F469732

General Info

Members Datasets Scaffolds Average Seq Length
618 372 1237 399

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10056858|Ga0157380_100568583
Length 457
Sequence MSMKTRSRPGAIAAQPKRARPKTAGESPASPADFASSPGGAPSPARQSGRRXXXQQRPQGALAGIRVLDLTNVLAGPFCAYQLGLLGAEVIKLELPATGDLARQLGADATLNKQLMGASFLAQNGGKKSITVNLKSEGGRDVLRRLVRDADVLVENFRPGVMSRLGLGYEALSLVNPALIYCAISGFGQEGPMKDAPAYDQIIQGLSGVMSITGDQKCAPLRVGYPIADTIGGITAAFSVTSALVRRGATGKGAFIDVSMLDCALATMGWVISNFLIAGHEPSPMGNDNFTAAPSGTFKTGSGLLNIAANKQEQFETLAQAVGAGGLVTDSRFVDRESRKRNRAALTIELEAALQHKSAADWETILNELGIPAGRVATIPEALNNPQVLHRELLQTLRDVPGLDRPLTLTRAGFKLSGADPFVSSPPPRLGEHTDEILRAAGYTEQEIAALHRAKAI

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
84 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
111 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
113 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
175 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
203 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
204 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
205 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
206 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
207 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
208 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
209 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
210 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
211 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
212 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
213 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
214 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
215 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
216 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
219 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
220 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
221 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
230 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
233 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
243 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
281 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
288 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
293 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
296 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
297 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
298 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
299 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
300 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
301 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
302 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
303 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
304 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
305 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
306 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
307 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
308 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
309 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
310 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
311 2512875024
312 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
313 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
314 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
315 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
316 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
317 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
318 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
319 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
320 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
321 2643221626 Ensifer sp. Root31 Isolate Unclassified
322 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
323 2643221659 Ensifer sp. Root127 Isolate Unclassified
324 2643221698 Ensifer sp. Root142 Isolate Unclassified
325 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
326 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
327 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
328 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
329 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
330 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
331 2831864461 Roseateles noduli HZ7 Isolate Nodule
332 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
333 2841760612 Bosea sp. Tri-49 Isolate Nodule
334 2844104063 Bosea sp. Tri-39 Isolate Nodule
335 2844163670 Ensifer sp. 1H6 Isolate Unclassified
336 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
337 2851246043 Bosea sp. Tri-54 Isolate Nodule
338 2855730933 Achromobacter sp. HZ28 Isolate Nodule
339 2855767633 Achromobacter sp. HZ34 Isolate Nodule
340 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
341 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
342 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
343 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
344 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
345 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
346 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
347 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
348 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
349 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
350 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
351 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
352 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
353 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
354 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
355 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
356 2919069694 Microbacterium sp. 1154 Isolate Unclassified
357 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
358 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
359 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
360 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
361 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
362 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
363 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
364 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
365 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
366 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
367 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
368 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
369 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
