F469730

General Info

Members Datasets Scaffolds Average Seq Length
618 225 1236 280

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10217292|Ga0157369_102172922
Length 322
Sequence LVTGSARNWTVQGAIVEEPKYVEEKDRSSTRRLLMCDSDNHQGYIVDTSFSRRSVVLTMSAAVAAGSLPTAAFAANVVEADVMVPTPDGTADAALFHPAGSGSWPAVLMWPDILGLRPVFRDMGRRLAAEGYVVLVPNPFYRTKRAPIVTGPFDFNDPKQFQPLMALKATLTDAAVDRDAAAFITFLDKQKQTDRRKGAGVQGYCFAGPLAFHTAAVRSDRIRAVGSFHGGGLVTKDASSPHLLIPRTKASFVVAIARNDDQKQPEAKDVLKAEFAKAKRPAVVEVYPADHGWCVPGGPTYDKAAAERAWAELLRLYRANLV

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
153 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
211 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
212 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
213 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
214 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
215 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
216 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
217 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
218 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
219 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
220 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
223 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
225 2895880812 Frankia sp. BMG5.11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.69
Nodule 0
Rhizoplane 7.28
Rhizosphere 85.92
Stem 0
Stem Tuber 0
Unclassified 5.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10217292 3300013105 Bacteria 2002
2 JGI24737J22298_10008234 3300001990 Bacteria 3498
3 JGI24737J22298_10021040 3300001990 Bacteria 2080
4 JGI24744J21845_10002826 3300002077 Bacteria 3548
5 rootL2_10289674 3300003322 Bacteria 1294
6 Ga0055531_10001248 3300003794 Bacteria 19310
7 Ga0070658_10001059 3300005327 Bacteria 23534
8 Ga0070658_10006084 3300005327 Bacteria 9787
9 Ga0070658_10020029 3300005327 Bacteria 5358
10 Ga0070658_10020760 3300005327 Bacteria 5263
11 Ga0070658_10025538 3300005327 Bacteria 4736
12 Ga0070658_10056439 3300005327 Bacteria 3192
13 Ga0070658_10119996 3300005327 Bacteria 2185
14 Ga0070658_10255098 3300005327 Bacteria 1488
15 Ga0070658_10321940 3300005327 Bacteria 1320
16 Ga0070676_10061340 3300005328 Bacteria 2235
17 Ga0070676_10070923 3300005328 Bacteria 2092
18 Ga0070683_100085980 3300005329 Bacteria 2949
19 Ga0070683_100303010 3300005329 Bacteria 1520
20 Ga0070683_100697537 3300005329 Bacteria 972
21 Ga0070690_100001800 3300005330 Bacteria 11342
22 Ga0070690_100026980 3300005330 Bacteria 3548
23 Ga0070670_100017903 3300005331 Bacteria 6082
24 Ga0070670_100031180 3300005331 Bacteria 4591
25 Ga0070670_100093117 3300005331 Bacteria 2592
26 Ga0070670_100366220 3300005331 Bacteria 1268
27 Ga0068869_100212353 3300005334 Bacteria 1530
28 Ga0070666_10001045 3300005335 Bacteria 16951
29 Ga0070666_10026930 3300005335 Bacteria 3761
30 Ga0070666_10364148 3300005335 Unclassified 1036
31 Ga0070680_100029024 3300005336 Bacteria 4442
32 Ga0068868_100015054 3300005338 Bacteria 5712
33 Ga0068868_100159482 3300005338 Bacteria 1862
34 Ga0068868_100161776 3300005338 Bacteria 1849
35 Ga0068868_100190287 3300005338 Bacteria 1706
36 Ga0070660_100003986 3300005339 Bacteria 10200
37 Ga0070660_100004104 3300005339 Bacteria 10048
38 Ga0070660_100111165 3300005339 Bacteria 2180
39 Ga0070660_100225599 3300005339 Bacteria 1523
40 Ga0070689_100066698 3300005340 Bacteria 2804
41 Ga0070661_100041941 3300005344 Bacteria 3339
42 Ga0070661_100042259 3300005344 Bacteria 3327
43 Ga0070661_100056034 3300005344 Bacteria 2887
44 Ga0070661_100073998 3300005344 Bacteria 2508
45 Ga0070661_100085296 3300005344 Bacteria 2333
46 Ga0070661_100235644 3300005344 Bacteria 1408
47 Ga0070692_10003972 3300005345 Bacteria 6104
48 Ga0070669_100129092 3300005353 Bacteria 1937
49 Ga0070669_100169715 3300005353 Bacteria 1700
50 Ga0070669_100206498 3300005353 Bacteria 1548
51 Ga0070669_100213648 3300005353 Unclassified 1523
52 Ga0070669_100268235 3300005353 Bacteria 1364
53 Ga0070675_100013002 3300005354 Bacteria 6536
54 Ga0070675_100032550 3300005354 Bacteria 4220
55 Ga0070675_100037514 3300005354 Bacteria 3948
56 Ga0070675_100264561 3300005354 Bacteria 1508
57 Ga0070675_100585028 3300005354 Bacteria 1012
58 Ga0070671_100010266 3300005355 Bacteria 7517
59 Ga0070671_100018400 3300005355 Bacteria 5675
60 Ga0070671_100024687 3300005355 Bacteria 4924
61 Ga0070671_100058075 3300005355 Bacteria 3221
62 Ga0070671_100228896 3300005355 Bacteria 1577
63 Ga0070671_100264407 3300005355 Bacteria 1462
64 Ga0070674_100010535 3300005356 Bacteria 5595
65 Ga0070674_100124859 3300005356 Bacteria 1910
66 Ga0070674_100185632 3300005356 Bacteria 1596
67 Ga0070673_100001909 3300005364 Bacteria 12510
68 Ga0070673_100020190 3300005364 Bacteria 4801
69 Ga0070673_100048061 3300005364 Bacteria 3324
70 Ga0070673_100123811 3300005364 Bacteria 2161
71 Ga0070673_100151646 3300005364 Bacteria 1963
72 Ga0070688_100152805 3300005365 Bacteria 1579
73 Ga0070659_100004083 3300005366 Bacteria 10401
74 Ga0070659_100019097 3300005366 Bacteria 5185
75 Ga0070659_100022239 3300005366 Bacteria 4838
76 Ga0070659_100185031 3300005366 Bacteria 1710
77 Ga0070659_100230125 3300005366 Bacteria 1532
78 Ga0070659_100323991 3300005366 Unclassified 1288
79 Ga0070667_100000857 3300005367 Bacteria 28344
80 Ga0070667_100003694 3300005367 Bacteria 13020
81 Ga0070667_100019293 3300005367 Bacteria 5657
82 Ga0070667_100181948 3300005367 Bacteria 1859
83 Ga0070714_100030270 3300005435 Bacteria 4504
84 Ga0070714_100070168 3300005435 Bacteria 3028
85 Ga0070714_100075954 3300005435 Bacteria 2916
86 Ga0070714_100226964 3300005435 Bacteria 1719
87 Ga0070714_100265854 3300005435 Unclassified 1589
88 Ga0070713_100011839 3300005436 Bacteria 6373
89 Ga0070713_100046348 3300005436 Bacteria 3566
90 Ga0070663_100154355 3300005455 Bacteria 1763
91 Ga0070663_100156049 3300005455 Bacteria 1754
