
49 Ga0070660_100319081 3300005339 Bacteria 1276
50 Ga0070660_101817143 3300005339 Bacteria 519
51 Ga0070689_101306116 3300005340 Unclassified 653
52 Ga0070691_10009252 3300005341 Bacteria 4502
53 Ga0070687_100396124 3300005343 Unclassified 904
54 Ga0070661_100003585 3300005344 Bacteria 10686
55 Ga0070661_100012237 3300005344 Bacteria 6000
56 Ga0070661_100057125 3300005344 Bacteria 2860
57 Ga0070661_100094351 3300005344 Bacteria 2217
58 Ga0070661_100665968 3300005344 Bacteria 846
59 Ga0070661_100938993 3300005344 Bacteria 715
60 Ga0070661_101004042 3300005344 Bacteria 692
61 Ga0070668_100556063 3300005347 Bacteria 999
62 Ga0070668_100583999 3300005347 Bacteria 976
63 Ga0070668_101016011 3300005347 Bacteria 746
64 Ga0070669_100137288 3300005353 Bacteria 1882
65 Ga0070675_100019332 3300005354 Bacteria 5427
66 Ga0070675_100128281 3300005354 Bacteria 2159
67 Ga0070675_100170985 3300005354 Bacteria 1874
68 Ga0070671_100001535 3300005355 Bacteria 17343
69 Ga0070671_100007827 3300005355 Bacteria 8540
70 Ga0070671_100030377 3300005355 Bacteria 4459
71 Ga0070671_100037439 3300005355 Bacteria 4023
72 Ga0070671_100190618 3300005355 Bacteria 1738
73 Ga0070671_100529164 3300005355 Bacteria 1015
74 Ga0070671_100660094 3300005355 Bacteria 906
75 Ga0070674_100027278 3300005356 Bacteria 3742
76 Ga0070674_100140571 3300005356 Bacteria 1811
77 Ga0070674_100305452 3300005356 Bacteria 1270
78 Ga0070674_100313577 3300005356 Bacteria 1255
79 Ga0070674_100318034 3300005356 Bacteria 1247
80 Ga0070674_100518313 3300005356 Bacteria 995
81 Ga0070673_100000590 3300005364 Bacteria 19738
82 Ga0070673_100014748 3300005364 Bacteria 5460
83 Ga0070673_100055835 3300005364 Bacteria 3113
84 Ga0070673_100085262 3300005364 Bacteria 2571
85 Ga0070673_100623014 3300005364 Bacteria 986
86 Ga0070688_101116504 3300005365 Unclassified 631
87 Ga0070659_100013059 3300005366 Bacteria 6177
88 Ga0070659_100416396 3300005366 Bacteria 1136
89 Ga0070659_100480225 3300005366 Bacteria 1057
90 Ga0070659_102056813 3300005366 Bacteria 513
91 Ga0070667_100028788 3300005367 Bacteria 4625
92 Ga0070667_100325901 3300005367 Bacteria 1387
93 Ga0070667_100851533 3300005367 Bacteria 848
94 Ga0070701_11048318 3300005438 Unclassified 571
95 Ga0070663_100016740 3300005455 Bacteria 4771
96 Ga0070663_100040202 3300005455 Bacteria 3272
97 Ga0070663_100305680 3300005455 Bacteria 1274
98 Ga0070663_100347881 3300005455 Bacteria 1199
99 Ga0070663_100749869 3300005455 Bacteria 833
100 Ga0070678_100013101 3300005456 Bacteria 5185
101 Ga0070678_100019694 3300005456 Bacteria 4407
102 Ga0070678_100051721 3300005456 Bacteria 2979
103 Ga0070678_100073316 3300005456 Bacteria 2569
104 Ga0070678_100647485 3300005456 Bacteria 947
105 Ga0070678_101005155 3300005456 Bacteria 767
106 Ga0070662_100006577 3300005457 Bacteria 7499
107 Ga0070662_100007068 3300005457 Bacteria 7263
108 Ga0070662_100050542 3300005457 Bacteria 2999
109 Ga0070662_100064786 3300005457 Bacteria 2677
110 Ga0070662_100130341 3300005457 Bacteria 1938
111 Ga0070662_100146366 3300005457 Bacteria 1835
112 Ga0070662_101728753 3300005457 Unclassified 540
113 Ga0070681_10964411 3300005458 Bacteria 772
114 Ga0068867_100019003 3300005459 Bacteria 4892
115 Ga0068867_100087911 3300005459 Bacteria 2354
116 Ga0068867_100088704 3300005459 Bacteria 2344
117 Ga0070679_100234134 3300005530 Bacteria 1796
118 Ga0070679_100384581 3300005530 Bacteria 1350
119 Ga0070679_100532348 3300005530 Bacteria 1119
120 Ga0070684_100002928 3300005535 Bacteria 12687
121 Ga0070684_100006344 3300005535 Bacteria 9137
122 Ga0068853_100009683 3300005539 Bacteria 7769
123 Ga0068853_100023556 3300005539 Bacteria 5156
124 Ga0068853_100148512 3300005539 Bacteria 2108
125 Ga0068853_101472971 3300005539 Bacteria 659
126 Ga0070672_100009120 3300005543 Bacteria 6825
127 Ga0070672_100040941 3300005543 Bacteria 3559
128 Ga0070672_100079925 3300005543 Bacteria 2618
129 Ga0070672_100138011 3300005543 Bacteria 2009
130 Ga0070672_100288556 3300005543 Bacteria 1389
131 Ga0070672_100303553 3300005543 Bacteria 1354
132 Ga0070686_100046875 3300005544 Bacteria 2730
133 Ga0070665_100002033 3300005548 Bacteria 22765
134 Ga0070665_100102397 3300005548 Bacteria 2867
135 Ga0068855_100075713 3300005563 Bacteria 3907
136 Ga0068855_100097713 3300005563 Bacteria 3383
137 Ga0068855_100255039 3300005563 Bacteria 1956
138 Ga0068855_100527029 3300005563 Bacteria 1281
139 Ga0068855_100715329 3300005563 Bacteria 1070
140 Ga0068855_101118720 3300005563 Bacteria 822
141 Ga0068855_101354988 3300005563 Unclassified 735
142 Ga0070664_100008813 3300005564 Bacteria 8175
143 Ga0070664_100027914 3300005564 Bacteria 4694
144 Ga0070664_100054180 3300005564 Bacteria 3402
145 Ga0070664_100471921 3300005564 Bacteria 1154
146 Ga0070664_100513971 3300005564 Bacteria 1105
147 Ga0070664_100640462 3300005564 Bacteria 987
148 Ga0070664_101004732 3300005564 Bacteria 784
149 Ga0070664_102030525 3300005564 Unclassified 546
150 Ga0068857_100001542 3300005577 Bacteria 18443
151 Ga0068857_100009896 3300005577 Bacteria 8279
152 Ga0068857_100134746 3300005577 Bacteria 2230
153 Ga0068857_100467777 3300005577 Bacteria 1180
154 Ga0068854_100001932 3300005578 Bacteria 12640
155 Ga0068854_100007038 3300005578 Bacteria 7179
156 Ga0068854_100008980 3300005578 Bacteria 6441