370 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
371 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
372 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.64
Metatranscriptomes 0.16
Isolates 10.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.83
Nodule 6.31
Rhizoplane 2.75
Rhizosphere 65.53
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10056858 3300014326 Bacteria 3113
2 JGI24740J21852_10012979 3300001979 Bacteria 3126
3 JGI25151J46595_10000604 3300003187 Bacteria 31476
4 JGI25151J46595_10001117 3300003187 Bacteria 19581
5 JGI25151J46595_10009952 3300003187 Bacteria 4459
6 JGI25153J46596_10000338 3300003215 Bacteria 33480
7 rootH1_10017530 3300003316 Bacteria 4184
8 rootH1_10017530 3300003323 Bacteria 4041
9 rootL2_10000022 3300003322 Bacteria 23388
10 rootL2_10010425 3300003322 Bacteria 20457
11 rootH1_10003328 3300003323 Bacteria 4527
12 rootH1_10003329 3300003323 Bacteria 20992
13 Ga0055542_1000592 3300003762 Bacteria 31197
14 Ga0055529_1001564 3300003763 Bacteria 6438
15 Ga0055526_1004975 3300003771 Bacteria 7799
16 Ga0055526_1009094 3300003771 Bacteria 4845
17 Ga0055526_1013008 3300003771 Bacteria 3565
18 Ga0055537_1001090 3300003773 Bacteria 11907
19 Ga0055524_1000127 3300003775 Bacteria 89907
20 Ga0055524_1000141 3300003775 Bacteria 85601
21 Ga0055524_1001098 3300003775 Bacteria 16465
22 Ga0055524_1015249 3300003775 Bacteria 2811
23 Ga0055534_1002514 3300003784 Bacteria 6297
24 Ga0055531_10001681 3300003794 Bacteria 15923
25 Ga0055531_10024308 3300003794 Bacteria 2240
26 Ga0055543_1004482 3300004625 Bacteria 3800
27 Ga0065165_1001571 3300005262 Bacteria 23552
28 Ga0065714_10075018 3300005288 Unclassified 2958
29 Ga0070658_10014849 3300005327 Bacteria 6240
30 Ga0070658_10134782 3300005327 Bacteria 2059
31 Ga0070676_10019738 3300005328 Bacteria 3755
32 Ga0070670_100002285 3300005331 Bacteria 15788
33 Ga0070670_100049178 3300005331 Bacteria 3626
34 Ga0070666_10202379 3300005335 Bacteria 1397
35 Ga0070680_100000961 3300005336 Bacteria 20387
36 Ga0070680_100030116 3300005336 Bacteria 4359
37 Ga0068868_100025860 3300005338 Bacteria 4469
38 Ga0070660_100001302 3300005339 Bacteria 17010
39 Ga0070660_100006492 3300005339 Bacteria 8112
40 Ga0070661_100059635 3300005344 Bacteria 2799
41 Ga0070692_10003301 3300005345 Bacteria 6513
42 Ga0070692_10021295 3300005345 Bacteria 3153
43 Ga0070668_100000553 3300005347 Bacteria 24984
44 Ga0070668_100009283 3300005347 Bacteria 7294
45 Ga0070668_100020043 3300005347 Bacteria 5043
46 Ga0070668_100031912 3300005347 Bacteria 4008
47 Ga0070668_100177928 3300005347 Bacteria 1736
48 Ga0070668_100217801 3300005347 Bacteria 1573
49 Ga0070669_100142817 3300005353 Bacteria 1847
50 Ga0070675_100001666 3300005354 Bacteria 16394
51 Ga0070675_100042517 3300005354 Bacteria 3713
52 Ga0070675_100249187 3300005354 Bacteria 1554
53 Ga0070671_100011088 3300005355 Bacteria 7237
54 Ga0070671_100014791 3300005355 Bacteria 6305
55 Ga0070671_100046061 3300005355 Bacteria 3626
56 Ga0070671_100127752 3300005355 Bacteria 2140
57 Ga0070674_100005007 3300005356 Bacteria 7604
58 Ga0070674_100152490 3300005356 Bacteria 1745
59 Ga0070673_100002313 3300005364 Bacteria 11576
60 Ga0070673_100016604 3300005364 Bacteria 5211
61 Ga0070673_100032384 3300005364 Bacteria 3936
62 Ga0070659_100010969 3300005366 Bacteria 6692
63 Ga0070667_100032462 3300005367 Bacteria 4355
64 Ga0070667_100262093 3300005367 Bacteria 1548
65 Ga0070709_10049287 3300005434 Bacteria 2632
66 Ga0070714_100028687 3300005435 Bacteria 4620
67 Ga0070713_100000194 3300005436 Bacteria 40569
68 Ga0070711_100046808 3300005439 Bacteria 2949
69 Ga0070694_100111500 3300005444 Bacteria 1949
70 Ga0070663_100009415 3300005455 Bacteria 6047
71 Ga0070663_100018235 3300005455 Bacteria 4596
72 Ga0070678_100006974 3300005456 Bacteria 6669
73 Ga0070678_100008594 3300005456 Bacteria 6121
74 Ga0070678_100045712 3300005456 Bacteria 3134
75 Ga0070662_100010429 3300005457 Bacteria 6095
76 Ga0070662_100147591 3300005457 Bacteria 1828
77 Ga0070662_100214739 3300005457 Bacteria 1532
78 Ga0070681_10005782 3300005458 Bacteria 11964
79 Ga0070681_10115006 3300005458 Bacteria 2629
80 Ga0068867_100023796 3300005459 Bacteria 4388
81 Ga0068867_100133656 3300005459 Bacteria 1931
82 Ga0070685_10066253 3300005466 Bacteria 2128
83 Ga0070706_100002496 3300005467 Bacteria 18534
84 Ga0070679_100018638 3300005530 Bacteria 6738
85 Ga0070679_100040141 3300005530 Bacteria 4656
86 Ga0068853_100007844 3300005539 Bacteria 8560
87 Ga0068853_100048116 3300005539 Bacteria 3661
88 Ga0068853_100126650 3300005539 Bacteria 2282
89 Ga0070672_100001087 3300005543 Bacteria 16548
90 Ga0070672_100008016 3300005543 Bacteria 7215
91 Ga0070672_100039550 3300005543 Bacteria 3613
92 Ga0070665_100012733 3300005548 Bacteria 8472
93 Ga0070665_100036991 3300005548 Bacteria 4909
94 Ga0070665_100037523 3300005548 Bacteria 4873
95 Ga0070704_100062164 3300005549 Bacteria 2675
96 Ga0068855_100001539 3300005563 Bacteria 28980
97 Ga0068855_100037831 3300005563 Bacteria 5734
98 Ga0070664_100002042 3300005564 Bacteria 16161
99 Ga0070664_100057872 3300005564 Bacteria 3296
100 Ga0068854_100042550 3300005578 Bacteria 3216
101 Ga0068856_100000246 3300005614 Bacteria 59117
102 Ga0068856_100051662 3300005614 Bacteria 4053
103 Ga0068856_100055321 3300005614 Bacteria 3916
104 Ga0068856_100139772 3300005614 Bacteria 2429
105 Ga0068852_100023255 3300005616 Bacteria 4985
106 Ga0068852_100090732 3300005616 Bacteria 2733
107 Ga0068852_100105644 3300005616 Bacteria 2551
108 Ga0068859_100485541 3300005617 Bacteria 1331
109 Ga0068864_100002152 3300005618 Bacteria 16277
110 Ga0068864_100003200 3300005618 Bacteria 13525
111 Ga0068864_100009011 3300005618 Bacteria 8227
112 Ga0068864_100053189 3300005618 Bacteria 3492
113 Ga0068866_10058170 3300005718 Bacteria 1995
114 Ga0068861_100016791 3300005719 Bacteria 5187
115 Ga0068851_10028274 3300005834 Bacteria 2769
116 Ga0068863_100032927 3300005841 Bacteria 4938
117 Ga0068863_100044309 3300005841 Bacteria 4224
118 Ga0068863_100048559 3300005841 Bacteria 4024
119 Ga0068863_100131159 3300005841 Bacteria 2393
120 Ga0068863_100186663 3300005841 Bacteria 1992
121 Ga0068860_100050885 3300005843 Bacteria 3943
122 Ga0068860_100081375 3300005843 Bacteria 3080
123 Ga0068860_100133886 3300005843 Bacteria 2380
124 Ga0068862_100028584 3300005844 Bacteria 4697
125 Ga0068862_100039351 3300005844 Bacteria 4015
126 Ga0068862_100044841 3300005844 Bacteria 3772
127 Ga0081540_1000084 3300005983 Bacteria 100067