92 Ga0070663_100462580 3300005455 Unclassified 1047
93 Ga0070678_100001234 3300005456 Bacteria 13521
94 Ga0070678_100019494 3300005456 Bacteria 4424
95 Ga0070678_100052899 3300005456 Bacteria 2951
96 Ga0070678_100726276 3300005456 Bacteria 897
97 Ga0070662_100015597 3300005457 Bacteria 5093
98 Ga0070662_100017621 3300005457 Bacteria 4819
99 Ga0070662_100020766 3300005457 Bacteria 4478
100 Ga0070662_100093360 3300005457 Bacteria 2264
101 Ga0070662_100095143 3300005457 Bacteria 2244
102 Ga0070662_100107612 3300005457 Bacteria 2120
103 Ga0070662_100138151 3300005457 Bacteria 1886
104 Ga0070681_10147881 3300005458 Bacteria 2277
105 Ga0068867_100060421 3300005459 Bacteria 2811
106 Ga0068867_100136965 3300005459 Bacteria 1910
107 Ga0070679_100037449 3300005530 Bacteria 4819
108 Ga0070679_100133431 3300005530 Bacteria 2464
109 Ga0068853_100034106 3300005539 Bacteria 4319
110 Ga0068853_100248786 3300005539 Bacteria 1630
111 Ga0070672_100026170 3300005543 Bacteria 4337
112 Ga0070672_100059515 3300005543 Bacteria 3006
113 Ga0070672_100180947 3300005543 Bacteria 1757
114 Ga0070672_100185779 3300005543 Bacteria 1733
115 Ga0070672_100217470 3300005543 Bacteria 1602
116 Ga0070672_100392648 3300005543 Bacteria 1188
117 Ga0070686_100151856 3300005544 Bacteria 1623
118 Ga0070693_100127461 3300005547 Bacteria 1586
119 Ga0070665_100034422 3300005548 Bacteria 5094
120 Ga0070665_100037953 3300005548 Bacteria 4843
121 Ga0070665_100091291 3300005548 Bacteria 3051
122 Ga0070665_100301143 3300005548 Bacteria 1606
123 Ga0068855_100213191 3300005563 Bacteria 2169
124 Ga0070664_100002315 3300005564 Bacteria 15306
125 Ga0070664_100022184 3300005564 Bacteria 5237
126 Ga0070664_100024717 3300005564 Bacteria 4972
127 Ga0070664_100029485 3300005564 Bacteria 4575
128 Ga0070664_100057828 3300005564 Bacteria 3297
129 Ga0070664_100118355 3300005564 Bacteria 2317
130 Ga0070664_100496951 3300005564 Bacteria 1124
131 Ga0068857_100050574 3300005577 Bacteria 3686
132 Ga0068857_100270268 3300005577 Bacteria 1562
133 Ga0068854_100009206 3300005578 Bacteria 6373
134 Ga0068854_100086793 3300005578 Bacteria 2320
135 Ga0068854_100159802 3300005578 Bacteria 1744
136 Ga0068854_100197903 3300005578 Bacteria 1578
137 Ga0068854_100443517 3300005578 Bacteria 1083
138 Ga0068856_100076785 3300005614 Bacteria 3309
139 Ga0068856_100234544 3300005614 Bacteria 1850
140 Ga0068856_100264497 3300005614 Bacteria 1736
141 Ga0068856_100345351 3300005614 Bacteria 1507
142 Ga0068856_100803274 3300005614 Unclassified 960
143 Ga0068852_100163654 3300005616 Bacteria 2079
144 Ga0068859_100006190 3300005617 Bacteria 12161
145 Ga0068859_100038961 3300005617 Bacteria 4767
146 Ga0068859_100069559 3300005617 Bacteria 3555
147 Ga0068859_100382553 3300005617 Bacteria 1503
148 Ga0068859_100393359 3300005617 Bacteria 1482
149 Ga0068864_100032976 3300005618 Bacteria 4401
150 Ga0068864_100060139 3300005618 Bacteria 3289
151 Ga0068864_100160752 3300005618 Bacteria 2042
152 Ga0068864_100239581 3300005618 Bacteria 1680
153 Ga0068866_10015478 3300005718 Bacteria 3389
154 Ga0068866_10080558 3300005718 Bacteria 1747
155 Ga0068861_100187380 3300005719 Bacteria 1727
156 Ga0068851_10026323 3300005834 Bacteria 2858
157 Ga0068851_10049970 3300005834 Bacteria 2123
158 Ga0068851_10227502 3300005834 Bacteria 1050
159 Ga0068863_100015484 3300005841 Bacteria 7330
160 Ga0068863_100026544 3300005841 Bacteria 5524
161 Ga0068858_100005035 3300005842 Bacteria 12951
162 Ga0068858_100019797 3300005842 Bacteria 6291
163 Ga0068858_100265161 3300005842 Bacteria 1634
164 Ga0068858_100329652 3300005842 Bacteria 1460
165 Ga0068858_100393547 3300005842 Bacteria 1331
166 Ga0068860_100152494 3300005843 Bacteria 2226
167 Ga0068860_100369405 3300005843 Bacteria 1414
168 Ga0068862_100177065 3300005844 Unclassified 1912
169 Ga0081539_10004451 3300005985 Bacteria 15469
170 Ga0081539_10050872 3300005985 Bacteria 2340
171 Ga0070717_10012793 3300006028 Bacteria 6407
172 Ga0070712_100033981 3300006175 Bacteria 3454
173 Ga0075366_10141539 3300006195 Bacteria 1454
174 Ga0097621_100034871 3300006237 Bacteria 4016
175 Ga0097621_100042725 3300006237 Bacteria 3652
176 Ga0068871_100051719 3300006358 Bacteria 3327
177 Ga0068871_100128813 3300006358 Bacteria 2144
178 Ga0068871_100575355 3300006358 Bacteria 1022
179 Ga0068865_100005217 3300006881 Bacteria 7857
180 Ga0068865_100103774 3300006881 Unclassified 2086
181 Ga0068865_100428959 3300006881 Bacteria 1089
182 Ga0097620_100006190 3300006931 Bacteria 12161
183 Ga0097620_100038961 3300006931 Bacteria 4767
184 Ga0097620_100069554 3300006931 Bacteria 3555
185 Ga0097620_100382563 3300006931 Bacteria 1503
186 Ga0097620_100393395 3300006931 Bacteria 1482
187 Ga0105240_10090105 3300009093 Bacteria 3750
188 Ga0105240_10511509 3300009093 Bacteria 1334
189 Ga0105240_10522133 3300009093 Unclassified 1317
190 Ga0105245_10007757 3300009098 Bacteria 9400
191 Ga0105242_10004543 3300009176 Bacteria 10768
192 Ga0105248_10001194 3300009177 Bacteria 29026
193 Ga0105248_10008933 3300009177 Bacteria 11019
194 Ga0105248_10086078 3300009177 Bacteria 3536
195 Ga0105248_10113286 3300009177 Bacteria 3059
196 Ga0105248_10124558 3300009177 Bacteria 2907
197 Ga0105248_10137380 3300009177 Bacteria 2757
198 Ga0105248_10162663 3300009177 Bacteria 2517
199 Ga0105248_10605582 3300009177 Bacteria 1236
200 Ga0105237_10001877 3300009545 Bacteria 26810
201 Ga0105238_10012233 3300009551 Bacteria 8654
202 Ga0105238_10034457 3300009551 Bacteria 5151
203 Ga0105246_10023205 3300011119 Bacteria 4012
204 Ga0157373_10012832 3300013100 Bacteria 6153
205 Ga0157371_10041642 3300013102 Bacteria 3277
206 Ga0157371_10088924 3300013102 Bacteria 2187
207 Ga0157371_10254706 3300013102 Bacteria 1264
208 Ga0157370_10127652 3300013104 Bacteria 2374
209 Ga0157370_10419440 3300013104 Bacteria 1231
210 Ga0157369_10348903 3300013105 Bacteria 1537
211 Ga0157374_10041046 3300013296 Bacteria 4261