157 Ga0068854_100070139 3300005578 Bacteria 2561
158 Ga0068854_100106349 3300005578 Bacteria 2111
159 Ga0068854_100306049 3300005578 Bacteria 1287
160 Ga0068856_100074538 3300005614 Bacteria 3360
161 Ga0068856_100119659 3300005614 Bacteria 2635
162 Ga0068856_100190305 3300005614 Bacteria 2066
163 Ga0068856_100571332 3300005614 Bacteria 1152
164 Ga0070702_100201523 3300005615 Bacteria 1318
165 Ga0068852_100006345 3300005616 Bacteria 8535
166 Ga0068852_100341949 3300005616 Bacteria 1459
167 Ga0068852_100858916 3300005616 Unclassified 923
168 Ga0068852_101921236 3300005616 Unclassified 614
169 Ga0068852_102725891 3300005616 Unclassified 513
170 Ga0068859_100045620 3300005617 Bacteria 4403
171 Ga0068864_100085796 3300005618 Bacteria 2768
172 Ga0068864_100718321 3300005618 Bacteria 977
173 Ga0068864_101068830 3300005618 Bacteria 802
174 Ga0068866_10003876 3300005718 Bacteria 6134
175 Ga0068866_10004832 3300005718 Bacteria 5533
176 Ga0068866_10044100 3300005718 Bacteria 2230
177 Ga0068866_10725075 3300005718 Bacteria 684
178 Ga0068861_100842250 3300005719 Bacteria 864
179 Ga0068851_10093090 3300005834 Bacteria 1589
180 Ga0068851_10558242 3300005834 Bacteria 693
181 Ga0068851_10876375 3300005834 Unclassified 561
182 Ga0068870_10127333 3300005840 Bacteria 1475
183 Ga0068870_11089000 3300005840 Bacteria 574
184 Ga0068863_100005004 3300005841 Bacteria 13068
185 Ga0068863_100006008 3300005841 Bacteria 11903
186 Ga0068863_101220594 3300005841 Bacteria 758
187 Ga0068858_102578412 3300005842 Unclassified 502
188 Ga0068860_100069822 3300005843 Bacteria 3340
189 Ga0068860_101170860 3300005843 Bacteria 789
190 Ga0097621_100004134 3300006237 Bacteria 10062
191 Ga0097621_100345046 3300006237 Bacteria 1323
192 Ga0097621_100374805 3300006237 Bacteria 1270
193 Ga0068871_100016408 3300006358 Bacteria 5576
194 Ga0068871_101647362 3300006358 Bacteria 608
195 Ga0068865_100017730 3300006881 Bacteria 4583
196 Ga0068865_100024691 3300006881 Bacteria 3946
197 Ga0068865_100281570 3300006881 Bacteria 1324
198 Ga0068865_100438300 3300006881 Bacteria 1078
199 Ga0097620_100045621 3300006931 Bacteria 4403
200 Ga0105240_10026437 3300009093 Bacteria 7614
201 Ga0105240_10399019 3300009093 Bacteria 1549
202 Ga0105240_11018596 3300009093 Bacteria 885
203 Ga0105245_10033856 3300009098 Bacteria 4528
204 Ga0105245_10090796 3300009098 Bacteria 2810
205 Ga0105245_10154676 3300009098 Bacteria 2171
206 Ga0105245_13086771 3300009098 Unclassified 516
207 Ga0105247_10150454 3300009101 Bacteria 1533
208 Ga0105243_10035308 3300009148 Bacteria 3876
209 Ga0105243_10463369 3300009148 Bacteria 1192
210 Ga0105241_10081863 3300009174 Bacteria 2530
211 Ga0105241_10134107 3300009174 Bacteria 2008
212 Ga0105241_10337279 3300009174 Bacteria 1305
213 Ga0105241_12494681 3300009174 Unclassified 518
214 Ga0105242_10025554 3300009176 Bacteria 4675
215 Ga0105242_10407726 3300009176 Bacteria 1270
216 Ga0105248_10094779 3300009177 Bacteria 3361
217 Ga0105248_10147985 3300009177 Bacteria 2650
218 Ga0105248_10425860 3300009177 Bacteria 1495
219 Ga0105237_10010306 3300009545 Bacteria 9957
220 Ga0105238_10048182 3300009551 Bacteria 4295
221 Ga0105238_10598419 3300009551 Bacteria 1110
222 Ga0105246_10629831 3300011119 Bacteria 931
223 Ga0157373_10084265 3300013100 Bacteria 2241
224 Ga0157373_10287752 3300013100 Bacteria 1165
225 Ga0157373_10330951 3300013100 Bacteria 1085
226 Ga0157371_10019332 3300013102 Bacteria 5026
227 Ga0157371_10130234 3300013102 Bacteria 1790
228 Ga0157371_10181863 3300013102 Bacteria 1504
229 Ga0157371_10444409 3300013102 Bacteria 953
230 Ga0157370_10000809 3300013104 Bacteria 39519
231 Ga0157370_10030507 3300013104 Bacteria 5282
232 Ga0157370_10427297 3300013104 Bacteria 1218
233 Ga0157370_11103761 3300013104 Bacteria 717
234 Ga0157369_10054572 3300013105 Bacteria 4315
235 Ga0157369_10093726 3300013105 Bacteria 3205
236 Ga0157374_10004105 3300013296 Bacteria 12227
237 Ga0157374_10307108 3300013296 Bacteria 1570
238 Ga0157374_11484578 3300013296 Bacteria 701
239 Ga0157378_10020481 3300013297 Bacteria 5814
240 Ga0157378_10363345 3300013297 Bacteria 1417
241 Ga0157378_10492517 3300013297 Bacteria 1223
242 Ga0157378_11078727 3300013297 Unclassified 839
243 Ga0163162_10060690 3300013306 Bacteria 3817
244 Ga0163162_10123947 3300013306 Bacteria 2689
245 Ga0163162_10198436 3300013306 Bacteria 2135
246 Ga0163162_10610321 3300013306 Bacteria 1217
247 Ga0163162_10783145 3300013306 Bacteria 1072
248 Ga0157372_10025612 3300013307 Bacteria 6418
249 Ga0157372_10065006 3300013307 Bacteria 4095
250 Ga0157372_10637092 3300013307 Bacteria 1242
251 Ga0157372_10998310 3300013307 Bacteria 969
252 Ga0157375_10013028 3300013308 Bacteria 7389
253 Ga0157375_10246348 3300013308 Bacteria 1947
254 Ga0157375_11396187 3300013308 Bacteria 825
255 Ga0163163_10233013 3300014325 Bacteria 1891
256 Ga0163163_10629850 3300014325 Unclassified 1136
257 Ga0157380_13513115 3300014326 Bacteria 502
258 Ga0182008_10650491 3300014497 Unclassified 597
259 Ga0157377_10090479 3300014745 Bacteria 1806
260 Ga0157379_10085378 3300014968 Bacteria 2829
261 Ga0157376_10143990 3300014969 Bacteria 2141
262 Ga0163161_10082040 3300017792 Bacteria 2375
263 Ga0197907_10516875 3300020069 Unclassified 632
264 Ga0206353_11498432 3300020082 Bacteria 1179