128 Ga0070717_10011506 3300006028 Bacteria 6723
129 Ga0070717_10026853 3300006028 Bacteria 4598
130 Ga0070717_10186382 3300006028 Bacteria 1811
131 Ga0075365_10003404 3300006038 Bacteria 8182
132 Ga0075365_10037855 3300006038 Bacteria 3133
133 Ga0075368_10007574 3300006042 Bacteria 3831
134 Ga0075363_100026377 3300006048 Bacteria 2972
135 Ga0075364_10003306 3300006051 Bacteria 9143
136 Ga0075364_10014945 3300006051 Bacteria 4806
137 Ga0070715_10006854 3300006163 Bacteria 3892
138 Ga0070716_100058357 3300006173 Bacteria 2220
139 Ga0075362_10012325 3300006177 Bacteria 3394
140 Ga0075367_10010594 3300006178 Bacteria 4849
141 Ga0075367_10016817 3300006178 Bacteria 4001
142 Ga0075367_10106113 3300006178 Bacteria 1721
143 Ga0075366_10000452 3300006195 Bacteria 19114
144 Ga0075366_10006946 3300006195 Bacteria 6232
145 Ga0097621_100048144 3300006237 Bacteria 3457
146 Ga0075370_10007792 3300006353 Bacteria 5472
147 Ga0075370_10029713 3300006353 Bacteria 3045
148 Ga0068871_100003052 3300006358 Bacteria 11492
149 Ga0068871_100033702 3300006358 Bacteria 4058
150 Ga0068871_100098738 3300006358 Bacteria 2443
151 Ga0075428_100108589 3300006844 Bacteria 3024
152 Ga0075428_100191669 3300006844 Bacteria 2211
153 Ga0075428_100211275 3300006844 Bacteria 2097
154 Ga0075428_100313482 3300006844 Bacteria 1686
155 Ga0075430_100041936 3300006846 Bacteria 3870
156 Ga0075430_100058019 3300006846 Bacteria 3255
157 Ga0075431_100217711 3300006847 Bacteria 1949
158 Ga0097620_100485576 3300006931 Bacteria 1331
159 Ga0099823_1000003 3300006944 Bacteria 189058
160 Ga0099826_10000074 3300006948 Bacteria 52710
161 Ga0105240_10023028 3300009093 Bacteria 8249
162 Ga0111539_10537793 3300009094 Bacteria 1361
163 Ga0114129_10176801 3300009147 Bacteria 2907
164 Ga0114129_10221836 3300009147 Bacteria 2550
165 Ga0114129_10311438 3300009147 Unclassified 2095
166 Ga0105241_10012603 3300009174 Bacteria 6202
167 Ga0105248_10001530 3300009177 Bacteria 25754
168 Ga0105248_10079729 3300009177 Bacteria 3680
169 Ga0105248_10232319 3300009177 Bacteria 2076
170 Ga0105237_10007074 3300009545 Bacteria 12339
171 Ga0105237_10037129 3300009545 Bacteria 4926
172 Ga0105237_10052174 3300009545 Bacteria 4106
173 Ga0105238_10076849 3300009551 Bacteria 3331
174 Ga0105238_10077063 3300009551 Bacteria 3326
175 Ga0099796_10004452 3300010159 Bacteria 3390
176 Ga0105239_10002719 3300010375 Bacteria 22230
177 Ga0105239_10199603 3300010375 Bacteria 2241
178 Ga0105239_10299589 3300010375 Bacteria 1811
179 Ga0105239_10392272 3300010375 Bacteria 1570
180 Ga0157319_1000002 3300012497 Bacteria 410803
181 Ga0157373_10001898 3300013100 Bacteria 15867
182 Ga0157373_10108105 3300013100 Bacteria 1956
183 Ga0157371_10003903 3300013102 Bacteria 13278
184 Ga0157370_10005307 3300013104 Bacteria 14481
185 Ga0157370_10024812 3300013104 Bacteria 5936
186 Ga0157369_10188744 3300013105 Bacteria 2166
187 Ga0157374_10289804 3300013296 Bacteria 1618
188 Ga0157378_10064459 3300013297 Bacteria 3278
189 Ga0157378_10155424 3300013297 Bacteria 2135
190 Ga0163162_10063903 3300013306 Bacteria 3725
191 Ga0157372_10004840 3300013307 Bacteria 14321
192 Ga0157375_10001141 3300013308 Bacteria 22994
193 Ga0157375_10015717 3300013308 Bacteria 6782
194 Ga0157375_10253693 3300013308 Bacteria 1920
195 Ga0157375_10297056 3300013308 Bacteria 1779
196 Ga0163163_10018021 3300014325 Bacteria 6596
197 Ga0157380_10026450 3300014326 Bacteria 4405
198 Ga0157376_10090581 3300014969 Bacteria 2647
199 Ga0157376_10097084 3300014969 Bacteria 2566
200 Ga0157376_10105230 3300014969 Bacteria 2474
201 Ga0157376_10278938 3300014969 Bacteria 1573
202 Ga0182006_1020552 3300015261 Bacteria 2765
203 Ga0183362_10002 3300015683 Bacteria 1432711
204 Ga0163161_10049561 3300017792 Unclassified 3036
205 Ga0163161_10071347 3300017792 Bacteria 2541
206 Ga0206353_10962024 3300020082 Bacteria 1330
207 Ga0207425_1001160 3300025245 Bacteria 11803
208 Ga0209148_1000069 3300025254 Bacteria 334444
209 Ga0209129_1000122 3300025258 Bacteria 135306
210 Ga0209565_1000079 3300025263 Bacteria 159565
211 Ga0209565_1000620 3300025263 Bacteria 23412
212 Ga0209455_1000219 3300025272 Bacteria 79850
213 Ga0209673_1008367 3300025273 Bacteria 4612
214 Ga0209673_1010738 3300025273 Bacteria 3836
215 Ga0209673_1030080 3300025273 Bacteria 1717
216 Ga0209675_1000784 3300025291 Bacteria 21152
217 Ga0209676_1016448 3300025292 Bacteria 2669
218 Ga0209025_1000027 3300025294 Bacteria 505882
219 Ga0209025_1000113 3300025294 Bacteria 218943
220 Ga0209025_1000897 3300025294 Bacteria 46271
221 Ga0209025_1002276 3300025294 Bacteria 20948
222 Ga0209564_1000266 3300025295 Bacteria 110519
223 Ga0209564_1000624 3300025295 Bacteria 53918
224 Ga0209564_1001384 3300025295 Bacteria 25303
225 Ga0209564_1028373 3300025295 Bacteria 1791
226 Ga0209758_1000091 3300025297 Bacteria 242583
227 Ga0209050_1003171 3300025298 Bacteria 12502
228 Ga0209256_1000190 3300025299 Bacteria 117775
229 Ga0209256_1000938 3300025299 Bacteria 35416
230 Ga0209256_1001291 3300025299 Bacteria 27026
231 Ga0209256_1004279 3300025299 Bacteria 9102
232 Ga0209256_1019724 3300025299 Bacteria 2134
233 Ga0209051_1000301 3300025303 Bacteria 77933
234 Ga0209051_1003421 3300025303 Bacteria 10418
235 Ga0209051_1007088 3300025303 Bacteria 6198
236 Ga0209051_1012951 3300025303 Bacteria 3998
237 Ga0209051_1036472 3300025303 Bacteria 1815
238 Ga0209257_1000022 3300025304 Bacteria 765258
239 Ga0209257_1000385 3300025304 Bacteria 88117
240 Ga0209257_1006540 3300025304 Bacteria 7444
241 Ga0207697_10012754 3300025315 Bacteria 3516
242 Ga0207656_10005928 3300025321 Bacteria 4360
243 Ga0207688_10053973 3300025901 Bacteria 2254
244 Ga0207680_10095556 3300025903 Bacteria 1899
245 Ga0207647_10006394 3300025904 Bacteria 8568
246 Ga0207685_10006850 3300025905 Bacteria 3135
247 Ga0207645_10005846 3300025907 Bacteria 8866
248 Ga0207645_10025763 3300025907 Bacteria 3804
249 Ga0207705_10001451 3300025909 Bacteria 18917
250 Ga0207705_10133142 3300025909 Bacteria 1851
251 Ga0207684_10005984 3300025910 Bacteria 11128
252 Ga0207707_10108845 3300025912 Bacteria 2423
253 Ga0207707_10188191 3300025912 Bacteria 1801
254 Ga0207695_10087351 3300025913 Bacteria 3141
255 Ga0207671_10005013 3300025914 Bacteria 12390
256 Ga0207693_10035458 3300025915 Bacteria 3933
257 Ga0207660_10010018 3300025917 Bacteria 6140
258 Ga0207657_10003661 3300025919 Bacteria 16361
259 Ga0207657_10005884 3300025919 Bacteria 12769
260 Ga0207657_10092557 3300025919 Bacteria 2520
261 Ga0207657_10094545 3300025919 Bacteria 2488