212 Ga0157374_10055435 3300013296 Bacteria 3700
213 Ga0157374_10313874 3300013296 Bacteria 1552
214 Ga0157378_10035100 3300013297 Bacteria 4434
215 Ga0157378_10062468 3300013297 Bacteria 3325
216 Ga0157378_10092602 3300013297 Bacteria 2750
217 Ga0163162_10019956 3300013306 Bacteria 6583
218 Ga0163162_10075864 3300013306 Bacteria 3423
219 Ga0163162_10241983 3300013306 Bacteria 1935
220 Ga0163162_10353388 3300013306 Bacteria 1602
221 Ga0157372_10461113 3300013307 Unclassified 1481
222 Ga0157375_10019396 3300013308 Bacteria 6184
223 Ga0157375_10050167 3300013308 Bacteria 4093
224 Ga0163163_10001746 3300014325 Bacteria 18307
225 Ga0163163_10007049 3300014325 Bacteria 9879
226 Ga0163163_10008334 3300014325 Bacteria 9204
227 Ga0163163_10215168 3300014325 Bacteria 1970
228 Ga0157377_10130159 3300014745 Bacteria 1536
229 Ga0157376_10005869 3300014969 Bacteria 8614
230 Ga0163161_10003580 3300017792 Bacteria 10884
231 Ga0163161_10178685 3300017792 Bacteria 1626
232 Ga0163161_10200354 3300017792 Bacteria 1538
233 Ga0213876_10065767 3300021384 Bacteria 1913
234 Ga0209026_1001854 3300025250 Bacteria 8643
235 Ga0209758_1001337 3300025297 Bacteria 29833
236 Ga0209050_1000245 3300025298 Bacteria 116929
237 Ga0209257_1000227 3300025304 Bacteria 133512
238 Ga0207697_10004411 3300025315 Bacteria 6727
239 Ga0207697_10020178 3300025315 Bacteria 2729
240 Ga0207656_10098024 3300025321 Bacteria 1340
241 Ga0207656_10100407 3300025321 Bacteria 1326
242 Ga0207688_10005110 3300025901 Bacteria 7131
243 Ga0207680_10033439 3300025903 Bacteria 2933
244 Ga0207680_10141528 3300025903 Bacteria 1595
245 Ga0207647_10010997 3300025904 Bacteria 6366
246 Ga0207647_10040483 3300025904 Bacteria 2934
247 Ga0207647_10052980 3300025904 Bacteria 2502
248 Ga0207647_10121076 3300025904 Bacteria 1543
249 Ga0207647_10127175 3300025904 Bacteria 1499
250 Ga0207699_10024816 3300025906 Bacteria 3283
251 Ga0207645_10032495 3300025907 Bacteria 3354
252 Ga0207645_10103458 3300025907 Bacteria 1839
253 Ga0207643_10027602 3300025908 Bacteria 3148
254 Ga0207705_10003040 3300025909 Bacteria 12799
255 Ga0207705_10005586 3300025909 Bacteria 9401
256 Ga0207705_10025256 3300025909 Bacteria 4241
257 Ga0207705_10035712 3300025909 Bacteria 3556
258 Ga0207705_10048770 3300025909 Bacteria 3047
259 Ga0207705_10134928 3300025909 Bacteria 1839
260 Ga0207705_10142296 3300025909 Bacteria 1792
261 Ga0207705_10149318 3300025909 Bacteria 1750
262 Ga0207707_10365769 3300025912 Bacteria 1241
263 Ga0207695_10173868 3300025913 Bacteria 2077
264 Ga0207695_10330397 3300025913 Bacteria 1413
265 Ga0207671_10002026 3300025914 Bacteria 22278
266 Ga0207693_10045355 3300025915 Bacteria 3454
267 Ga0207660_10499170 3300025917 Bacteria 987
268 Ga0207657_10001406 3300025919 Bacteria 25663
269 Ga0207657_10003658 3300025919 Bacteria 16366
270 Ga0207657_10015828 3300025919 Bacteria 7288
271 Ga0207657_10071110 3300025919 Unclassified 2947
272 Ga0207657_10077025 3300025919 Bacteria 2812
273 Ga0207657_10091710 3300025919 Bacteria 2533
274 Ga0207657_10120436 3300025919 Bacteria 2159
275 Ga0207657_10177894 3300025919 Bacteria 1721
276 Ga0207649_10047230 3300025920 Bacteria 2649
277 Ga0207649_10257072 3300025920 Bacteria 1260
278 Ga0207649_10295705 3300025920 Unclassified 1182
279 Ga0207652_10065841 3300025921 Bacteria 3139
280 Ga0207652_10073991 3300025921 Bacteria 2965
281 Ga0207652_10395914 3300025921 Unclassified 1246
282 Ga0207681_10033164 3300025923 Bacteria 3384
283 Ga0207681_10133447 3300025923 Bacteria 1839
284 Ga0207681_10277773 3300025923 Unclassified 1318
285 Ga0207694_10066456 3300025924 Bacteria 2813
286 Ga0207694_10070638 3300025924 Bacteria 2728
287 Ga0207650_10011028 3300025925 Bacteria 6213
288 Ga0207650_10102692 3300025925 Bacteria 2203
289 Ga0207650_10187172 3300025925 Bacteria 1652
290 Ga0207650_10291907 3300025925 Bacteria 1330
291 Ga0207650_10369031 3300025925 Bacteria 1184
292 Ga0207659_10066101 3300025926 Bacteria 2623
293 Ga0207700_10063371 3300025928 Bacteria 2811
294 Ga0207664_10005644 3300025929 Bacteria 8552
295 Ga0207664_10077971 3300025929 Bacteria 2686
296 Ga0207664_10079614 3300025929 Bacteria 2660
297 Ga0207644_10000761 3300025931 Bacteria 20421
298 Ga0207644_10010283 3300025931 Bacteria 6166
299 Ga0207644_10014665 3300025931 Bacteria 5250
300 Ga0207644_10036572 3300025931 Bacteria 3447
301 Ga0207644_10069891 3300025931 Bacteria 2564
302 Ga0207644_10077293 3300025931 Bacteria 2451
303 Ga0207644_10087762 3300025931 Bacteria 2312
304 Ga0207690_10011775 3300025932 Bacteria 5231
305 Ga0207690_10013627 3300025932 Bacteria 4889
306 Ga0207690_10087104 3300025932 Bacteria 2197
307 Ga0207690_10146210 3300025932 Unclassified 1748
308 Ga0207690_10382947 3300025932 Bacteria 1118
309 Ga0207706_10010665 3300025933 Bacteria 8393
310 Ga0207706_10019226 3300025933 Bacteria 6143
311 Ga0207706_10021774 3300025933 Bacteria 5754
312 Ga0207706_10051245 3300025933 Bacteria 3645
313 Ga0207706_10065599 3300025933 Bacteria 3197
314 Ga0207706_10070772 3300025933 Bacteria 3068
315 Ga0207706_10126979 3300025933 Bacteria 2243
316 Ga0207706_10182541 3300025933 Bacteria 1843
317 Ga0207706_10201559 3300025933 Bacteria 1745
318 Ga0207669_10105415 3300025937 Bacteria 1875
319 Ga0207669_10238581 3300025937 Unclassified 1346
320 Ga0207704_10013341 3300025938 Bacteria 4109
321 Ga0207704_10130282 3300025938 Bacteria 1740
322 Ga0207704_10188857 3300025938 Bacteria 1497
323 Ga0207704_10397441 3300025938 Bacteria 1086
324 Ga0207691_10003271 3300025940 Bacteria 15781
325 Ga0207691_10005219 3300025940 Bacteria 12537
326 Ga0207691_10006905 3300025940 Bacteria 10951
327 Ga0207691_10030918 3300025940 Bacteria 4999
328 Ga0207691_10076334 3300025940 Bacteria 3020
329 Ga0207711_10002037 3300025941 Bacteria 18274
330 Ga0207711_10002613 3300025941 Bacteria 15972
331 Ga0207711_10005184 3300025941 Bacteria 11040
332 Ga0207711_10009373 3300025941 Bacteria 8175
333 Ga0207711_10015088 3300025941 Bacteria 6417