265 Ga0213876_10139140 3300021384 Bacteria 1291
266 Ga0207697_10025893 3300025315 Bacteria 2398
267 Ga0207656_10058142 3300025321 Bacteria 1688
268 Ga0207682_10003866 3300025893 Bacteria 6416
269 Ga0207682_10071908 3300025893 Bacteria 1467
270 Ga0207682_10106840 3300025893 Bacteria 1229
271 Ga0207682_10213011 3300025893 Bacteria 892
272 Ga0207688_10027109 3300025901 Bacteria 3151
273 Ga0207688_10143984 3300025901 Bacteria 1404
274 Ga0207688_10383001 3300025901 Bacteria 870
275 Ga0207688_10659330 3300025901 Bacteria 661
276 Ga0207680_10030306 3300025903 Bacteria 3050
277 Ga0207680_10120111 3300025903 Bacteria 1717
278 Ga0207680_10264037 3300025903 Bacteria 1192
279 Ga0207647_10001001 3300025904 Bacteria 21921
280 Ga0207647_10010152 3300025904 Bacteria 6654
281 Ga0207647_10121297 3300025904 Bacteria 1541
282 Ga0207645_10041224 3300025907 Bacteria 2956
283 Ga0207645_10055130 3300025907 Bacteria 2538
284 Ga0207645_10235866 3300025907 Bacteria 1208
285 Ga0207645_10468671 3300025907 Bacteria 851
286 Ga0207643_10034986 3300025908 Bacteria 2815
287 Ga0207705_10003350 3300025909 Bacteria 12181
288 Ga0207705_10014418 3300025909 Bacteria 5689
289 Ga0207705_10046236 3300025909 Bacteria 3127
290 Ga0207654_10057882 3300025911 Bacteria 2254
291 Ga0207654_10376110 3300025911 Bacteria 983
292 Ga0207707_10130282 3300025912 Bacteria 2200
293 Ga0207695_10019266 3300025913 Bacteria 7858
294 Ga0207695_10542932 3300025913 Unclassified 1044
295 Ga0207671_10018784 3300025914 Bacteria 5297
296 Ga0207660_10020986 3300025917 Bacteria 4389
297 Ga0207660_10760444 3300025917 Bacteria 791
298 Ga0207660_11615578 3300025917 Unclassified 522
299 Ga0207662_10095965 3300025918 Bacteria 1831
300 Ga0207662_10150510 3300025918 Bacteria 1480
301 Ga0207657_10000594 3300025919 Bacteria 38336
302 Ga0207657_10017472 3300025919 Bacteria 6875
303 Ga0207657_10056187 3300025919 Bacteria 3397
304 Ga0207657_10073681 3300025919 Bacteria 2885
305 Ga0207657_10122209 3300025919 Bacteria 2142
306 Ga0207649_10008616 3300025920 Bacteria 5567
307 Ga0207649_10030954 3300025920 Bacteria 3175
308 Ga0207649_10043223 3300025920 Bacteria 2754
309 Ga0207649_10064443 3300025920 Bacteria 2317
310 Ga0207649_10236418 3300025920 Bacteria 1309
311 Ga0207649_10524087 3300025920 Bacteria 904
312 Ga0207652_10208651 3300025921 Bacteria 1759
313 Ga0207652_10444222 3300025921 Bacteria 1169
314 Ga0207681_10156299 3300025923 Bacteria 1714
315 Ga0207694_10382434 3300025924 Bacteria 1168
316 Ga0207650_10047647 3300025925 Bacteria 3158
317 Ga0207650_10118313 3300025925 Bacteria 2060
318 Ga0207650_10493728 3300025925 Bacteria 1022
319 Ga0207650_10530018 3300025925 Bacteria 986
320 Ga0207659_10013617 3300025926 Bacteria 5215
321 Ga0207659_10134531 3300025926 Bacteria 1912
322 Ga0207687_10122203 3300025927 Bacteria 1949
323 Ga0207687_10292338 3300025927 Bacteria 1310
324 Ga0207687_11022817 3300025927 Unclassified 709
325 Ga0207644_10003132 3300025931 Bacteria 10653
326 Ga0207644_10003697 3300025931 Bacteria 9918
327 Ga0207644_10005078 3300025931 Bacteria 8594
328 Ga0207644_10033234 3300025931 Bacteria 3603
329 Ga0207644_10043845 3300025931 Bacteria 3176
330 Ga0207644_10204344 3300025931 Bacteria 1559
331 Ga0207644_10447808 3300025931 Bacteria 1060
332 Ga0207690_10006094 3300025932 Bacteria 7145
333 Ga0207690_10082611 3300025932 Bacteria 2247
334 Ga0207690_10232810 3300025932 Bacteria 1415
335 Ga0207690_10323415 3300025932 Unclassified 1213
336 Ga0207706_10003893 3300025933 Bacteria 14166
337 Ga0207706_10006178 3300025933 Bacteria 11123
338 Ga0207706_10009669 3300025933 Bacteria 8852
339 Ga0207706_10010553 3300025933 Bacteria 8439
340 Ga0207706_10031300 3300025933 Bacteria 4740
341 Ga0207706_10042080 3300025933 Bacteria 4048
342 Ga0207706_10165522 3300025933 Bacteria 1943
343 Ga0207686_10093358 3300025934 Bacteria 1992
344 Ga0207686_10445548 3300025934 Bacteria 995
345 Ga0207670_11263086 3300025936 Unclassified 626
346 Ga0207669_10009397 3300025937 Bacteria 4654
347 Ga0207669_10021530 3300025937 Bacteria 3406
348 Ga0207669_10025935 3300025937 Bacteria 3179
349 Ga0207669_10082194 3300025937 Bacteria 2067
350 Ga0207669_10549887 3300025937 Unclassified 931
351 Ga0207669_10644810 3300025937 Bacteria 865
352 Ga0207704_10007995 3300025938 Bacteria 5030
353 Ga0207704_10117662 3300025938 Bacteria 1811
354 Ga0207704_10140814 3300025938 Bacteria 1687
355 Ga0207704_10932260 3300025938 Bacteria 732
356 Ga0207691_10007876 3300025940 Bacteria 10263
357 Ga0207691_10032664 3300025940 Bacteria 4852
358 Ga0207691_10034681 3300025940 Bacteria 4691
359 Ga0207691_10093281 3300025940 Bacteria 2696
360 Ga0207691_10141381 3300025940 Bacteria 2121
361 Ga0207691_10290449 3300025940 Bacteria 1406
362 Ga0207691_10631360 3300025940 Bacteria 906
363 Ga0207711_10015796 3300025941 Bacteria 6263
364 Ga0207711_10083329 3300025941 Bacteria 2797
365 Ga0207711_10149544 3300025941 Bacteria 2106
366 Ga0207711_10294512 3300025941 Bacteria 1496
367 Ga0207689_10174445 3300025942 Bacteria 1773
368 Ga0207661_10013868 3300025944 Bacteria 5889
369 Ga0207661_10054328 3300025944 Bacteria 3208
370 Ga0207661_11160972 3300025944 Bacteria 711
371 Ga0207679_10003093 3300025945 Bacteria 10301
372 Ga0207679_10060618 3300025945 Bacteria 2812
373 Ga0207679_10163628 3300025945 Bacteria 1824