262 Ga0207652_10002630 3300025921 Bacteria 15077
263 Ga0207652_10072275 3300025921 Bacteria 3000
264 Ga0207646_10103212 3300025922 Bacteria 2557
265 Ga0207694_10076772 3300025924 Bacteria 2617
266 Ga0207650_10009329 3300025925 Bacteria 6706
267 Ga0207650_10180443 3300025925 Bacteria 1682
268 Ga0207659_10033231 3300025926 Bacteria 3548
269 Ga0207659_10034054 3300025926 Bacteria 3510
270 Ga0207659_10143214 3300025926 Bacteria 1858
271 Ga0207700_10000176 3300025928 Bacteria 38407
272 Ga0207644_10000090 3300025931 Bacteria 65122
273 Ga0207644_10007428 3300025931 Bacteria 7143
274 Ga0207644_10105175 3300025931 Bacteria 2126
275 Ga0207690_10014160 3300025932 Bacteria 4811
276 Ga0207706_10000190 3300025933 Bacteria 68803
277 Ga0207706_10060496 3300025933 Bacteria 3335
278 Ga0207706_10369621 3300025933 Bacteria 1245
279 Ga0207670_10075891 3300025936 Bacteria 2338
280 Ga0207669_10106470 3300025937 Bacteria 1868
281 Ga0207669_10150095 3300025937 Bacteria 1631
282 Ga0207704_10037031 3300025938 Bacteria 2814
283 Ga0207665_10001117 3300025939 Bacteria 18003
284 Ga0207691_10000018 3300025940 Bacteria 134343
285 Ga0207691_10001640 3300025940 Bacteria 22220
286 Ga0207691_10024128 3300025940 Bacteria 5720
287 Ga0207691_10249288 3300025940 Unclassified 1533
288 Ga0207711_10000817 3300025941 Bacteria 30510
289 Ga0207711_10044961 3300025941 Bacteria 3772
290 Ga0207711_10220162 3300025941 Bacteria 1736
291 Ga0207661_10034890 3300025944 Bacteria 3916
292 Ga0207679_10005470 3300025945 Bacteria 7959
293 Ga0207679_10024488 3300025945 Bacteria 4139
294 Ga0207679_10040637 3300025945 Bacteria 3331
295 Ga0207667_10027116 3300025949 Bacteria 6245
296 Ga0207651_10010594 3300025960 Bacteria 5117
297 Ga0207651_10034621 3300025960 Bacteria 3273
298 Ga0207712_10047184 3300025961 Bacteria 2989
299 Ga0207668_10002243 3300025972 Bacteria 11276
300 Ga0207668_10017775 3300025972 Bacteria 4462
301 Ga0207668_10060404 3300025972 Bacteria 2660
302 Ga0207668_10251776 3300025972 Bacteria 1435
303 Ga0207658_10021442 3300025986 Bacteria 4485
304 Ga0207677_10069348 3300026023 Bacteria 2479
305 Ga0207677_10084546 3300026023 Bacteria 2288
306 Ga0207639_10064051 3300026041 Bacteria 2849
307 Ga0207639_10118665 3300026041 Bacteria 2169
308 Ga0207678_10000754 3300026067 Bacteria 29592
309 Ga0207678_10029792 3300026067 Bacteria 4765
310 Ga0207708_10015323 3300026075 Bacteria 5748
311 Ga0207702_10004336 3300026078 Bacteria 12655
312 Ga0207702_10008638 3300026078 Bacteria 8592
313 Ga0207702_10138942 3300026078 Bacteria 2196
314 Ga0207641_10023318 3300026088 Bacteria 5100
315 Ga0207641_10056390 3300026088 Bacteria 3339
316 Ga0207641_10124196 3300026088 Bacteria 2308
317 Ga0207648_10054808 3300026089 Bacteria 3482
318 Ga0207648_10120030 3300026089 Bacteria 2311
319 Ga0207648_10151460 3300026089 Bacteria 2046
320 Ga0207676_10034960 3300026095 Bacteria 3808
321 Ga0207676_10044209 3300026095 Bacteria 3435
322 Ga0207676_10073622 3300026095 Bacteria 2750
323 Ga0207676_10266030 3300026095 Bacteria 1550
324 Ga0207674_10205209 3300026116 Bacteria 1920
325 Ga0207675_100015915 3300026118 Bacteria 7015
326 Ga0207675_100057355 3300026118 Bacteria 3633
327 Ga0207675_100092065 3300026118 Bacteria 2851
328 Ga0207675_100269723 3300026118 Bacteria 1651
329 Ga0207683_10000163 3300026121 Bacteria 56559
330 Ga0207683_10016089 3300026121 Bacteria 6366
331 Ga0207683_10046665 3300026121 Bacteria 3792
332 Ga0207683_10097979 3300026121 Bacteria 2616
333 Ga0207683_10141571 3300026121 Bacteria 2168
334 Ga0207698_10010993 3300026142 Bacteria 5850
335 Ga0207698_10011390 3300026142 Bacteria 5765
336 Ga0209389_1001915 3300027296 Bacteria 15326
337 Ga0209371_1016471 3300027312 Bacteria 1948
338 Ga0209282_1000113 3300027666 Bacteria 52714
339 Ga0209974_10016485 3300027876 Bacteria 2454
340 Ga0268266_10019573 3300028379 Bacteria 5767
341 Ga0268266_10029488 3300028379 Bacteria 4663
342 Ga0268266_10070290 3300028379 Bacteria 3033
343 Ga0268266_10147182 3300028379 Bacteria 2119
344 Ga0268265_10012175 3300028380 Bacteria 5826
345 Ga0268265_10219227 3300028380 Bacteria 1663
346 Ga0307511_10001237 3300030521 Bacteria 26984
347 Ga0265327_10055188 3300031251 Bacteria 2053
348 Ga0307509_10177132 3300031507 Bacteria 2003
349 Ga0307509_10213583 3300031507 Bacteria 1751
350 Ga0307408_100004584 3300031548 Bacteria 9353
351 Ga0307405_10005949 3300031731 Bacteria 5952
352 Ga0307405_10035256 3300031731 Bacteria 2986
353 Ga0307405_10109471 3300031731 Bacteria 1869
354 Ga0307405_10173217 3300031731 Bacteria 1541
355 Ga0307413_10001161 3300031824 Bacteria 9678
356 Ga0307413_10007135 3300031824 Bacteria 5161
357 Ga0307413_10062112 3300031824 Bacteria 2309
358 Ga0307410_10001726 3300031852 Bacteria 10093
359 Ga0307410_10013289 3300031852 Bacteria 4798
360 Ga0307410_10033884 3300031852 Bacteria 3301
361 Ga0307406_10004201 3300031901 Bacteria 7841
362 Ga0307406_10047763 3300031901 Bacteria 2699
363 Ga0307407_10004762 3300031903 Bacteria 5807
364 Ga0307412_10014159 3300031911 Bacteria 4697
365 Ga0307412_10065053 3300031911 Bacteria 2466
366 Ga0307409_100007546 3300031995 Bacteria 6517
367 Ga0307409_100056645 3300031995 Bacteria 3032
368 Ga0307409_100181619 3300031995 Bacteria 1863
369 Ga0307416_100008129 3300032002 Bacteria 6737
370 Ga0307416_100057655 3300032002 Bacteria 3144
371 Ga0307416_100117371 3300032002 Bacteria 2362
372 Ga0307416_100122967 3300032002 Bacteria 2318
373 Ga0307414_10063482 3300032004 Bacteria 2625
374 Ga0307414_10089589 3300032004 Bacteria 2280
375 Ga0307411_10000419 3300032005 Bacteria 14481
376 Ga0307411_10007751 3300032005 Bacteria 5502
377 Ga0307411_10044724 3300032005 Bacteria 2843
378 Ga0307411_10071691 3300032005 Bacteria 2349
379 Ga0307415_100003744 3300032126 Bacteria 7791
380 Ga0307507_10098078 3300033179 Bacteria 2469
381 Ga0373931_0035756 3300035691 Bacteria 2584
382 Ga0395899_0000445 3300037312 Bacteria 47388
383 Ga0395899_0001915 3300037312 Bacteria 17168
384 Ga0395899_0013095 3300037312 Bacteria 6344
385 Ga0395900_0000280 3300037418 Bacteria 76850
386 Ga0395900_0006347 3300037418 Bacteria 12330
387 Ga0395898_0000169 3300037466 Bacteria 168667
388 Ga0395898_0001517 3300037466 Bacteria 31994
389 Ga0395898_0023320 3300037466 Bacteria 6255
390 Ga0395905_0000109 3300037471 Bacteria 137754
391 Ga0395905_0001662 3300037471 Bacteria 26275
392 Ga0395905_0001796 3300037471 Bacteria 24883
393 Ga0395905_0002187 3300037471 Bacteria 22094
394 Ga0395905_0007293 3300037471 Bacteria 11021
395 Ga0395905_0038410 3300037471 Bacteria 4493