334 Ga0207711_10054325 3300025941 Bacteria 3437
335 Ga0207711_10059477 3300025941 Bacteria 3290
336 Ga0207711_10097566 3300025941 Bacteria 2595
337 Ga0207711_10506164 3300025941 Bacteria 1126
338 Ga0207689_10017511 3300025942 Bacteria 6060
339 Ga0207661_10065442 3300025944 Bacteria 2951
340 Ga0207661_10130067 3300025944 Bacteria 2155
341 Ga0207679_10000689 3300025945 Bacteria 22607
342 Ga0207679_10009857 3300025945 Bacteria 6133
343 Ga0207679_10072978 3300025945 Bacteria 2595
344 Ga0207679_10148472 3300025945 Bacteria 1905
345 Ga0207667_10105356 3300025949 Bacteria 2909
346 Ga0207667_10419349 3300025949 Bacteria 1362
347 Ga0207651_10022498 3300025960 Bacteria 3855
348 Ga0207651_10025014 3300025960 Bacteria 3704
349 Ga0207651_10064909 3300025960 Bacteria 2557
350 Ga0207651_10129448 3300025960 Bacteria 1929
351 Ga0207651_10170594 3300025960 Bacteria 1715
352 Ga0207640_10025185 3300025981 Bacteria 3598
353 Ga0207640_10153553 3300025981 Bacteria 1694
354 Ga0207658_10003190 3300025986 Bacteria 11682
355 Ga0207658_10010412 3300025986 Bacteria 6317
356 Ga0207658_10163282 3300025986 Bacteria 1827
357 Ga0207658_10417390 3300025986 Bacteria 1183
358 Ga0207677_10006115 3300026023 Bacteria 6574
359 Ga0207677_10040163 3300026023 Bacteria 3082
360 Ga0207677_10221519 3300026023 Unclassified 1518
361 Ga0207703_10010377 3300026035 Bacteria 7288
362 Ga0207703_10058783 3300026035 Bacteria 3139
363 Ga0207703_10062523 3300026035 Bacteria 3049
364 Ga0207703_10122014 3300026035 Bacteria 2238
365 Ga0207639_10040171 3300026041 Bacteria 3490
366 Ga0207639_10047146 3300026041 Bacteria 3255
367 Ga0207639_10052978 3300026041 Bacteria 3094
368 Ga0207678_10008549 3300026067 Bacteria 9018
369 Ga0207678_10024269 3300026067 Bacteria 5296
370 Ga0207678_10106454 3300026067 Bacteria 2392
371 Ga0207678_10164490 3300026067 Bacteria 1894
372 Ga0207702_10062573 3300026078 Bacteria 3179
373 Ga0207641_10003872 3300026088 Bacteria 13100
374 Ga0207641_10035017 3300026088 Bacteria 4180
375 Ga0207641_10076982 3300026088 Bacteria 2885
376 Ga0207641_10108744 3300026088 Bacteria 2454
377 Ga0207641_10222938 3300026088 Bacteria 1749
378 Ga0207648_10002753 3300026089 Bacteria 18692
379 Ga0207648_10021592 3300026089 Bacteria 5786
380 Ga0207676_10025819 3300026095 Bacteria 4362
381 Ga0207676_10032848 3300026095 Bacteria 3915
382 Ga0207676_10259082 3300026095 Bacteria 1569
383 Ga0207674_10002425 3300026116 Bacteria 23551
384 Ga0207674_10133421 3300026116 Bacteria 2446
385 Ga0207674_10361705 3300026116 Bacteria 1403
386 Ga0207683_10001237 3300026121 Bacteria 23185
387 Ga0207683_10003086 3300026121 Bacteria 14553
388 Ga0207683_10040025 3300026121 Bacteria 4088
389 Ga0207683_10073761 3300026121 Bacteria 3019
390 Ga0207683_10078687 3300026121 Bacteria 2922
391 Ga0207683_10159121 3300026121 Bacteria 2041
392 Ga0207698_10036836 3300026142 Bacteria 3596
393 Ga0207698_10051932 3300026142 Bacteria 3137
394 Ga0207698_10548315 3300026142 Unclassified 1133
395 Ga0268266_10059974 3300028379 Bacteria 3278
396 Ga0268266_10133832 3300028379 Bacteria 2219
397 Ga0268264_10050550 3300028381 Bacteria 3462
398 Ga0268264_10148147 3300028381 Bacteria 2101
399 Ga0268264_10397574 3300028381 Bacteria 1323
400 Ga0307517_10121381 3300028786 Bacteria 1930
401 Ga0307513_10000816 3300031456 Bacteria 45405
402 Ga0307408_100067711 3300031548 Bacteria 2627
403 Ga0307413_10222139 3300031824 Bacteria 1381
404 Ga0307414_10060306 3300032004 Bacteria 2682
405 Ga0307510_10075119 3300033180 Bacteria 3334
406 Ga0373932_0076143 3300035112 Bacteria 1051
407 Ga0373943_0003479 3300035170 Bacteria 7167
408 Ga0373943_0093747 3300035170 Bacteria 1559
409 Ga0373961_0070450 3300035241 Unclassified 1080
410 Ga0373935_0025581 3300035692 Bacteria 3637
411 Ga0395899_0000104 3300037312 Bacteria 147238
412 Ga0395899_0000825 3300037312 Bacteria 30147
413 Ga0395899_0028259 3300037312 Bacteria 4223
414 Ga0395899_0029573 3300037312 Bacteria 4121
415 Ga0395899_0033200 3300037312 Bacteria 3876
416 Ga0395899_0062712 3300037312 Bacteria 2737
417 Ga0395899_0075087 3300037312 Bacteria 2469
418 Ga0395899_0100512 3300037312 Bacteria 2089
419 Ga0395899_0168142 3300037312 Unclassified 1545
420 Ga0395899_0331663 3300037312 Unclassified 1022
421 Ga0395900_0000031 3300037418 Bacteria 262393
422 Ga0395900_0000161 3300037418 Bacteria 110637
423 Ga0395900_0000703 3300037418 Bacteria 44559
424 Ga0395900_0016315 3300037418 Bacteria 7571
425 Ga0395900_0019594 3300037418 Bacteria 6898
426 Ga0395900_0028356 3300037418 Bacteria 5733
427 Ga0395900_0030982 3300037418 Bacteria 5494
428 Ga0395900_0031245 3300037418 Bacteria 5469
429 Ga0395900_0053026 3300037418 Bacteria 4174
430 Ga0395900_0068481 3300037418 Bacteria 3647
431 Ga0395900_0078393 3300037418 Bacteria 3394
432 Ga0395900_0078785 3300037418 Bacteria 3385
433 Ga0395900_0085071 3300037418 Bacteria 3250
434 Ga0395900_0087563 3300037418 Bacteria 3201
435 Ga0395900_0442863 3300037418 Bacteria 1256
436 Ga0395898_0000169 3300037466 Bacteria 168667
437 Ga0395898_0001777 3300037466 Bacteria 28071
438 Ga0395898_0009985 3300037466 Bacteria 9944
439 Ga0395898_0014378 3300037466 Bacteria 8134
440 Ga0395898_0025170 3300037466 Bacteria 6001
441 Ga0395898_0036094 3300037466 Bacteria 4910
442 Ga0395898_0066286 3300037466 Bacteria 3499
443 Ga0395898_0095772 3300037466 Bacteria 2851
444 Ga0395898_0218863 3300037466 Unclassified 1816
445 Ga0395898_0280600 3300037466 Bacteria 1589
446 Ga0395905_0000120 3300037471 Bacteria 130865
447 Ga0395905_0000627 3300037471 Bacteria 47256
448 Ga0395905_0000946 3300037471 Bacteria 37278
449 Ga0395905_0006189 3300037471 Bacteria 12079
450 Ga0395905_0010111 3300037471 Bacteria 9197
451 Ga0395905_0013020 3300037471 Bacteria 7991
452 Ga0395905_0015115 3300037471 Bacteria 7346
453 Ga0395905_0020139 3300037471 Bacteria 6319
454 Ga0395905_0026831 3300037471 Bacteria 5433
455 Ga0395905_0033497 3300037471 Bacteria 4825