374 Ga0207679_10204153 3300025945 Bacteria 1653
375 Ga0207679_10223460 3300025945 Bacteria 1585
376 Ga0207679_10313050 3300025945 Bacteria 1357
377 Ga0207679_11237928 3300025945 Unclassified 685
378 Ga0207679_11506279 3300025945 Unclassified 617
379 Ga0207667_10023065 3300025949 Bacteria 6858
380 Ga0207667_10173495 3300025949 Bacteria 2216
381 Ga0207667_10895459 3300025949 Bacteria 879
382 Ga0207667_10998852 3300025949 Bacteria 824
383 Ga0207651_10001472 3300025960 Bacteria 10708
384 Ga0207651_10108526 3300025960 Bacteria 2077
385 Ga0207651_10168591 3300025960 Bacteria 1724
386 Ga0207651_10279662 3300025960 Bacteria 1378
387 Ga0207651_11740117 3300025960 Unclassified 561
388 Ga0207668_10023073 3300025972 Bacteria 3994
389 Ga0207668_10579863 3300025972 Bacteria 975
390 Ga0207640_10007188 3300025981 Bacteria 6136
391 Ga0207640_10021763 3300025981 Bacteria 3826
392 Ga0207640_10576246 3300025981 Bacteria 949
393 Ga0207640_10602479 3300025981 Bacteria 930
394 Ga0207658_10025967 3300025986 Bacteria 4103
395 Ga0207658_10111130 3300025986 Bacteria 2167
396 Ga0207658_10615812 3300025986 Bacteria 976
397 Ga0207658_12008378 3300025986 Bacteria 526
398 Ga0207677_10009185 3300026023 Bacteria 5553
399 Ga0207677_10175881 3300026023 Bacteria 1679
400 Ga0207677_10445524 3300026023 Bacteria 1108
401 Ga0207703_10089634 3300026035 Bacteria 2583
402 Ga0207703_10847543 3300026035 Bacteria 874
403 Ga0207639_10024788 3300026041 Bacteria 4346
404 Ga0207639_10277647 3300026041 Bacteria 1472
405 Ga0207639_10341068 3300026041 Bacteria 1336
406 Ga0207678_10032074 3300026067 Bacteria 4580
407 Ga0207678_10054208 3300026067 Bacteria 3453
408 Ga0207678_10061987 3300026067 Bacteria 3216
409 Ga0207678_10065652 3300026067 Bacteria 3116
410 Ga0207678_10070715 3300026067 Bacteria 2992
411 Ga0207702_10017062 3300026078 Bacteria 6006
412 Ga0207702_10195420 3300026078 Bacteria 1872
413 Ga0207702_10492186 3300026078 Bacteria 1194
414 Ga0207702_11650011 3300026078 Unclassified 634
415 Ga0207641_10337681 3300026088 Bacteria 1433
416 Ga0207641_10614154 3300026088 Bacteria 1065
417 Ga0207648_10007110 3300026089 Bacteria 11043
418 Ga0207648_10226074 3300026089 Bacteria 1664
419 Ga0207648_10702753 3300026089 Bacteria 937
420 Ga0207676_10056503 3300026095 Bacteria 3086
421 Ga0207676_10654356 3300026095 Bacteria 1014
422 Ga0207676_10692615 3300026095 Bacteria 986
423 Ga0207674_10000065 3300026116 Bacteria 109485
424 Ga0207674_10004380 3300026116 Bacteria 17015
425 Ga0207674_10009547 3300026116 Bacteria 11069
426 Ga0207674_10324533 3300026116 Bacteria 1489
427 Ga0207674_10573044 3300026116 Unclassified 1090
428 Ga0207675_100342051 3300026118 Bacteria 1465
429 Ga0207683_10004731 3300026121 Bacteria 11729
430 Ga0207683_10005286 3300026121 Bacteria 11078
431 Ga0207683_10014941 3300026121 Bacteria 6609
432 Ga0207683_10025205 3300026121 Bacteria 5128
433 Ga0207683_10068955 3300026121 Bacteria 3123
434 Ga0207683_11005987 3300026121 Bacteria 774
435 Ga0207698_10005578 3300026142 Bacteria 7784
436 Ga0207698_10129887 3300026142 Bacteria 2151
437 Ga0207698_11025413 3300026142 Bacteria 836
438 Ga0207698_11620116 3300026142 Unclassified 663
439 Ga0268266_10005388 3300028379 Bacteria 11942
440 Ga0268266_10542676 3300028379 Bacteria 1113
441 Ga0268264_10089293 3300028381 Bacteria 2653
442 Ga0268264_11001328 3300028381 Bacteria 842
443 Ga0307408_100015718 3300031548 Bacteria 5043
444 Ga0307408_100082792 3300031548 Bacteria 2402
445 Ga0307408_102252460 3300031548 Bacteria 527
446 Ga0307405_10116176 3300031731 Bacteria 1822
447 Ga0307405_10319994 3300031731 Bacteria 1184
448 Ga0307413_10033129 3300031824 Bacteria 2937
449 Ga0307413_10152868 3300031824 Bacteria 1611
450 Ga0307413_10858974 3300031824 Bacteria 767
451 Ga0307410_10095969 3300031852 Bacteria 2115
452 Ga0307410_10242325 3300031852 Bacteria 1398
453 Ga0307410_10414417 3300031852 Bacteria 1091
454 Ga0307410_10489171 3300031852 Bacteria 1010
455 Ga0307406_10882750 3300031901 Bacteria 760
456 Ga0307406_10973363 3300031901 Bacteria 726
457 Ga0307406_11576478 3300031901 Unclassified 579
458 Ga0307407_10056964 3300031903 Bacteria 2265
459 Ga0307407_11085932 3300031903 Bacteria 621
460 Ga0307412_10079128 3300031911 Bacteria 2267
461 Ga0307412_10685929 3300031911 Bacteria 877
462 Ga0307409_100033315 3300031995 Bacteria 3747
463 Ga0307409_100147761 3300031995 Bacteria 2035
464 Ga0307409_100578688 3300031995 Bacteria 1106
465 Ga0307409_102431328 3300031995 Bacteria 553
466 Ga0307416_100045256 3300032002 Bacteria 3464
467 Ga0307416_100094118 3300032002 Bacteria 2582
468 Ga0307414_10009672 3300032004 Bacteria 5551
469 Ga0307414_10416489 3300032004 Bacteria 1170
470 Ga0307411_10029973 3300032005 Bacteria 3330
471 Ga0307411_10130866 3300032005 Bacteria 1833
472 Ga0307415_100066143 3300032126 Bacteria 2521
473 Ga0307415_100204520 3300032126 Bacteria 1570
474 Ga0307415_100339977 3300032126 Bacteria 1259
475 Ga0307415_100463672 3300032126 Bacteria 1098
476 Ga0373951_0235603 3300035091 Bacteria 545
477 Ga0373942_0060204 3300035207 Bacteria 1087
478 Ga0373931_0098631 3300035691 Bacteria 1640
479 Ga0373933_1050869 3300035724 Unclassified 536
480 Ga0395899_0003120 3300037312 Bacteria 13202
481 Ga0395899_0016688 3300037312 Bacteria 5598
482 Ga0395899_0024928 3300037312 Bacteria 4517