396 Ga0395905_0181059 3300037471 Bacteria 1978
397 Ga0395901_0000444 3300038443 Bacteria 48218
398 Ga0395901_0001994 3300038443 Bacteria 21012
399 Ga0395901_0041935 3300038443 Bacteria 4743
400 Ga0395901_0108371 3300038443 Bacteria 2916
401 Ga0400483_267015 3300039062 Bacteria 4949
402 Ga0439439_0004840 3300041406 Bacteria 3050
403 Ga0439447_003720 3300041407 Bacteria 5376
404 Ga0439466_0011189 3300041411 Bacteria 3321
405 Ga0439445_0012767 3300042004 Bacteria 2023
406 Ga0439432_029802 3300042006 Bacteria 1772
407 Ga0439449_0001526 3300042007 Bacteria 9067
408 Ga0439457_006183 3300042014 Bacteria 2950
409 Ga0439462_0040721 3300042015 Bacteria 1239
410 Ga0450911_000170 3300042115 Bacteria 25645
411 Ga0450894_008494 3300042131 Bacteria 1329
412 Ga0450898_007627 3300042134 Bacteria 1688
413 Ga0450906_002859 3300042145 Bacteria 3758
414 Ga0439464_0021833 3300042439 Bacteria 1759
415 Ga0453683_0021283 3300044673 Bacteria 4141
416 Ga0466966_0145112 3300044684 Bacteria 1449
417 Ga0466961_0035440 3300044693 Bacteria 3205
418 Ga0466964_0008134 3300044706 Bacteria 3936
419 Ga0466968_0041734 3300044735 Bacteria 1938
420 Ga0466970_0003734 3300044765 Bacteria 7443
421 Ga0466959_0021050 3300045049 Bacteria 4808
422 Ga0466959_0054320 3300045049 Bacteria 2927
423 Ga0466958_0032373 3300045836 Bacteria 3110
424 Ga0466967_0019794 3300045976 Bacteria 5422
425 Ga0466967_0153304 3300045976 Bacteria 2156
426 Ga0495650_0001042 3300046471 Bacteria 30968
427 Ga0495650_0004610 3300046471 Bacteria 9351
428 Ga0495650_0012325 3300046471 Bacteria 4605
429 Ga0495664_0007235 3300046477 Bacteria 6156
430 Ga0495596_0000121 3300046500 Bacteria 53954
431 Ga0495607_0000491 3300046501 Bacteria 39545
432 Ga0495610_0000387 3300046512 Bacteria 45513
433 Ga0495610_0005836 3300046512 Bacteria 8651
434 Ga0495616_0001566 3300046513 Bacteria 15769
435 Ga0495631_0004456 3300046518 Bacteria 7460
436 Ga0495648_0000107 3300046524 Bacteria 104376
437 Ga0495609_0001279 3300046538 Bacteria 17171
438 Ga0495621_0014781 3300046539 Bacteria 2478
439 Ga0495597_0000095 3300046542 Bacteria 78512
440 Ga0495597_0069321 3300046542 Bacteria 1522
441 Ga0495633_0009940 3300046558 Bacteria 5224
442 Ga0495656_0050202 3300046615 Bacteria 1780
443 Ga0495668_0017339 3300046616 Bacteria 4178
444 Ga0495668_0028005 3300046616 Bacteria 3189
445 Ga0495668_0064079 3300046616 Bacteria 2024
446 Ga0495668_0068440 3300046616 Bacteria 1953
447 Ga0495625_0001190 3300046660 Bacteria 33330
448 Ga0495661_0003687 3300046665 Bacteria 11251
449 Ga0495670_0002090 3300046691 Bacteria 9851
450 Ga0495671_0000494 3300046692 Bacteria 30400
451 Ga0495636_0003914 3300047318 Bacteria 5812
452 Ga0495674_0010007 3300047319 Bacteria 8986
453 Ga0495673_0000209 3300047469 Bacteria 88818
454 Ga0495686_0004046 3300047472 Bacteria 12251
455 Ga0495686_0140370 3300047472 Bacteria 1426
456 Ga0496101_0049619 3300048904 Bacteria 3020
457 Ga0496102_0013655 3300048905 Bacteria 7039
458 Ga0496102_0128542 3300048905 Bacteria 2370
459 Ga0496104_0313288 3300048907 Bacteria 1482
460 Ga0496105_0005577 3300048908 Bacteria 9560
461 Ga0496106_0000353 3300048909 Bacteria 32583
462 Ga0496107_0014365 3300048910 Bacteria 5544
463 Ga0496108_0006845 3300048911 Bacteria 9223
464 Ga0496109_0044187 3300048912 Bacteria 4041
465 Ga0496110_0006935 3300048913 Bacteria 9009
466 Ga0496111_0007216 3300048914 Bacteria 7269
467 Ga0496112_0001018 3300048915 Bacteria 20577
468 Ga0496112_0018343 3300048915 Bacteria 6588
469 Ga0496112_0040942 3300048915 Bacteria 4531
470 Ga0496113_0012104 3300048916 Bacteria 5788
471 Ga0496113_0262600 3300048916 Bacteria 1379
472 Ga0496116_0004217 3300048919 Bacteria 13819
473 Ga0496118_0128482 3300048921 Bacteria 1633
474 Ga0496121_0001338 3300048924 Bacteria 42197
475 Ga0496121_0009516 3300048924 Bacteria 11145
476 Ga0496121_0016061 3300048924 Bacteria 7759
477 Ga0496121_0020904 3300048924 Bacteria 6444
478 Ga0496121_0173954 3300048924 Bacteria 1561
479 Ga0496122_0000930 3300048925 Bacteria 53414
480 Ga0496122_0006566 3300048925 Bacteria 13294
481 Ga0496123_0000369 3300048926 Bacteria 84409
482 Ga0496124_0004886 3300048927 Bacteria 15421
483 Ga0496124_0054258 3300048927 Bacteria 3393
484 Ga0496124_0090719 3300048927 Bacteria 2492
485 Ga0496124_0129972 3300048927 Bacteria 2002
486 Ga0496124_0223737 3300048927 Bacteria 1413
487 Ga0496125_0000135 3300048928 Bacteria 160987
488 Ga0496125_0006101 3300048928 Bacteria 13155
489 Ga0496125_0024186 3300048928 Bacteria 5588
490 Ga0496125_0140373 3300048928 Bacteria 1681
491 Ga0496126_0128267 3300048929 Bacteria 2194
492 Ga0495678_005431 3300049459 Bacteria 7035
493 Ga0501032_0090075 3300049569 Bacteria 2036
494 Ga0501033_0008988 3300049570 Bacteria 7714
495 Ga0501034_0224190 3300049571 Bacteria 1831
496 Ga0501034_0360111 3300049571 Bacteria 1382
497 Ga0501036_0295224 3300049572 Bacteria 1356
498 Ga0501038_0094158 3300049574 Bacteria 2504
499 Ga0501039_0033146 3300049575 Bacteria 3985
500 Ga0501040_0017972 3300049576 Bacteria 4694
501 Ga0501042_0089148 3300049578 Bacteria 2213
502 Ga0501043_0077812 3300049579 Bacteria 2606
503 Ga0501046_0063525 3300049580 Bacteria 2883
504 Ga0501047_0007128 3300049581 Bacteria 10500
505 Ga0501048_0091341 3300049582 Bacteria 2148
506 Ga0501206_002828 3300049653 Bacteria 2185
507 Ga0501265_000212 3300049762 Bacteria 5754
508 Ga0501035_0006447 3300049822 Bacteria 11020
509 Ga0501035_0038470 3300049822 Bacteria 4330
510 Ga0501044_0000048 3300049823 Bacteria 145067
511 Ga0501044_0006454 3300049823 Bacteria 12954
512 Ga0501044_0184381 3300049823 Bacteria 2053
513 nmdc:mga03683_10104_c1 3300050489 Bacteria 3377
514 nmdc:mga00v17_1739_c1 3300050491 Bacteria 11315
515 nmdc:mga00v17_24763_c1 3300050491 Bacteria 3483
516 nmdc:mga0yw44_201_c1 3300050492 Bacteria 21091
517 nmdc:mga0k408_115188_c1 3300050493 Bacteria 1590
518 nmdc:mga0k408_2295_c1 3300050493 Bacteria 10200
519 nmdc:mga0k408_77261_c1 3300050493 Bacteria 1947
520 nmdc:mga06z11_14088_c1 3300050494 Bacteria 3531
521 nmdc:mga06z11_1691_c1 3300050494 Bacteria 8282
522 nmdc:mga07m45_10732_c1 3300050496 Bacteria 4793
523 nmdc:mga07m45_16391_c1 3300050496 Bacteria 3968
524 nmdc:mga07m45_8134_c1 3300050496 Bacteria 5376
525 nmdc:mga05p37_220384_c1 3300050507 Bacteria 2290
526 nmdc:mga05p37_256517_c1 3300050507 Unclassified 2095
527 nmdc:mga09592_28046_c1 3300050508 Bacteria 4675
528 nmdc:mga0qj67_30398_c1 3300050509 Bacteria 4204
529 nmdc:mga0qj67_56269_c1 3300050509 Bacteria 3117
530 nmdc:mga06r32_216213_c1 3300050510 Bacteria 1904