456 Ga0395905_0050138 3300037471 Bacteria 3912
457 Ga0395905_0059903 3300037471 Bacteria 3559
458 Ga0395905_0086952 3300037471 Bacteria 2930
459 Ga0395905_0096643 3300037471 Bacteria 2773
460 Ga0395905_0130967 3300037471 Bacteria 2359
461 Ga0395905_0145649 3300037471 Bacteria 2228
462 Ga0395905_0178970 3300037471 Bacteria 1991
463 Ga0395905_0193927 3300037471 Bacteria 1905
464 Ga0395905_0203736 3300037471 Unclassified 1854
465 Ga0395905_0259458 3300037471 Bacteria 1623
466 Ga0395905_0385066 3300037471 Bacteria 1296
467 Ga0395905_0472058 3300037471 Bacteria 1153
468 Ga0395905_0536877 3300037471 Unclassified 1070
469 Ga0395905_0610113 3300037471 Bacteria 993
470 Ga0395901_0000260 3300038443 Bacteria 66084
471 Ga0395901_0000871 3300038443 Bacteria 33284
472 Ga0395901_0004433 3300038443 Bacteria 14162
473 Ga0395901_0004704 3300038443 Bacteria 13776
474 Ga0395901_0011742 3300038443 Bacteria 8879
475 Ga0395901_0024148 3300038443 Bacteria 6236
476 Ga0395901_0032283 3300038443 Bacteria 5402
477 Ga0395901_0039131 3300038443 Bacteria 4906
478 Ga0395901_0045039 3300038443 Bacteria 4577
479 Ga0395901_0048387 3300038443 Bacteria 4415
480 Ga0395901_0064460 3300038443 Bacteria 3814
481 Ga0395901_0074135 3300038443 Bacteria 3550
482 Ga0395901_0123530 3300038443 Bacteria 2720
483 Ga0395901_0210285 3300038443 Bacteria 2036
484 Ga0395901_0225402 3300038443 Bacteria 1958
485 Ga0395901_0485484 3300038443 Unclassified 1259
486 Ga0395901_0602560 3300038443 Bacteria 1107
487 Ga0395901_0604652 3300038443 Bacteria 1105
488 Ga0237819_01526 3300038705 Bacteria 5887
489 Ga0237816_03217 3300039145 Bacteria 1204
490 Ga0436365_0496393 3300039437 Bacteria 13805
491 Ga0439458_0000075 3300042157 Bacteria 18397
492 Ga0466969_0091500 3300044656 Bacteria 1441
493 Ga0466972_0154746 3300044658 Bacteria 1077
494 Ga0466972_0163689 3300044658 Bacteria 1045
495 Ga0466961_0013579 3300044693 Bacteria 5216
496 Ga0466961_0040575 3300044693 Bacteria 2984
497 Ga0466961_0138774 3300044693 Bacteria 1523
498 Ga0466963_0094291 3300044694 Bacteria 2041
499 Ga0466963_0220627 3300044694 Bacteria 1328
500 Ga0466964_0085500 3300044706 Bacteria 1362
501 Ga0453684_0343793 3300044712 Bacteria 1684
502 Ga0466970_0186884 3300044765 Bacteria 1150
503 Ga0466957_0031008 3300044842 Bacteria 3193
504 Ga0466957_0204451 3300044842 Bacteria 1298
505 Ga0466960_0077212 3300044901 Unclassified 1670
506 Ga0466959_0223682 3300045049 Bacteria 1304
507 Ga0466958_0021389 3300045836 Bacteria 3779
508 Ga0466958_0093864 3300045836 Bacteria 1858
509 Ga0466967_0335001 3300045976 Bacteria 1462
510 Ga0495638_0002342 3300046460 Bacteria 15549
511 Ga0495638_0018706 3300046460 Bacteria 4596
512 Ga0495580_0235590 3300046472 Unclassified 1256
513 Ga0495583_0000083 3300046506 Bacteria 165667
514 Ga0495610_0077880 3300046512 Unclassified 1530
515 Ga0495648_0025018 3300046524 Bacteria 4051
516 Ga0495642_0000901 3300046528 Bacteria 13933
517 Ga0495642_0035790 3300046528 Bacteria 2005
518 Ga0495642_0166913 3300046528 Unclassified 956
519 Ga0495598_0002947 3300046537 Bacteria 3569
520 Ga0495621_0000786 3300046539 Bacteria 8013
521 Ga0495621_0010182 3300046539 Bacteria 2870
522 Ga0495621_0027880 3300046539 Bacteria 1916
523 Ga0495621_0073973 3300046539 Bacteria 1260
524 Ga0495622_0003463 3300046557 Bacteria 7437
525 Ga0495668_0006029 3300046616 Bacteria 8039
526 Ga0495625_0009886 3300046660 Bacteria 7933
527 Ga0495669_0000306 3300046684 Bacteria 27112
528 Ga0495669_0094586 3300046684 Bacteria 1383
529 Ga0495669_0112518 3300046684 Bacteria 1272
530 Ga0495670_0014874 3300046691 Bacteria 3831
531 Ga0495671_0005230 3300046692 Bacteria 7626
532 Ga0495671_0029705 3300046692 Bacteria 2804
533 Ga0495672_0032500 3300047320 Bacteria 3245
534 Ga0495677_0038215 3300047445 Unclassified 1754
535 Ga0495677_0039288 3300047445 Bacteria 1730
536 Ga0495677_0090262 3300047445 Unclassified 1154
537 Ga0495673_0005675 3300047469 Bacteria 7499
538 Ga0495686_0000055 3300047472 Bacteria 255566
539 Ga0495686_0111888 3300047472 Bacteria 1636
540 Ga0495615_0004960 3300048090 Unclassified 2362
541 Ga0496100_0038915 3300048903 Bacteria 3017
542 Ga0496100_0103856 3300048903 Bacteria 1963
543 Ga0496100_0479125 3300048903 Bacteria 957
544 Ga0496100_0536783 3300048903 Bacteria 904
545 Ga0496101_0003551 3300048904 Bacteria 9725
546 Ga0496101_0005007 3300048904 Bacteria 8416
547 Ga0496101_0264151 3300048904 Bacteria 1343
548 Ga0496101_0417271 3300048904 Bacteria 1058
549 Ga0496102_0102403 3300048905 Bacteria 2662
550 Ga0496102_0111046 3300048905 Bacteria 2556
551 Ga0496102_0163043 3300048905 Bacteria 2097
552 Ga0496103_0027494 3300048906 Bacteria 3447
553 Ga0496104_0104569 3300048907 Bacteria 2713
554 Ga0496105_0026179 3300048908 Bacteria 4755
555 Ga0496106_0454251 3300048909 Unclassified 1029
556 Ga0496107_0008805 3300048910 Bacteria 6991
557 Ga0496107_0046732 3300048910 Bacteria 3116
558 Ga0496107_0090515 3300048910 Bacteria 2235
559 Ga0496108_0003970 3300048911 Bacteria 11889
560 Ga0496108_0004156 3300048911 Bacteria 11647
561 Ga0496108_0004195 3300048911 Bacteria 11607
562 Ga0496108_0020884 3300048911 Bacteria 5385
563 Ga0496108_0239155 3300048911 Bacteria 1579
564 Ga0496109_0009310 3300048912 Bacteria 8367
565 Ga0496109_0110627 3300048912 Bacteria 2554
566 Ga0496109_0171274 3300048912 Unclassified 2037
567 Ga0496109_0202470 3300048912 Bacteria 1866
568 Ga0496110_0006176 3300048913 Bacteria 9453
569 Ga0496110_0010222 3300048913 Bacteria 7626
570 Ga0496110_0028004 3300048913 Bacteria 4835
571 Ga0496110_0122187 3300048913 Bacteria 2347
572 Ga0496111_0002827 3300048914 Bacteria 10584
573 Ga0496111_0013573 3300048914 Bacteria 5547
574 Ga0496112_0020885 3300048915 Bacteria 6215
575 Ga0496112_0055034 3300048915 Bacteria 3910
576 Ga0496112_0071208 3300048915 Bacteria 3436
577 Ga0496112_0177140 3300048915 Bacteria 2097
578 Ga0496112_0258941 3300048915 Bacteria 1689