483 Ga0395899_0045730 3300037312 Bacteria 3261
484 Ga0395899_0330040 3300037312 Bacteria 1025
485 Ga0395899_0334880 3300037312 Bacteria 1016
486 Ga0395899_0403159 3300037312 Bacteria 904
487 Ga0395899_0437369 3300037312 Bacteria 859
488 Ga0395900_0008210 3300037418 Bacteria 10747
489 Ga0395900_0009559 3300037418 Bacteria 9940
490 Ga0395900_0032817 3300037418 Bacteria 5341
491 Ga0395900_0034732 3300037418 Bacteria 5194
492 Ga0395900_0077210 3300037418 Bacteria 3422
493 Ga0395900_0085545 3300037418 Bacteria 3240
494 Ga0395900_0144078 3300037418 Bacteria 2438
495 Ga0395900_0173554 3300037418 Bacteria 2193
496 Ga0395900_0178048 3300037418 Bacteria 2162
497 Ga0395900_0235290 3300037418 Bacteria 1840
498 Ga0395900_0477115 3300037418 Bacteria 1200
499 Ga0395898_0009147 3300037466 Bacteria 10437
500 Ga0395898_0019039 3300037466 Bacteria 6990
501 Ga0395898_0062358 3300037466 Bacteria 3620
502 Ga0395898_0195883 3300037466 Bacteria 1930
503 Ga0395898_0252577 3300037466 Bacteria 1681
504 Ga0395898_0511953 3300037466 Bacteria 1141
505 Ga0395898_0525904 3300037466 Bacteria 1124
506 Ga0395898_0557221 3300037466 Bacteria 1088
507 Ga0395898_1141303 3300037466 Bacteria 712
508 Ga0395905_0000793 3300037471 Bacteria 41518
509 Ga0395905_0000958 3300037471 Bacteria 37063
510 Ga0395905_0007674 3300037471 Bacteria 10705
511 Ga0395905_0009274 3300037471 Bacteria 9626
512 Ga0395905_0012159 3300037471 Bacteria 8290
513 Ga0395905_0020132 3300037471 Bacteria 6321
514 Ga0395905_0050185 3300037471 Bacteria 3910
515 Ga0395905_0054097 3300037471 Bacteria 3756
516 Ga0395905_0084250 3300037471 Bacteria 2978
517 Ga0395905_0194976 3300037471 Bacteria 1899
518 Ga0395905_0215290 3300037471 Bacteria 1799
519 Ga0395905_0455905 3300037471 Bacteria 1177
520 Ga0395905_0681132 3300037471 Bacteria 930
521 Ga0395901_0006716 3300038443 Bacteria 11626
522 Ga0395901_0017008 3300038443 Bacteria 7412
523 Ga0395901_0034057 3300038443 Bacteria 5259
524 Ga0395901_0040667 3300038443 Bacteria 4816
525 Ga0395901_0053254 3300038443 Bacteria 4205
526 Ga0395901_0064227 3300038443 Bacteria 3821
527 Ga0395901_0080812 3300038443 Bacteria 3394
528 Ga0395901_0117925 3300038443 Bacteria 2789
529 Ga0395901_0122675 3300038443 Bacteria 2731
530 Ga0395901_0127012 3300038443 Bacteria 2679
531 Ga0395901_0139981 3300038443 Bacteria 2543
532 Ga0395901_0197603 3300038443 Bacteria 2108
533 Ga0395901_0270210 3300038443 Bacteria 1768
534 Ga0395901_0810692 3300038443 Bacteria 924
535 Ga0395901_1897709 3300038443 Unclassified 543
536 Ga0436365_0727625 3300039437 Bacteria 1964
537 Ga0436365_1036392 3300039437 Bacteria 7696
538 Ga0439432_111341 3300042006 Bacteria 814
539 Ga0439449_0102563 3300042007 Bacteria 1058
540 Ga0439458_0000959 3300042157 Bacteria 7429
541 Ga0439458_0049719 3300042157 Bacteria 1033
542 Ga0466965_0953499 3300044683 Bacteria 502
543 Ga0466966_0027521 3300044684 Bacteria 3706
544 Ga0466966_0129823 3300044684 Bacteria 1544
545 Ga0466961_0143546 3300044693 Bacteria 1494
546 Ga0466961_0560105 3300044693 Unclassified 688
547 Ga0466963_0010948 3300044694 Bacteria 5511
548 Ga0466963_0012160 3300044694 Bacteria 5261
549 Ga0466963_0590693 3300044694 Bacteria 784
550 Ga0466968_0268705 3300044735 Bacteria 814
551 Ga0466957_0093488 3300044842 Bacteria 1887
552 Ga0466957_0525805 3300044842 Bacteria 822
553 Ga0466960_1044623 3300044901 Unclassified 503
554 Ga0466959_0003226 3300045049 Bacteria 10610
555 Ga0466959_0396292 3300045049 Bacteria 939
556 Ga0466958_0030635 3300045836 Bacteria 3197
557 Ga0466958_0127189 3300045836 Bacteria 1598
558 Ga0466958_0298026 3300045836 Bacteria 1035
559 Ga0466958_0440563 3300045836 Bacteria 843
560 Ga0466958_0565516 3300045836 Unclassified 739
561 Ga0466967_0009691 3300045976 Bacteria 7168
562 Ga0466967_0066457 3300045976 Bacteria 3213
563 Ga0466967_0467962 3300045976 Unclassified 1234
564 Ga0495598_0036950 3300046537 Bacteria 1406
565 Ga0495621_0003464 3300046539 Bacteria 4356
566 Ga0495633_0133161 3300046558 Bacteria 1150
567 Ga0495659_0141886 3300046664 Bacteria 959
568 Ga0495669_0355964 3300046684 Bacteria 708
569 Ga0495669_0416343 3300046684 Bacteria 651
570 Ga0495670_0038992 3300046691 Bacteria 2369
571 Ga0495687_102889 3300047443 Bacteria 1067
572 Ga0495677_0121285 3300047445 Bacteria 997
573 Ga0496100_0067696 3300048903 Bacteria 2372
574 Ga0496100_0200429 3300048903 Bacteria 1454
575 Ga0496101_0003296 3300048904 Bacteria 10044
576 Ga0496101_0184623 3300048904 Bacteria 1607
577 Ga0496101_1300168 3300048904 Bacteria 569
578 Ga0496102_0052927 3300048905 Bacteria 3700
579 Ga0496102_0351729 3300048905 Bacteria 1387
580 Ga0496103_0010484 3300048906 Bacteria 5485
581 Ga0496103_0646136 3300048906 Unclassified 672
582 Ga0496104_0178292 3300048907 Bacteria 2035
583 Ga0496104_1218879 3300048907 Unclassified 656
584 Ga0496105_0007221 3300048908 Bacteria 8579
585 Ga0496106_0007771 3300048909 Bacteria 7935
586 Ga0496106_0079054 3300048909 Bacteria 2525
587 Ga0496106_0451472 3300048909 Bacteria 1033
588 Ga0496107_0001984 3300048910 Bacteria 13030
589 Ga0496107_0139535 3300048910 Bacteria 1792
590 Ga0496107_0640971 3300048910 Bacteria 784
591 Ga0496108_0009981 3300048911 Bacteria 7695
592 Ga0496109_0122450 3300048912 Bacteria 2423
593 Ga0496109_0997084 3300048912 Bacteria 775