531 nmdc:mga0n895_163923_c1 3300050512 Bacteria 2254
532 nmdc:mga0sz30_18809_c1 3300050516 Bacteria 2768
533 nmdc:mga0sz30_3656_c1 3300050516 Bacteria 5538
534 Ga0500578_0000004 3300053086 Bacteria 260037
535 Ga0500578_0003815 3300053086 Bacteria 11058
536 Ga0500644_0000466 3300053088 Bacteria 18286
537 Ga0500646_0002432 3300053090 Bacteria 4841
538 Ga0500651_0003991 3300053093 Bacteria 8182
539 Ga0500641_0004491 3300053096 Bacteria 4929
540 Ga0500594_0000109 3300053118 Bacteria 24096
541 Ga0500564_000037 3300053138 Bacteria 36834
542 Ga0500604_0004986 3300053151 Bacteria 3515
543 Ga0500616_0022581 3300053153 Bacteria 3512
544 Ga0500616_0030976 3300053153 Bacteria 2934
545 Ga0500616_0104033 3300053153 Bacteria 1383
546 Ga0500619_000194 3300053154 Bacteria 14268
547 Ga0500620_000386 3300053155 Bacteria 8164
548 Ga0500622_0001724 3300053156 Bacteria 16928
549 Ga0500622_0002761 3300053156 Bacteria 12355
550 Ga0500622_0003898 3300053156 Bacteria 9656
551 Ga0500622_0004340 3300053156 Bacteria 8960
552 Ga0500622_0005597 3300053156 Bacteria 7490
553 Ga0500622_0013167 3300053156 Bacteria 4466
554 Ga0500639_005545 3300053163 Bacteria 6464
555 Ga0500645_000581 3300053730 Bacteria 23599
556 Ga0500645_002110 3300053730 Bacteria 9180
557 2509142352 2508501127 Bacteria 7037543
558 2512960759 2512875024 Bacteria 7195110
559 2513956126 2513237150 Bacteria 6553639
560 2514040504 2513237165 Bacteria 6771773
561 2514417333 2513237305 Bacteria 7293571
562 2585147182 2582581279 Bacteria 4980720
563 2597810951 2597489875 Bacteria 7010078
564 2643769916 2643221550 Bacteria 4619371
565 2643837721 2643221564 Bacteria 4193379
566 2643987479 2643221595 Bacteria 6565519
567 2644028803 2643221603 Bacteria 6147767
568 2644147971 2643221626 Bacteria 8069654
569 2644158002 2643221627 Bacteria 6761570
570 2644333505 2643221659 Bacteria 7890716
571 2644543776 2643221698 Bacteria 7756764
572 2723574255 2721755686 Bacteria 7343952
573 2770196390 2767802442 Bacteria 5747986
574 2774380353 2773857758 Bacteria 3592392
575 2792748150 2791355123 Bacteria 8049106
576 2792840439 2791355137 Bacteria 9654227
577 2821448748 2821443989 Bacteria 7658172
578 2831868603 2831864461 Bacteria 6502356
579 2841737583 2841734538 Bacteria 6784580
580 2841764366 2841760612 Bacteria 6454112
581 2844108179 2844104063 Bacteria 6440972
582 2844164979 2844163670 Bacteria 7266046
583 2847674838 2847670302 Bacteria 6165597
584 2851250801 2851246043 Bacteria 6439203
585 2855735778 2855730933 Bacteria 7047938
586 2855772716 2855767633 Bacteria 7049357
587 2856317277 2856314179 Bacteria 6477897
588 2856345918 2856342000 Bacteria 7176905
589 2857580913 2857576091 Bacteria 5465855
590 2871474476 2871474448 Bacteria 6806570
591 2874126767 2874123672 Bacteria 7238285
592 2874174937 2874168670 Bacteria 8062617
593 2878038315 2878035449 Bacteria 6555736
594 2878793982 2878788777 Bacteria 6567085
595 2881416290 2881412998 Bacteria 6492157
596 2881861526 2881861095 Bacteria 7128710
597 2881931373 2881927736 Bacteria 3993927
598 2882639530 2882632389 Bacteria 8154593
599 2885313015 2885312484 Bacteria 6415165
600 2888345502 2888343758 Bacteria 6611049
601 2901302506 2901300506 Bacteria 8463898
602 2906417340 2906414383 Bacteria 6580790
603 2919071556 2919069694 Bacteria 3622919
604 2924757680 2924754689 Bacteria 6774424
605 2924765197 2924762789 Bacteria 6561353
606 2924786718 2924784321 Bacteria 7416538
607 2928119798 2928115317 Bacteria 6477646
608 2937822415 2937822353 Bacteria 7290551
609 2937840182 2937836603 Bacteria 6811263
610 2941503367 2941499720 Bacteria 7599444
611 2958075288 2958071322 Bacteria 6815895
612 2970527219 2970524798 Bacteria 6840927
613 2970544122 2970540015 Bacteria 6977556
614 2977988632 2977986579 Bacteria 6581278
615 2987669688 2987666974 Bacteria 6509233
616 644751887 644736347 Bacteria 6476522
617 8004400005 8004395343 Bacteria 6620908
618 8004639729 8004633249 Bacteria 6723080
619 8055619299 8055617313 Bacteria 7548464
620 Ga0157380_10056858
621 JGI24740J21852_10012979
622 JGI25151J46595_10000604
623 JGI25151J46595_10001117
624 JGI25151J46595_10009952
625 JGI25153J46596_10000338
626 rootH1_10017530
627 rootL2_10000022
628 rootL2_10010425
629 rootH1_10003328
630 rootH1_10003329
631 Ga0055542_1000592
632 Ga0055529_1001564
633 Ga0055526_1004975
634 Ga0055526_1009094
635 Ga0055526_1013008
636 Ga0055537_1001090
637 Ga0055524_1000127
638 Ga0055524_1000141
639 Ga0055524_1001098
640 Ga0055524_1015249
641 Ga0055534_1002514
642 Ga0055531_10001681
643 Ga0055531_10024308
644 Ga0055543_1004482
645 Ga0065165_1001571
646 Ga0065714_10075018
647 Ga0070658_10014849
648 Ga0070658_10134782
649 Ga0070676_10019738
650 Ga0070670_100002285
651 Ga0070670_100049178
652 Ga0070666_10202379
653 Ga0070680_100000961
654 Ga0070680_100030116
655 Ga0068868_100025860
656 Ga0070660_100001302
657 Ga0070660_100006492
658 Ga0070661_100059635
659 Ga0070692_10003301
660 Ga0070692_10021295
661 Ga0070668_100000553
662 Ga0070668_100009283
663 Ga0070668_100020043
664 Ga0070668_100031912
665 Ga0070668_100177928
666 Ga0070668_100217801
667 Ga0070669_100142817
668 Ga0070675_100001666
669 Ga0070675_100042517
670 Ga0070675_100249187
671 Ga0070671_100011088
672 Ga0070671_100014791
673 Ga0070671_100046061
674 Ga0070671_100127752
675 Ga0070674_100005007
676 Ga0070674_100152490
677 Ga0070673_100002313
678 Ga0070673_100016604
679 Ga0070673_100032384
680 Ga0070659_100010969
681 Ga0070667_100032462
682 Ga0070667_100262093
683 Ga0070709_10049287
684 Ga0070714_100028687
685 Ga0070713_100000194
686 Ga0070711_100046808
687 Ga0070694_100111500
688 Ga0070663_100009415
689 Ga0070663_100018235
690 Ga0070678_100006974
691 Ga0070678_100008594
692 Ga0070678_100045712
693 Ga0070662_100010429
694 Ga0070662_100147591
695 Ga0070662_100214739
696 Ga0070681_10005782
697 Ga0070681_10115006
698 Ga0068867_100023796
699 Ga0068867_100133656
700 Ga0070685_10066253
701 Ga0070706_100002496
702 Ga0070679_100018638
703 Ga0070679_100040141
704 Ga0068853_100007844
705 Ga0068853_100048116
706 Ga0068853_100126650
707 Ga0070672_100001087
708 Ga0070672_100008016
709 Ga0070672_100039550
710 Ga0070665_100012733
711 Ga0070665_100036991
712 Ga0070665_100037523
713 Ga0070704_100062164
714 Ga0068855_100001539
715 Ga0068855_100037831
716 Ga0070664_100002042
717 Ga0070664_100057872
718 Ga0068854_100042550
719 Ga0068856_100000246
720 Ga0068856_100051662
721 Ga0068856_100055321
722 Ga0068856_100139772
723 Ga0068852_100023255
724 Ga0068852_100090732
725 Ga0068852_100105644