579 Ga0496113_0019492 3300048916 Bacteria 4746
580 Ga0496113_0035272 3300048916 Bacteria 3657
581 Ga0496114_0001397 3300048917 Bacteria 18340
582 Ga0496114_0009311 3300048917 Bacteria 7795
583 Ga0496114_0059879 3300048917 Bacteria 3181
584 Ga0496115_0002821 3300048918 Bacteria 12493
585 Ga0496115_0006188 3300048918 Bacteria 8752
586 Ga0496119_0187678 3300048922 Bacteria 1080
587 Ga0496122_0011153 3300048925 Bacteria 9154
588 Ga0496123_0000521 3300048926 Bacteria 66722
589 Ga0501033_0002409 3300049570 Bacteria 15915
590 Ga0501034_0038469 3300049571 Bacteria 4843
591 Ga0501047_0126498 3300049581 Bacteria 2436
592 Ga0501044_0001509 3300049823 Bacteria 27278
593 Ga0500643_000528 3300053087 Bacteria 26847
594 Ga0500643_006941 3300053087 Bacteria 4650
595 Ga0500643_054514 3300053087 Bacteria 1134
596 Ga0500641_0003300 3300053096 Bacteria 5710
597 Ga0500641_0030537 3300053096 Bacteria 2118
598 Ga0500650_0057416 3300053098 Bacteria 1815
599 Ga0500555_000253 3300053103 Bacteria 23468
600 Ga0500556_0000031 3300053104 Bacteria 156000
601 Ga0500556_0006343 3300053104 Bacteria 3355
602 Ga0500557_015416 3300053105 Bacteria 2065
603 Ga0500562_004036 3300053108 Bacteria 3699
604 Ga0500562_013197 3300053108 Bacteria 2107
605 Ga0500594_0003793 3300053118 Bacteria 3326
606 Ga0500642_0000003 3300053130 Bacteria 544899
607 Ga0500658_0013299 3300053134 Bacteria 3039
608 Ga0500568_0094551 3300053139 Bacteria 1125
609 Ga0500616_0031414 3300053153 Bacteria 2910
610 Ga0500616_0053146 3300053153 Bacteria 2127
611 Ga0500616_0112712 3300053153 Bacteria 1311
612 Ga0500622_0012256 3300053156 Bacteria 4648
613 Ga0500645_000255 3300053730 Bacteria 38915
614 Ga0500645_001612 3300053730 Bacteria 11187
615 Ga0500645_016650 3300053730 Bacteria 2311
616 Ga0500645_044540 3300053730 Bacteria 1305
617 Ga0466962_0006005 3300061719 Bacteria 5838
618 2895882148 2895880812 Bacteria 11255272
619 Ga0157369_10217292
620 JGI24737J22298_10008234
621 JGI24737J22298_10021040
622 JGI24744J21845_10002826
623 rootL2_10289674
624 Ga0055531_10001248
625 Ga0070658_10001059
626 Ga0070658_10006084
627 Ga0070658_10020029
628 Ga0070658_10020760
629 Ga0070658_10025538
630 Ga0070658_10056439
631 Ga0070658_10119996
632 Ga0070658_10255098
633 Ga0070658_10321940
634 Ga0070676_10061340
635 Ga0070676_10070923
636 Ga0070683_100085980
637 Ga0070683_100303010
638 Ga0070683_100697537
639 Ga0070690_100001800
640 Ga0070690_100026980
641 Ga0070670_100017903
642 Ga0070670_100031180
643 Ga0070670_100093117
644 Ga0070670_100366220
645 Ga0068869_100212353
646 Ga0070666_10001045
647 Ga0070666_10026930
648 Ga0070666_10364148
649 Ga0070680_100029024
650 Ga0068868_100015054
651 Ga0068868_100159482
652 Ga0068868_100161776
653 Ga0068868_100190287
654 Ga0070660_100003986
655 Ga0070660_100004104
656 Ga0070660_100111165
657 Ga0070660_100225599
658 Ga0070689_100066698
659 Ga0070661_100041941
660 Ga0070661_100042259
661 Ga0070661_100056034
662 Ga0070661_100073998
663 Ga0070661_100085296
664 Ga0070661_100235644
665 Ga0070692_10003972
666 Ga0070669_100129092
667 Ga0070669_100169715
668 Ga0070669_100206498
669 Ga0070669_100213648
670 Ga0070669_100268235
671 Ga0070675_100013002
672 Ga0070675_100032550
673 Ga0070675_100037514
674 Ga0070675_100264561
675 Ga0070675_100585028
676 Ga0070671_100010266
677 Ga0070671_100018400
678 Ga0070671_100024687
679 Ga0070671_100058075
680 Ga0070671_100228896
681 Ga0070671_100264407
682 Ga0070674_100010535
683 Ga0070674_100124859
684 Ga0070674_100185632
685 Ga0070673_100001909
686 Ga0070673_100020190
687 Ga0070673_100048061
688 Ga0070673_100123811
689 Ga0070673_100151646
690 Ga0070688_100152805
691 Ga0070659_100004083
692 Ga0070659_100019097
693 Ga0070659_100022239
694 Ga0070659_100185031
695 Ga0070659_100230125
696 Ga0070659_100323991
697 Ga0070667_100000857
698 Ga0070667_100003694
699 Ga0070667_100019293
700 Ga0070667_100181948
701 Ga0070714_100030270
702 Ga0070714_100070168
703 Ga0070714_100075954
704 Ga0070714_100226964
705 Ga0070714_100265854
706 Ga0070713_100011839
707 Ga0070713_100046348
708 Ga0070663_100154355
709 Ga0070663_100156049
710 Ga0070663_100462580
711 Ga0070678_100001234
712 Ga0070678_100019494
713 Ga0070678_100052899
714 Ga0070678_100726276
715 Ga0070662_100015597
716 Ga0070662_100017621
717 Ga0070662_100020766
718 Ga0070662_100093360
719 Ga0070662_100095143
720 Ga0070662_100107612
721 Ga0070662_100138151
722 Ga0070681_10147881
723 Ga0068867_100060421
724 Ga0068867_100136965
725 Ga0070679_100037449
726 Ga0070679_100133431
727 Ga0068853_100034106
728 Ga0068853_100248786
729 Ga0070672_100026170
730 Ga0070672_100059515
731 Ga0070672_100180947
732 Ga0070672_100185779
733 Ga0070672_100217470
734 Ga0070672_100392648
735 Ga0070686_100151856
736 Ga0070693_100127461
737 Ga0070665_100034422
738 Ga0070665_100037953
739 Ga0070665_100091291
740 Ga0070665_100301143
741 Ga0068855_100213191
742 Ga0070664_100002315
743 Ga0070664_100022184
744 Ga0070664_100024717
745 Ga0070664_100029485
746 Ga0070664_100057828
747 Ga0070664_100118355
748 Ga0070664_100496951
749 Ga0068857_100050574
750 Ga0068857_100270268
751 Ga0068854_100009206
752 Ga0068854_100086793
753 Ga0068854_100159802
754 Ga0068854_100197903
755 Ga0068854_100443517
756 Ga0068856_100076785
757 Ga0068856_100234544
758 Ga0068856_100264497
759 Ga0068856_100345351
760 Ga0068856_100803274
761 Ga0068852_100163654
762 Ga0068859_100006190
763 Ga0068859_100038961
764 Ga0068859_100069559
765 Ga0068859_100382553
766 Ga0068859_100393359
767 Ga0068864_100032976
768 Ga0068864_100060139
769 Ga0068864_100160752
770 Ga0068864_100239581
771 Ga0068866_10015478
772 Ga0068866_10080558
773 Ga0068861_100187380
774 Ga0068851_10026323
775 Ga0068851_10049970
776 Ga0068851_10227502
777 Ga0068863_100015484
778 Ga0068863_100026544
779 Ga0068858_100005035
780 Ga0068858_100019797
781 Ga0068858_100265161
782 Ga0068858_100329652
783 Ga0068858_100393547
784 Ga0068860_100152494
785 Ga0068860_100369405