594 Ga0496110_0003761 3300048913 Bacteria 11691
595 Ga0496111_0002605 3300048914 Bacteria 10918
596 Ga0496112_0025215 3300048915 Bacteria 5707
597 Ga0496112_0554527 3300048915 Bacteria 1083
598 Ga0496113_0001095 3300048916 Bacteria 14658
599 Ga0496113_0274505 3300048916 Bacteria 1348
600 Ga0501067_0019617 3300049583 Bacteria 3743
601 Ga0501201_014834 3300049651 Bacteria 789
602 Ga0501223_025960 3300049663 Bacteria 1140
603 Ga0501224_064947 3300049664 Bacteria 573
604 Ga0501227_116264 3300049665 Unclassified 720
605 Ga0501233_139705 3300049668 Bacteria 668
606 Ga0501235_122673 3300049669 Bacteria 651
607 Ga0501239_030582 3300049672 Bacteria 705
608 Ga0501249_022186 3300049679 Bacteria 1389
609 Ga0501221_158567 3300049704 Unclassified 604
610 Ga0501080_0286394 3300049742 Bacteria 1497
611 Ga0501262_060044 3300049759 Bacteria 605
612 Ga0501263_009312 3300049760 Bacteria 1187
613 Ga0501267_015400 3300049764 Bacteria 809
614 Ga0501268_006533 3300049765 Bacteria 1716
615 Ga0501273_021041 3300049770 Bacteria 884
616 Ga0501212_010885 3300049851 Bacteria 1304
617 nmdc:mga07m45_453794_c1 3300050496 Bacteria 743
618 Ga0466962_0041121 3300061719 Bacteria 2212
619 Ga0105242_10106926
620 JGI24747J21853_1008497
621 JGI24740J21852_10001189
622 JGI24739J22299_10002907
623 JGI24737J22298_10007110
624 JGI24737J22298_10070190
625 JGI24737J22298_10105277
626 JGI24743J22301_10000629
627 JGI24743J22301_10023960
628 JGI24735J21928_10074341
629 JGI24744J21845_10000141
630 JGI24742J22300_10008635
631 rootL2_10169548
632 Ga0070658_10015071
633 Ga0070658_10828889
634 Ga0070658_11586612
635 Ga0070676_10375583
636 Ga0070683_100013737
637 Ga0070683_100037860
638 Ga0070683_101339074
639 Ga0070690_100005416
640 Ga0070690_100206539
641 Ga0070670_100085951
642 Ga0070670_100147428
643 Ga0070670_100346567
644 Ga0070670_101004974
645 Ga0070670_101659757
646 Ga0070677_10001871
647 Ga0070677_10037334
648 Ga0070677_10135285
649 Ga0068869_100290432
650 Ga0068869_100328648
651 Ga0070666_10167003
652 Ga0070666_10325589
653 Ga0070666_11110697
654 Ga0070680_100011270
655 Ga0070680_100626140
656 Ga0070680_101033550
657 Ga0070682_100517630
658 Ga0070682_100920800
659 Ga0068868_100085849
660 Ga0068868_100191188
661 Ga0068868_100248676
662 Ga0068868_100732985
663 Ga0070660_100011977
664 Ga0070660_100083949
665 Ga0070660_100095438
666 Ga0070660_100190229
667 Ga0070660_100319081
668 Ga0070660_101817143
669 Ga0070689_101306116
670 Ga0070691_10009252
671 Ga0070687_100396124
672 Ga0070661_100003585
673 Ga0070661_100012237
674 Ga0070661_100057125
675 Ga0070661_100094351
676 Ga0070661_100665968
677 Ga0070661_100938993
678 Ga0070661_101004042
679 Ga0070668_100556063
680 Ga0070668_100583999
681 Ga0070668_101016011
682 Ga0070669_100137288
683 Ga0070675_100019332
684 Ga0070675_100128281
685 Ga0070675_100170985
686 Ga0070671_100001535
687 Ga0070671_100007827
688 Ga0070671_100030377
689 Ga0070671_100037439
690 Ga0070671_100190618
691 Ga0070671_100529164
692 Ga0070671_100660094
693 Ga0070674_100027278
694 Ga0070674_100140571
695 Ga0070674_100305452
696 Ga0070674_100313577
697 Ga0070674_100318034
698 Ga0070674_100518313
699 Ga0070673_100000590
700 Ga0070673_100014748
701 Ga0070673_100055835
702 Ga0070673_100085262
703 Ga0070673_100623014
704 Ga0070688_101116504
705 Ga0070659_100013059
706 Ga0070659_100416396
707 Ga0070659_100480225
708 Ga0070659_102056813
709 Ga0070667_100028788
710 Ga0070667_100325901
711 Ga0070667_100851533
712 Ga0070701_11048318
713 Ga0070663_100016740
714 Ga0070663_100040202
715 Ga0070663_100305680
716 Ga0070663_100347881
717 Ga0070663_100749869
718 Ga0070678_100013101
719 Ga0070678_100019694
720 Ga0070678_100051721
721 Ga0070678_100073316
722 Ga0070678_100647485
723 Ga0070678_101005155
724 Ga0070662_100006577
725 Ga0070662_100007068
726 Ga0070662_100050542
727 Ga0070662_100064786
728 Ga0070662_100130341
729 Ga0070662_100146366
730 Ga0070662_101728753
731 Ga0070681_10964411
732 Ga0068867_100019003
733 Ga0068867_100087911
734 Ga0068867_100088704
735 Ga0070679_100234134
736 Ga0070679_100384581
737 Ga0070679_100532348
738 Ga0070684_100002928
739 Ga0070684_100006344
740 Ga0068853_100009683
741 Ga0068853_100023556
742 Ga0068853_100148512
743 Ga0068853_101472971
744 Ga0070672_100009120
745 Ga0070672_100040941
746 Ga0070672_100079925
747 Ga0070672_100138011
748 Ga0070672_100288556
749 Ga0070672_100303553
750 Ga0070686_100046875
751 Ga0070665_100002033
752 Ga0070665_100102397
753 Ga0068855_100075713
754 Ga0068855_100097713
755 Ga0068855_100255039
756 Ga0068855_100527029
757 Ga0068855_100715329
758 Ga0068855_101118720
759 Ga0068855_101354988
760 Ga0070664_100008813
761 Ga0070664_100027914
762 Ga0070664_100054180
763 Ga0070664_100471921
764 Ga0070664_100513971
765 Ga0070664_100640462
766 Ga0070664_101004732
767 Ga0070664_102030525
768 Ga0068857_100001542
769 Ga0068857_100009896
770 Ga0068857_100134746
771 Ga0068857_100467777
772 Ga0068854_100001932
773 Ga0068854_100007038
774 Ga0068854_100008980
775 Ga0068854_100070139
776 Ga0068854_100106349
777 Ga0068854_100306049
778 Ga0068856_100074538
779 Ga0068856_100119659
780 Ga0068856_100190305
781 Ga0068856_100571332
782 Ga0070702_100201523
783 Ga0068852_100006345
784 Ga0068852_100341949
785 Ga0068852_100858916
786 Ga0068852_101921236
787 Ga0068852_102725891