726 Ga0068859_100485541
727 Ga0068864_100002152
728 Ga0068864_100003200
729 Ga0068864_100009011
730 Ga0068864_100053189
731 Ga0068866_10058170
732 Ga0068861_100016791
733 Ga0068851_10028274
734 Ga0068863_100032927
735 Ga0068863_100044309
736 Ga0068863_100048559
737 Ga0068863_100131159
738 Ga0068863_100186663
739 Ga0068860_100050885
740 Ga0068860_100081375
741 Ga0068860_100133886
742 Ga0068862_100028584
743 Ga0068862_100039351
744 Ga0068862_100044841
745 Ga0081540_1000084
746 Ga0070717_10011506
747 Ga0070717_10026853
748 Ga0070717_10186382
749 Ga0075365_10003404
750 Ga0075365_10037855
751 Ga0075368_10007574
752 Ga0075363_100026377
753 Ga0075364_10003306
754 Ga0075364_10014945
755 Ga0070715_10006854
756 Ga0070716_100058357
757 Ga0075362_10012325
758 Ga0075367_10010594
759 Ga0075367_10016817
760 Ga0075367_10106113
761 Ga0075366_10000452
762 Ga0075366_10006946
763 Ga0097621_100048144
764 Ga0075370_10007792
765 Ga0075370_10029713
766 Ga0068871_100003052
767 Ga0068871_100033702
768 Ga0068871_100098738
769 Ga0075428_100108589
770 Ga0075428_100191669
771 Ga0075428_100211275
772 Ga0075428_100313482
773 Ga0075430_100041936
774 Ga0075430_100058019
775 Ga0075431_100217711
776 Ga0097620_100485576
777 Ga0099823_1000003
778 Ga0099826_10000074
779 Ga0105240_10023028
780 Ga0111539_10537793
781 Ga0114129_10176801
782 Ga0114129_10221836
783 Ga0114129_10311438
784 Ga0105241_10012603
785 Ga0105248_10001530
786 Ga0105248_10079729
787 Ga0105248_10232319
788 Ga0105237_10007074
789 Ga0105237_10037129
790 Ga0105237_10052174
791 Ga0105238_10076849
792 Ga0105238_10077063
793 Ga0099796_10004452
794 Ga0105239_10002719
795 Ga0105239_10199603
796 Ga0105239_10299589
797 Ga0105239_10392272
798 Ga0157319_1000002
799 Ga0157373_10001898
800 Ga0157373_10108105
801 Ga0157371_10003903
802 Ga0157370_10005307
803 Ga0157370_10024812
804 Ga0157369_10188744
805 Ga0157374_10289804
806 Ga0157378_10064459
807 Ga0157378_10155424
808 Ga0163162_10063903
809 Ga0157372_10004840
810 Ga0157375_10001141
811 Ga0157375_10015717
812 Ga0157375_10253693
813 Ga0157375_10297056
814 Ga0163163_10018021
815 Ga0157380_10026450
816 Ga0157376_10090581
817 Ga0157376_10097084
818 Ga0157376_10105230
819 Ga0157376_10278938
820 Ga0182006_1020552
821 Ga0183362_10002
822 Ga0163161_10049561
823 Ga0163161_10071347
824 Ga0206353_10962024
825 Ga0207425_1001160
826 Ga0209148_1000069
827 Ga0209129_1000122
828 Ga0209565_1000079
829 Ga0209565_1000620
830 Ga0209455_1000219
831 Ga0209673_1008367
832 Ga0209673_1010738
833 Ga0209673_1030080
834 Ga0209675_1000784
835 Ga0209676_1016448
836 Ga0209025_1000027
837 Ga0209025_1000113
838 Ga0209025_1000897
839 Ga0209025_1002276
840 Ga0209564_1000266
841 Ga0209564_1000624
842 Ga0209564_1001384
843 Ga0209564_1028373
844 Ga0209758_1000091
845 Ga0209050_1003171
846 Ga0209256_1000190
847 Ga0209256_1000938
848 Ga0209256_1001291
849 Ga0209256_1004279
850 Ga0209256_1019724
851 Ga0209051_1000301
852 Ga0209051_1003421
853 Ga0209051_1007088
854 Ga0209051_1012951
855 Ga0209051_1036472
856 Ga0209257_1000022
857 Ga0209257_1000385
858 Ga0209257_1006540
859 Ga0207697_10012754
860 Ga0207656_10005928
861 Ga0207688_10053973
862 Ga0207680_10095556
863 Ga0207647_10006394
864 Ga0207685_10006850
865 Ga0207645_10005846
866 Ga0207645_10025763
867 Ga0207705_10001451
868 Ga0207705_10133142
869 Ga0207684_10005984
870 Ga0207707_10108845
871 Ga0207707_10188191
872 Ga0207695_10087351
873 Ga0207671_10005013
874 Ga0207693_10035458
875 Ga0207660_10010018
876 Ga0207657_10003661
877 Ga0207657_10005884
878 Ga0207657_10092557
879 Ga0207657_10094545
880 Ga0207652_10002630
881 Ga0207652_10072275
882 Ga0207646_10103212
883 Ga0207694_10076772
884 Ga0207650_10009329
885 Ga0207650_10180443
886 Ga0207659_10033231
887 Ga0207659_10034054
888 Ga0207659_10143214
889 Ga0207700_10000176
890 Ga0207644_10000090
891 Ga0207644_10007428
892 Ga0207644_10105175
893 Ga0207690_10014160
894 Ga0207706_10000190
895 Ga0207706_10060496
896 Ga0207706_10369621
897 Ga0207670_10075891
898 Ga0207669_10106470
899 Ga0207669_10150095
900 Ga0207704_10037031
901 Ga0207665_10001117
902 Ga0207691_10000018
903 Ga0207691_10001640
904 Ga0207691_10024128
905 Ga0207691_10249288
906 Ga0207711_10000817
907 Ga0207711_10044961
908 Ga0207711_10220162
909 Ga0207661_10034890
910 Ga0207679_10005470
911 Ga0207679_10024488
912 Ga0207679_10040637
913 Ga0207667_10027116
914 Ga0207651_10010594
915 Ga0207651_10034621
916 Ga0207712_10047184
917 Ga0207668_10002243
918 Ga0207668_10017775
919 Ga0207668_10060404
920 Ga0207668_10251776
921 Ga0207658_10021442
922 Ga0207677_10069348
923 Ga0207677_10084546
924 Ga0207639_10064051
925 Ga0207639_10118665
926 Ga0207678_10000754
927 Ga0207678_10029792
928 Ga0207708_10015323
929 Ga0207702_10004336
930 Ga0207702_10008638
931 Ga0207702_10138942
932 Ga0207641_10023318
933 Ga0207641_10056390
934 Ga0207641_10124196
935 Ga0207648_10054808
936 Ga0207648_10120030
937 Ga0207648_10151460
938 Ga0207676_10034960
939 Ga0207676_10044209
940 Ga0207676_10073622
941 Ga0207676_10266030
942 Ga0207674_10205209
943 Ga0207675_100015915
944 Ga0207675_100057355
945 Ga0207675_100092065
946 Ga0207675_100269723
947 Ga0207683_10000163
948 Ga0207683_10016089
949 Ga0207683_10046665
950 Ga0207683_10097979
951 Ga0207683_10141571
952 Ga0207698_10010993
953 Ga0207698_10011390
954 Ga0209389_1001915
955 Ga0209371_1016471
956 Ga0209282_1000113
957 Ga0209974_10016485
958 Ga0268266_10019573
959 Ga0268266_10029488
960 Ga0268266_10070290
961 Ga0268266_10147182
962 Ga0268265_10012175
963 Ga0268265_10219227
964 Ga0307511_10001237
965 Ga0265327_10055188
966 Ga0307509_10177132
967 Ga0307509_10213583
968 Ga0307408_100004584
969 Ga0307405_10005949
970 Ga0307405_10035256
971 Ga0307405_10109471
972 Ga0307405_10173217
973 Ga0307413_10001161
974 Ga0307413_10007135
975 Ga0307413_10062112
976 Ga0307410_10001726
977 Ga0307410_10013289
978 Ga0307410_10033884
979 Ga0307406_10004201
980 Ga0307406_10047763
981 Ga0307407_10004762
982 Ga0307412_10014159
983 Ga0307412_10065053
984 Ga0307409_100007546
985 Ga0307409_100056645
986 Ga0307409_100181619
987 Ga0307416_100008129
988 Ga0307416_100057655
989 Ga0307416_100117371
990 Ga0307416_100122967
991 Ga0307414_10063482
992 Ga0307414_10089589
993 Ga0307411_10000419
994 Ga0307411_10007751
995 Ga0307411_10044724
996 Ga0307411_10071691
997 Ga0307415_100003744
998 Ga0307507_10098078
999 Ga0373931_0035756
1000 Ga0395899_0000445
1001 Ga0395899_0001915
1002 Ga0395899_0013095
1003 Ga0395900_0000280
1004 Ga0395900_0006347
1005 Ga0395898_0000169
1006 Ga0395898_0001517