786 Ga0068862_100177065
787 Ga0081539_10004451
788 Ga0081539_10050872
789 Ga0070717_10012793
790 Ga0070712_100033981
791 Ga0075366_10141539
792 Ga0097621_100034871
793 Ga0097621_100042725
794 Ga0068871_100051719
795 Ga0068871_100128813
796 Ga0068871_100575355
797 Ga0068865_100005217
798 Ga0068865_100103774
799 Ga0068865_100428959
800 Ga0097620_100006190
801 Ga0097620_100038961
802 Ga0097620_100069554
803 Ga0097620_100382563
804 Ga0097620_100393395
805 Ga0105240_10090105
806 Ga0105240_10511509
807 Ga0105240_10522133
808 Ga0105245_10007757
809 Ga0105242_10004543
810 Ga0105248_10001194
811 Ga0105248_10008933
812 Ga0105248_10086078
813 Ga0105248_10113286
814 Ga0105248_10124558
815 Ga0105248_10137380
816 Ga0105248_10162663
817 Ga0105248_10605582
818 Ga0105237_10001877
819 Ga0105238_10012233
820 Ga0105238_10034457
821 Ga0105246_10023205
822 Ga0157373_10012832
823 Ga0157371_10041642
824 Ga0157371_10088924
825 Ga0157371_10254706
826 Ga0157370_10127652
827 Ga0157370_10419440
828 Ga0157369_10348903
829 Ga0157374_10041046
830 Ga0157374_10055435
831 Ga0157374_10313874
832 Ga0157378_10035100
833 Ga0157378_10062468
834 Ga0157378_10092602
835 Ga0163162_10019956
836 Ga0163162_10075864
837 Ga0163162_10241983
838 Ga0163162_10353388
839 Ga0157372_10461113
840 Ga0157375_10019396
841 Ga0157375_10050167
842 Ga0163163_10001746
843 Ga0163163_10007049
844 Ga0163163_10008334
845 Ga0163163_10215168
846 Ga0157377_10130159
847 Ga0157376_10005869
848 Ga0163161_10003580
849 Ga0163161_10178685
850 Ga0163161_10200354
851 Ga0213876_10065767
852 Ga0209026_1001854
853 Ga0209758_1001337
854 Ga0209050_1000245
855 Ga0209257_1000227
856 Ga0207697_10004411
857 Ga0207697_10020178
858 Ga0207656_10098024
859 Ga0207656_10100407
860 Ga0207688_10005110
861 Ga0207680_10033439
862 Ga0207680_10141528
863 Ga0207647_10010997
864 Ga0207647_10040483
865 Ga0207647_10052980
866 Ga0207647_10121076
867 Ga0207647_10127175
868 Ga0207699_10024816
869 Ga0207645_10032495
870 Ga0207645_10103458
871 Ga0207643_10027602
872 Ga0207705_10003040
873 Ga0207705_10005586
874 Ga0207705_10025256
875 Ga0207705_10035712
876 Ga0207705_10048770
877 Ga0207705_10134928
878 Ga0207705_10142296
879 Ga0207705_10149318
880 Ga0207707_10365769
881 Ga0207695_10173868
882 Ga0207695_10330397
883 Ga0207671_10002026
884 Ga0207693_10045355
885 Ga0207660_10499170
886 Ga0207657_10001406
887 Ga0207657_10003658
888 Ga0207657_10015828
889 Ga0207657_10071110
890 Ga0207657_10077025
891 Ga0207657_10091710
892 Ga0207657_10120436
893 Ga0207657_10177894
894 Ga0207649_10047230
895 Ga0207649_10257072
896 Ga0207649_10295705
897 Ga0207652_10065841
898 Ga0207652_10073991
899 Ga0207652_10395914
900 Ga0207681_10033164
901 Ga0207681_10133447
902 Ga0207681_10277773
903 Ga0207694_10066456
904 Ga0207694_10070638
905 Ga0207650_10011028
906 Ga0207650_10102692
907 Ga0207650_10187172
908 Ga0207650_10291907
909 Ga0207650_10369031
910 Ga0207659_10066101
911 Ga0207700_10063371
912 Ga0207664_10005644
913 Ga0207664_10077971
914 Ga0207664_10079614
915 Ga0207644_10000761
916 Ga0207644_10010283
917 Ga0207644_10014665
918 Ga0207644_10036572
919 Ga0207644_10069891
920 Ga0207644_10077293
921 Ga0207644_10087762
922 Ga0207690_10011775
923 Ga0207690_10013627
924 Ga0207690_10087104
925 Ga0207690_10146210
926 Ga0207690_10382947
927 Ga0207706_10010665
928 Ga0207706_10019226
929 Ga0207706_10021774
930 Ga0207706_10051245
931 Ga0207706_10065599
932 Ga0207706_10070772
933 Ga0207706_10126979
934 Ga0207706_10182541
935 Ga0207706_10201559
936 Ga0207669_10105415
937 Ga0207669_10238581
938 Ga0207704_10013341
939 Ga0207704_10130282
940 Ga0207704_10188857
941 Ga0207704_10397441
942 Ga0207691_10003271
943 Ga0207691_10005219
944 Ga0207691_10006905
945 Ga0207691_10030918
946 Ga0207691_10076334
947 Ga0207711_10002037
948 Ga0207711_10002613
949 Ga0207711_10005184
950 Ga0207711_10009373
951 Ga0207711_10015088
952 Ga0207711_10054325
953 Ga0207711_10059477
954 Ga0207711_10097566
955 Ga0207711_10506164
956 Ga0207689_10017511
957 Ga0207661_10065442
958 Ga0207661_10130067
959 Ga0207679_10000689
960 Ga0207679_10009857
961 Ga0207679_10072978
962 Ga0207679_10148472
963 Ga0207667_10105356
964 Ga0207667_10419349
965 Ga0207651_10022498
966 Ga0207651_10025014
967 Ga0207651_10064909
968 Ga0207651_10129448
969 Ga0207651_10170594
970 Ga0207640_10025185
971 Ga0207640_10153553
972 Ga0207658_10003190
973 Ga0207658_10010412
974 Ga0207658_10163282
975 Ga0207658_10417390
976 Ga0207677_10006115
977 Ga0207677_10040163
978 Ga0207677_10221519
979 Ga0207703_10010377
980 Ga0207703_10058783
981 Ga0207703_10062523
982 Ga0207703_10122014
983 Ga0207639_10040171
984 Ga0207639_10047146
985 Ga0207639_10052978
986 Ga0207678_10008549
987 Ga0207678_10024269
988 Ga0207678_10106454
989 Ga0207678_10164490
990 Ga0207702_10062573
991 Ga0207641_10003872
992 Ga0207641_10035017
993 Ga0207641_10076982
994 Ga0207641_10108744
995 Ga0207641_10222938
996 Ga0207648_10002753
997 Ga0207648_10021592
998 Ga0207676_10025819
999 Ga0207676_10032848
1000 Ga0207676_10259082
1001 Ga0207674_10002425
1002 Ga0207674_10133421
1003 Ga0207674_10361705
1004 Ga0207683_10001237
1005 Ga0207683_10003086
1006 Ga0207683_10040025
1007 Ga0207683_10073761
1008 Ga0207683_10078687
1009 Ga0207683_10159121
1010 Ga0207698_10036836
1011 Ga0207698_10051932
1012 Ga0207698_10548315
1013 Ga0268266_10059974
1014 Ga0268266_10133832
1015 Ga0268264_10050550
1016 Ga0268264_10148147
1017 Ga0268264_10397574
1018 Ga0307517_10121381
1019 Ga0307513_10000816
1020 Ga0307408_100067711
1021 Ga0307413_10222139
1022 Ga0307414_10060306
1023 Ga0307510_10075119
1024 Ga0373932_0076143
1025 Ga0373943_0003479
1026 Ga0373943_0093747
1027 Ga0373961_0070450
1028 Ga0373935_0025581
1029 Ga0395899_0000104
1030 Ga0395899_0000825
1031 Ga0395899_0028259
1032 Ga0395899_0029573
1033 Ga0395899_0033200
1034 Ga0395899_0062712
1035 Ga0395899_0075087
1036 Ga0395899_0100512
1037 Ga0395899_0168142
1038 Ga0395899_0331663
1039 Ga0395900_0000031