788 Ga0068859_100045620
789 Ga0068864_100085796
790 Ga0068864_100718321
791 Ga0068864_101068830
792 Ga0068866_10003876
793 Ga0068866_10004832
794 Ga0068866_10044100
795 Ga0068866_10725075
796 Ga0068861_100842250
797 Ga0068851_10093090
798 Ga0068851_10558242
799 Ga0068851_10876375
800 Ga0068870_10127333
801 Ga0068870_11089000
802 Ga0068863_100005004
803 Ga0068863_100006008
804 Ga0068863_101220594
805 Ga0068858_102578412
806 Ga0068860_100069822
807 Ga0068860_101170860
808 Ga0097621_100004134
809 Ga0097621_100345046
810 Ga0097621_100374805
811 Ga0068871_100016408
812 Ga0068871_101647362
813 Ga0068865_100017730
814 Ga0068865_100024691
815 Ga0068865_100281570
816 Ga0068865_100438300
817 Ga0097620_100045621
818 Ga0105240_10026437
819 Ga0105240_10399019
820 Ga0105240_11018596
821 Ga0105245_10033856
822 Ga0105245_10090796
823 Ga0105245_10154676
824 Ga0105245_13086771
825 Ga0105247_10150454
826 Ga0105243_10035308
827 Ga0105243_10463369
828 Ga0105241_10081863
829 Ga0105241_10134107
830 Ga0105241_10337279
831 Ga0105241_12494681
832 Ga0105242_10025554
833 Ga0105242_10407726
834 Ga0105248_10094779
835 Ga0105248_10147985
836 Ga0105248_10425860
837 Ga0105237_10010306
838 Ga0105238_10048182
839 Ga0105238_10598419
840 Ga0105246_10629831
841 Ga0157373_10084265
842 Ga0157373_10287752
843 Ga0157373_10330951
844 Ga0157371_10019332
845 Ga0157371_10130234
846 Ga0157371_10181863
847 Ga0157371_10444409
848 Ga0157370_10000809
849 Ga0157370_10030507
850 Ga0157370_10427297
851 Ga0157370_11103761
852 Ga0157369_10054572
853 Ga0157369_10093726
854 Ga0157374_10004105
855 Ga0157374_10307108
856 Ga0157374_11484578
857 Ga0157378_10020481
858 Ga0157378_10363345
859 Ga0157378_10492517
860 Ga0157378_11078727
861 Ga0163162_10060690
862 Ga0163162_10123947
863 Ga0163162_10198436
864 Ga0163162_10610321
865 Ga0163162_10783145
866 Ga0157372_10025612
867 Ga0157372_10065006
868 Ga0157372_10637092
869 Ga0157372_10998310
870 Ga0157375_10013028
871 Ga0157375_10246348
872 Ga0157375_11396187
873 Ga0163163_10233013
874 Ga0163163_10629850
875 Ga0157380_13513115
876 Ga0182008_10650491
877 Ga0157377_10090479
878 Ga0157379_10085378
879 Ga0157376_10143990
880 Ga0163161_10082040
881 Ga0197907_10516875
882 Ga0206353_11498432
883 Ga0213876_10139140
884 Ga0207697_10025893
885 Ga0207656_10058142
886 Ga0207682_10003866
887 Ga0207682_10071908
888 Ga0207682_10106840
889 Ga0207682_10213011
890 Ga0207688_10027109
891 Ga0207688_10143984
892 Ga0207688_10383001
893 Ga0207688_10659330
894 Ga0207680_10030306
895 Ga0207680_10120111
896 Ga0207680_10264037
897 Ga0207647_10001001
898 Ga0207647_10010152
899 Ga0207647_10121297
900 Ga0207645_10041224
901 Ga0207645_10055130
902 Ga0207645_10235866
903 Ga0207645_10468671
904 Ga0207643_10034986
905 Ga0207705_10003350
906 Ga0207705_10014418
907 Ga0207705_10046236
908 Ga0207654_10057882
909 Ga0207654_10376110
910 Ga0207707_10130282
911 Ga0207695_10019266
912 Ga0207695_10542932
913 Ga0207671_10018784
914 Ga0207660_10020986
915 Ga0207660_10760444
916 Ga0207660_11615578
917 Ga0207662_10095965
918 Ga0207662_10150510
919 Ga0207657_10000594
920 Ga0207657_10017472
921 Ga0207657_10056187
922 Ga0207657_10073681
923 Ga0207657_10122209
924 Ga0207649_10008616
925 Ga0207649_10030954
926 Ga0207649_10043223
927 Ga0207649_10064443
928 Ga0207649_10236418
929 Ga0207649_10524087
930 Ga0207652_10208651
931 Ga0207652_10444222
932 Ga0207681_10156299
933 Ga0207694_10382434
934 Ga0207650_10047647
935 Ga0207650_10118313
936 Ga0207650_10493728
937 Ga0207650_10530018
938 Ga0207659_10013617
939 Ga0207659_10134531
940 Ga0207687_10122203
941 Ga0207687_10292338
942 Ga0207687_11022817
943 Ga0207644_10003132
944 Ga0207644_10003697
945 Ga0207644_10005078
946 Ga0207644_10033234
947 Ga0207644_10043845
948 Ga0207644_10204344
949 Ga0207644_10447808
950 Ga0207690_10006094
951 Ga0207690_10082611
952 Ga0207690_10232810
953 Ga0207690_10323415
954 Ga0207706_10003893
955 Ga0207706_10006178
956 Ga0207706_10009669
957 Ga0207706_10010553
958 Ga0207706_10031300
959 Ga0207706_10042080
960 Ga0207706_10165522
961 Ga0207686_10093358
962 Ga0207686_10445548
963 Ga0207670_11263086
964 Ga0207669_10009397
965 Ga0207669_10021530
966 Ga0207669_10025935
967 Ga0207669_10082194
968 Ga0207669_10549887
969 Ga0207669_10644810
970 Ga0207704_10007995
971 Ga0207704_10117662
972 Ga0207704_10140814
973 Ga0207704_10932260
974 Ga0207691_10007876
975 Ga0207691_10032664
976 Ga0207691_10034681
977 Ga0207691_10093281
978 Ga0207691_10141381
979 Ga0207691_10290449
980 Ga0207691_10631360
981 Ga0207711_10015796
982 Ga0207711_10083329
983 Ga0207711_10149544
984 Ga0207711_10294512
985 Ga0207689_10174445
986 Ga0207661_10013868
987 Ga0207661_10054328
988 Ga0207661_11160972
989 Ga0207679_10003093
990 Ga0207679_10060618
991 Ga0207679_10163628
992 Ga0207679_10204153
993 Ga0207679_10223460
994 Ga0207679_10313050
995 Ga0207679_11237928
996 Ga0207679_11506279
997 Ga0207667_10023065
998 Ga0207667_10173495
999 Ga0207667_10895459
1000 Ga0207667_10998852
1001 Ga0207651_10001472
1002 Ga0207651_10108526
1003 Ga0207651_10168591
1004 Ga0207651_10279662
1005 Ga0207651_11740117
1006 Ga0207668_10023073
1007 Ga0207668_10579863
1008 Ga0207640_10007188
1009 Ga0207640_10021763
1010 Ga0207640_10576246
1011 Ga0207640_10602479
1012 Ga0207658_10025967
1013 Ga0207658_10111130
1014 Ga0207658_10615812