1007 Ga0395898_0023320
1008 Ga0395905_0000109
1009 Ga0395905_0001662
1010 Ga0395905_0001796
1011 Ga0395905_0002187
1012 Ga0395905_0007293
1013 Ga0395905_0038410
1014 Ga0395905_0181059
1015 Ga0395901_0000444
1016 Ga0395901_0001994
1017 Ga0395901_0041935
1018 Ga0395901_0108371
1019 Ga0400483_267015
1020 Ga0439439_0004840
1021 Ga0439447_003720
1022 Ga0439466_0011189
1023 Ga0439445_0012767
1024 Ga0439432_029802
1025 Ga0439449_0001526
1026 Ga0439457_006183
1027 Ga0439462_0040721
1028 Ga0450911_000170
1029 Ga0450894_008494
1030 Ga0450898_007627
1031 Ga0450906_002859
1032 Ga0439464_0021833
1033 Ga0453683_0021283
1034 Ga0466966_0145112
1035 Ga0466961_0035440
1036 Ga0466964_0008134
1037 Ga0466968_0041734
1038 Ga0466970_0003734
1039 Ga0466959_0021050
1040 Ga0466959_0054320
1041 Ga0466958_0032373
1042 Ga0466967_0019794
1043 Ga0466967_0153304
1044 Ga0495650_0001042
1045 Ga0495650_0004610
1046 Ga0495650_0012325
1047 Ga0495664_0007235
1048 Ga0495596_0000121
1049 Ga0495607_0000491
1050 Ga0495610_0000387
1051 Ga0495610_0005836
1052 Ga0495616_0001566
1053 Ga0495631_0004456
1054 Ga0495648_0000107
1055 Ga0495609_0001279
1056 Ga0495621_0014781
1057 Ga0495597_0000095
1058 Ga0495597_0069321
1059 Ga0495633_0009940
1060 Ga0495656_0050202
1061 Ga0495668_0017339
1062 Ga0495668_0028005
1063 Ga0495668_0064079
1064 Ga0495668_0068440
1065 Ga0495625_0001190
1066 Ga0495661_0003687
1067 Ga0495670_0002090
1068 Ga0495671_0000494
1069 Ga0495636_0003914
1070 Ga0495674_0010007
1071 Ga0495673_0000209
1072 Ga0495686_0004046
1073 Ga0495686_0140370
1074 Ga0496101_0049619
1075 Ga0496102_0013655
1076 Ga0496102_0128542
1077 Ga0496104_0313288
1078 Ga0496105_0005577
1079 Ga0496106_0000353
1080 Ga0496107_0014365
1081 Ga0496108_0006845
1082 Ga0496109_0044187
1083 Ga0496110_0006935
1084 Ga0496111_0007216
1085 Ga0496112_0001018
1086 Ga0496112_0018343
1087 Ga0496112_0040942
1088 Ga0496113_0012104
1089 Ga0496113_0262600
1090 Ga0496116_0004217
1091 Ga0496118_0128482
1092 Ga0496121_0001338
1093 Ga0496121_0009516
1094 Ga0496121_0016061
1095 Ga0496121_0020904
1096 Ga0496121_0173954
1097 Ga0496122_0000930
1098 Ga0496122_0006566
1099 Ga0496123_0000369
1100 Ga0496124_0004886
1101 Ga0496124_0054258
1102 Ga0496124_0090719
1103 Ga0496124_0129972
1104 Ga0496124_0223737
1105 Ga0496125_0000135
1106 Ga0496125_0006101
1107 Ga0496125_0024186
1108 Ga0496125_0140373
1109 Ga0496126_0128267
1110 Ga0495678_005431
1111 Ga0501032_0090075
1112 Ga0501033_0008988
1113 Ga0501034_0224190
1114 Ga0501034_0360111
1115 Ga0501036_0295224
1116 Ga0501038_0094158
1117 Ga0501039_0033146
1118 Ga0501040_0017972
1119 Ga0501042_0089148
1120 Ga0501043_0077812
1121 Ga0501046_0063525
1122 Ga0501047_0007128
1123 Ga0501048_0091341
1124 Ga0501206_002828
1125 Ga0501265_000212
1126 Ga0501035_0006447
1127 Ga0501035_0038470
1128 Ga0501044_0000048
1129 Ga0501044_0006454
1130 Ga0501044_0184381
1131 nmdc:mga03683_10104_c1
1132 nmdc:mga00v17_1739_c1
1133 nmdc:mga00v17_24763_c1
1134 nmdc:mga0yw44_201_c1
1135 nmdc:mga0k408_115188_c1
1136 nmdc:mga0k408_2295_c1
1137 nmdc:mga0k408_77261_c1
1138 nmdc:mga06z11_14088_c1
1139 nmdc:mga06z11_1691_c1
1140 nmdc:mga07m45_10732_c1
1141 nmdc:mga07m45_16391_c1
1142 nmdc:mga07m45_8134_c1
1143 nmdc:mga05p37_220384_c1
1144 nmdc:mga05p37_256517_c1
1145 nmdc:mga09592_28046_c1
1146 nmdc:mga0qj67_30398_c1
1147 nmdc:mga0qj67_56269_c1
1148 nmdc:mga06r32_216213_c1
1149 nmdc:mga0n895_163923_c1
1150 nmdc:mga0sz30_18809_c1
1151 nmdc:mga0sz30_3656_c1
1152 Ga0500578_0000004
1153 Ga0500578_0003815
1154 Ga0500644_0000466
1155 Ga0500646_0002432
1156 Ga0500651_0003991
1157 Ga0500641_0004491
1158 Ga0500594_0000109
1159 Ga0500564_000037
1160 Ga0500604_0004986
1161 Ga0500616_0022581
1162 Ga0500616_0030976
1163 Ga0500616_0104033
1164 Ga0500619_000194
1165 Ga0500620_000386
1166 Ga0500622_0001724
1167 Ga0500622_0002761
1168 Ga0500622_0003898
1169 Ga0500622_0004340
1170 Ga0500622_0005597
1171 Ga0500622_0013167
1172 Ga0500639_005545
1173 Ga0500645_000581
1174 Ga0500645_002110
1175 2509142352
1176 2512960759
1177 2513956126
1178 2514040504
1179 2514417333
1180 2585147182
1181 2597810951
1182 2643769916
1183 2643837721
1184 2643987479
1185 2644028803
1186 2644147971
1187 2644158002
1188 2644333505
1189 2644543776
1190 2723574255
1191 2770196390
1192 2774380353
1193 2792748150
1194 2792840439
1195 2821448748
1196 2831868603
1197 2841737583
1198 2841764366
1199 2844108179
1200 2844164979
1201 2847674838
1202 2851250801
1203 2855735778
1204 2855772716
1205 2856317277
1206 2856345918
1207 2857580913
1208 2871474476
1209 2874126767
1210 2874174937
1211 2878038315
1212 2878793982
1213 2881416290
1214 2881861526
1215 2881931373
1216 2882639530
1217 2885313015
1218 2888345502
1219 2901302506
1220 2906417340
1221 2919071556
1222 2924757680
1223 2924765197
1224 2924786718
1225 2928119798
1226 2937822415
1227 2937840182
1228 2941503367
1229 2958075288
1230 2970527219
1231 2970544122
1232 2977988632
1233 2987669688
1234 644751887
1235 8004400005
1236 8004639729
1237 8055619299

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

62

434

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bk2-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: q301e mutant 0.8535 6 36
7xe1-assembly1.cif.gz_A crystal structure of lsd2 in complex with cis-4-br-pcpa 0.8349 6 36
4j34-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase - truncated at position 394 plus his tag cleaved. 0.8218 7 36
4bjz-assembly1.cif.gz_A crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: native data 0.8195 8 37
4bk1-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: h213s mutant in complex with 3-hydroxybenzoate 0.8183 8 37
ID Description Score Start End Superfamily
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9442 224 315 3.30.1540.10
4hl6D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9382 6 221 3.40.50.10540
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9344 224 315 3.30.1540.10
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9311 224 315 3.30.1540.10
af_Q68FU4_261_348_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9283 230 312 3.30.1540.10
ID Description Score Start End GO Terms
AF-X8DXQ6-F1-model_v4 CoA-transferase III family protein 0.9911 65 140 GO:0016740
AF-A0A521KYS9-F1-model_v4 CoA transferase 0.964 6 153 GO:0008410
AF-A0A7Y7YJD4-F1-model_v4 CoA transferase 0.9638 19 142 GO:0016740
AF-A0A6J5CU96-F1-model_v4 Formyl-CoA:oxalate CoA-transferase (EC 2.8.3.16) 0.9634 5 155 GO:0033608
AF-A0A3M3RLL0-F1-model_v4 deleted 0.9602 1 151

Map