1040 Ga0395900_0000161
1041 Ga0395900_0000703
1042 Ga0395900_0016315
1043 Ga0395900_0019594
1044 Ga0395900_0028356
1045 Ga0395900_0030982
1046 Ga0395900_0031245
1047 Ga0395900_0053026
1048 Ga0395900_0068481
1049 Ga0395900_0078393
1050 Ga0395900_0078785
1051 Ga0395900_0085071
1052 Ga0395900_0087563
1053 Ga0395900_0442863
1054 Ga0395898_0000169
1055 Ga0395898_0001777
1056 Ga0395898_0009985
1057 Ga0395898_0014378
1058 Ga0395898_0025170
1059 Ga0395898_0036094
1060 Ga0395898_0066286
1061 Ga0395898_0095772
1062 Ga0395898_0218863
1063 Ga0395898_0280600
1064 Ga0395905_0000120
1065 Ga0395905_0000627
1066 Ga0395905_0000946
1067 Ga0395905_0006189
1068 Ga0395905_0010111
1069 Ga0395905_0013020
1070 Ga0395905_0015115
1071 Ga0395905_0020139
1072 Ga0395905_0026831
1073 Ga0395905_0033497
1074 Ga0395905_0050138
1075 Ga0395905_0059903
1076 Ga0395905_0086952
1077 Ga0395905_0096643
1078 Ga0395905_0130967
1079 Ga0395905_0145649
1080 Ga0395905_0178970
1081 Ga0395905_0193927
1082 Ga0395905_0203736
1083 Ga0395905_0259458
1084 Ga0395905_0385066
1085 Ga0395905_0472058
1086 Ga0395905_0536877
1087 Ga0395905_0610113
1088 Ga0395901_0000260
1089 Ga0395901_0000871
1090 Ga0395901_0004433
1091 Ga0395901_0004704
1092 Ga0395901_0011742
1093 Ga0395901_0024148
1094 Ga0395901_0032283
1095 Ga0395901_0039131
1096 Ga0395901_0045039
1097 Ga0395901_0048387
1098 Ga0395901_0064460
1099 Ga0395901_0074135
1100 Ga0395901_0123530
1101 Ga0395901_0210285
1102 Ga0395901_0225402
1103 Ga0395901_0485484
1104 Ga0395901_0602560
1105 Ga0395901_0604652
1106 Ga0237819_01526
1107 Ga0237816_03217
1108 Ga0436365_0496393
1109 Ga0439458_0000075
1110 Ga0466969_0091500
1111 Ga0466972_0154746
1112 Ga0466972_0163689
1113 Ga0466961_0013579
1114 Ga0466961_0040575
1115 Ga0466961_0138774
1116 Ga0466963_0094291
1117 Ga0466963_0220627
1118 Ga0466964_0085500
1119 Ga0453684_0343793
1120 Ga0466970_0186884
1121 Ga0466957_0031008
1122 Ga0466957_0204451
1123 Ga0466960_0077212
1124 Ga0466959_0223682
1125 Ga0466958_0021389
1126 Ga0466958_0093864
1127 Ga0466967_0335001
1128 Ga0495638_0002342
1129 Ga0495638_0018706
1130 Ga0495580_0235590
1131 Ga0495583_0000083
1132 Ga0495610_0077880
1133 Ga0495648_0025018
1134 Ga0495642_0000901
1135 Ga0495642_0035790
1136 Ga0495642_0166913
1137 Ga0495598_0002947
1138 Ga0495621_0000786
1139 Ga0495621_0010182
1140 Ga0495621_0027880
1141 Ga0495621_0073973
1142 Ga0495622_0003463
1143 Ga0495668_0006029
1144 Ga0495625_0009886
1145 Ga0495669_0000306
1146 Ga0495669_0094586
1147 Ga0495669_0112518
1148 Ga0495670_0014874
1149 Ga0495671_0005230
1150 Ga0495671_0029705
1151 Ga0495672_0032500
1152 Ga0495677_0038215
1153 Ga0495677_0039288
1154 Ga0495677_0090262
1155 Ga0495673_0005675
1156 Ga0495686_0000055
1157 Ga0495686_0111888
1158 Ga0495615_0004960
1159 Ga0496100_0038915
1160 Ga0496100_0103856
1161 Ga0496100_0479125
1162 Ga0496100_0536783
1163 Ga0496101_0003551
1164 Ga0496101_0005007
1165 Ga0496101_0264151
1166 Ga0496101_0417271
1167 Ga0496102_0102403
1168 Ga0496102_0111046
1169 Ga0496102_0163043
1170 Ga0496103_0027494
1171 Ga0496104_0104569
1172 Ga0496105_0026179
1173 Ga0496106_0454251
1174 Ga0496107_0008805
1175 Ga0496107_0046732
1176 Ga0496107_0090515
1177 Ga0496108_0003970
1178 Ga0496108_0004156
1179 Ga0496108_0004195
1180 Ga0496108_0020884
1181 Ga0496108_0239155
1182 Ga0496109_0009310
1183 Ga0496109_0110627
1184 Ga0496109_0171274
1185 Ga0496109_0202470
1186 Ga0496110_0006176
1187 Ga0496110_0010222
1188 Ga0496110_0028004
1189 Ga0496110_0122187
1190 Ga0496111_0002827
1191 Ga0496111_0013573
1192 Ga0496112_0020885
1193 Ga0496112_0055034
1194 Ga0496112_0071208
1195 Ga0496112_0177140
1196 Ga0496112_0258941
1197 Ga0496113_0019492
1198 Ga0496113_0035272
1199 Ga0496114_0001397
1200 Ga0496114_0009311
1201 Ga0496114_0059879
1202 Ga0496115_0002821
1203 Ga0496115_0006188
1204 Ga0496119_0187678
1205 Ga0496122_0011153
1206 Ga0496123_0000521
1207 Ga0501033_0002409
1208 Ga0501034_0038469
1209 Ga0501047_0126498
1210 Ga0501044_0001509
1211 Ga0500643_000528
1212 Ga0500643_006941
1213 Ga0500643_054514
1214 Ga0500641_0003300
1215 Ga0500641_0030537
1216 Ga0500650_0057416
1217 Ga0500555_000253
1218 Ga0500556_0000031
1219 Ga0500556_0006343
1220 Ga0500557_015416
1221 Ga0500562_004036
1222 Ga0500562_013197
1223 Ga0500594_0003793
1224 Ga0500642_0000003
1225 Ga0500658_0013299
1226 Ga0500568_0094551
1227 Ga0500616_0031414
1228 Ga0500616_0053146
1229 Ga0500616_0112712
1230 Ga0500622_0012256
1231 Ga0500645_000255
1232 Ga0500645_001612
1233 Ga0500645_016650
1234 Ga0500645_044540
1235 Ga0466962_0006005
1236 2895882148

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

91

321

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8783 30 276
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8714 30 276
1zi6-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a 0.849 36 275
4u2e-assembly1.cif.gz_A crystal structure of dienelactone hydrolase s-3 variant (q35h, f38l, q110l, c123s, y137c, y145c, n154d, e199g, s208g, g211d and k234n) at 1.70 a resolution 0.8448 36 275
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.8435 30 275
ID Description Score Start End Superfamily
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9366 34 273 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9252 34 273 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8818 33 274 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8671 30 276 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8603 30 276 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A520F7M0-F1-model_v4 deleted 0.9673 45 275
AF-A0A7X4FRE1-F1-model_v4 Dienelactone hydrolase family protein 0.9624 32 275 GO:0016787
AF-A0A432LZT5-F1-model_v4 Dienelactone hydrolase family protein 0.9583 28 273 GO:0016787
AF-A0A4Q9RC80-F1-model_v4 Dienelactone hydrolase 0.9579 32 275 GO:0016787
AF-A0A519QW09-F1-model_v4 Dienelactone hydrolase family protein 0.9571 30 276 GO:0016020
GO:0016787

Map