1015 Ga0207658_12008378
1016 Ga0207677_10009185
1017 Ga0207677_10175881
1018 Ga0207677_10445524
1019 Ga0207703_10089634
1020 Ga0207703_10847543
1021 Ga0207639_10024788
1022 Ga0207639_10277647
1023 Ga0207639_10341068
1024 Ga0207678_10032074
1025 Ga0207678_10054208
1026 Ga0207678_10061987
1027 Ga0207678_10065652
1028 Ga0207678_10070715
1029 Ga0207702_10017062
1030 Ga0207702_10195420
1031 Ga0207702_10492186
1032 Ga0207702_11650011
1033 Ga0207641_10337681
1034 Ga0207641_10614154
1035 Ga0207648_10007110
1036 Ga0207648_10226074
1037 Ga0207648_10702753
1038 Ga0207676_10056503
1039 Ga0207676_10654356
1040 Ga0207676_10692615
1041 Ga0207674_10000065
1042 Ga0207674_10004380
1043 Ga0207674_10009547
1044 Ga0207674_10324533
1045 Ga0207674_10573044
1046 Ga0207675_100342051
1047 Ga0207683_10004731
1048 Ga0207683_10005286
1049 Ga0207683_10014941
1050 Ga0207683_10025205
1051 Ga0207683_10068955
1052 Ga0207683_11005987
1053 Ga0207698_10005578
1054 Ga0207698_10129887
1055 Ga0207698_11025413
1056 Ga0207698_11620116
1057 Ga0268266_10005388
1058 Ga0268266_10542676
1059 Ga0268264_10089293
1060 Ga0268264_11001328
1061 Ga0307408_100015718
1062 Ga0307408_100082792
1063 Ga0307408_102252460
1064 Ga0307405_10116176
1065 Ga0307405_10319994
1066 Ga0307413_10033129
1067 Ga0307413_10152868
1068 Ga0307413_10858974
1069 Ga0307410_10095969
1070 Ga0307410_10242325
1071 Ga0307410_10414417
1072 Ga0307410_10489171
1073 Ga0307406_10882750
1074 Ga0307406_10973363
1075 Ga0307406_11576478
1076 Ga0307407_10056964
1077 Ga0307407_11085932
1078 Ga0307412_10079128
1079 Ga0307412_10685929
1080 Ga0307409_100033315
1081 Ga0307409_100147761
1082 Ga0307409_100578688
1083 Ga0307409_102431328
1084 Ga0307416_100045256
1085 Ga0307416_100094118
1086 Ga0307414_10009672
1087 Ga0307414_10416489
1088 Ga0307411_10029973
1089 Ga0307411_10130866
1090 Ga0307415_100066143
1091 Ga0307415_100204520
1092 Ga0307415_100339977
1093 Ga0307415_100463672
1094 Ga0373951_0235603
1095 Ga0373942_0060204
1096 Ga0373931_0098631
1097 Ga0373933_1050869
1098 Ga0395899_0003120
1099 Ga0395899_0016688
1100 Ga0395899_0024928
1101 Ga0395899_0045730
1102 Ga0395899_0330040
1103 Ga0395899_0334880
1104 Ga0395899_0403159
1105 Ga0395899_0437369
1106 Ga0395900_0008210
1107 Ga0395900_0009559
1108 Ga0395900_0032817
1109 Ga0395900_0034732
1110 Ga0395900_0077210
1111 Ga0395900_0085545
1112 Ga0395900_0144078
1113 Ga0395900_0173554
1114 Ga0395900_0178048
1115 Ga0395900_0235290
1116 Ga0395900_0477115
1117 Ga0395898_0009147
1118 Ga0395898_0019039
1119 Ga0395898_0062358
1120 Ga0395898_0195883
1121 Ga0395898_0252577
1122 Ga0395898_0511953
1123 Ga0395898_0525904
1124 Ga0395898_0557221
1125 Ga0395898_1141303
1126 Ga0395905_0000793
1127 Ga0395905_0000958
1128 Ga0395905_0007674
1129 Ga0395905_0009274
1130 Ga0395905_0012159
1131 Ga0395905_0020132
1132 Ga0395905_0050185
1133 Ga0395905_0054097
1134 Ga0395905_0084250
1135 Ga0395905_0194976
1136 Ga0395905_0215290
1137 Ga0395905_0455905
1138 Ga0395905_0681132
1139 Ga0395901_0006716
1140 Ga0395901_0017008
1141 Ga0395901_0034057
1142 Ga0395901_0040667
1143 Ga0395901_0053254
1144 Ga0395901_0064227
1145 Ga0395901_0080812
1146 Ga0395901_0117925
1147 Ga0395901_0122675
1148 Ga0395901_0127012
1149 Ga0395901_0139981
1150 Ga0395901_0197603
1151 Ga0395901_0270210
1152 Ga0395901_0810692
1153 Ga0395901_1897709
1154 Ga0436365_0727625
1155 Ga0436365_1036392
1156 Ga0439432_111341
1157 Ga0439449_0102563
1158 Ga0439458_0000959
1159 Ga0439458_0049719
1160 Ga0466965_0953499
1161 Ga0466966_0027521
1162 Ga0466966_0129823
1163 Ga0466961_0143546
1164 Ga0466961_0560105
1165 Ga0466963_0010948
1166 Ga0466963_0012160
1167 Ga0466963_0590693
1168 Ga0466968_0268705
1169 Ga0466957_0093488
1170 Ga0466957_0525805
1171 Ga0466960_1044623
1172 Ga0466959_0003226
1173 Ga0466959_0396292
1174 Ga0466958_0030635
1175 Ga0466958_0127189
1176 Ga0466958_0298026
1177 Ga0466958_0440563
1178 Ga0466958_0565516
1179 Ga0466967_0009691
1180 Ga0466967_0066457
1181 Ga0466967_0467962
1182 Ga0495598_0036950
1183 Ga0495621_0003464
1184 Ga0495633_0133161
1185 Ga0495659_0141886
1186 Ga0495669_0355964
1187 Ga0495669_0416343
1188 Ga0495670_0038992
1189 Ga0495687_102889
1190 Ga0495677_0121285
1191 Ga0496100_0067696
1192 Ga0496100_0200429
1193 Ga0496101_0003296
1194 Ga0496101_0184623
1195 Ga0496101_1300168
1196 Ga0496102_0052927
1197 Ga0496102_0351729
1198 Ga0496103_0010484
1199 Ga0496103_0646136
1200 Ga0496104_0178292
1201 Ga0496104_1218879
1202 Ga0496105_0007221
1203 Ga0496106_0007771
1204 Ga0496106_0079054
1205 Ga0496106_0451472
1206 Ga0496107_0001984
1207 Ga0496107_0139535
1208 Ga0496107_0640971
1209 Ga0496108_0009981
1210 Ga0496109_0122450
1211 Ga0496109_0997084
1212 Ga0496110_0003761
1213 Ga0496111_0002605
1214 Ga0496112_0025215
1215 Ga0496112_0554527
1216 Ga0496113_0001095
1217 Ga0496113_0274505
1218 Ga0501067_0019617
1219 Ga0501201_014834
1220 Ga0501223_025960
1221 Ga0501224_064947
1222 Ga0501227_116264
1223 Ga0501233_139705
1224 Ga0501235_122673
1225 Ga0501239_030582
1226 Ga0501249_022186
1227 Ga0501221_158567
1228 Ga0501080_0286394
1229 Ga0501262_060044
1230 Ga0501263_009312
1231 Ga0501267_015400
1232 Ga0501268_006533
1233 Ga0501273_021041
1234 Ga0501212_010885
1235 nmdc:mga07m45_453794_c1
1236 Ga0466962_0041121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map