F469736

General Info

Members Datasets Scaffolds Average Seq Length
618 256 1222 85

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10672470|Ga0207645_106724702
Length 105
Sequence LDLEELTHLSSLEKCSHKPLMENKEIIEKIHSFLVEEFEVEPEKIVPEANLKETLGLDSLDYIDLVVVIESNFAFKVKPEDFTDIATFQDFCDYVISRVNSKELV

Samples

Sample ID Description Type Environment
1 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2088090002 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
164 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
165 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
166 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
167 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
168 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
169 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
170 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
171 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
174 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
190 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
218 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
221 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
228 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
236 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
237 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
244 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
245 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
246 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
247 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
248 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
249 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
250 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
251 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
252 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
253 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
254 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
255 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
256 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.18
Nodule 0
Rhizoplane 2.1
Rhizosphere 86.25
Stem 0
Stem Tuber 0
Unclassified 9.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207645_10672470 3300025907 Unclassified 703
2 CNA_F7QKVOU01BIBUY 2088090002 Bacteria 507
3 MBSR1b_contig_1436207 2162886012 Bacteria 1379
4 JGI24740J21852_10080703 3300001979 Bacteria 853
5 JGI24737J22298_10000148 3300001990 Bacteria 21941
6 JGI24735J21928_10000020 3300002067 Bacteria 108706
7 rootH1_10000337 3300003316 Bacteria 26455
8 rootH1_10000337 3300003323 Bacteria 8315
9 rootH1_10021873 3300003316 Bacteria 26221
10 rootH2_10001223 3300003320 Bacteria 131149
11 rootH2_10003246 3300003320 Bacteria 168239
12 rootH2_10340990 3300003320 Bacteria 1547
13 rootL2_10021639 3300003322 Bacteria 6506
14 rootL2_10023564 3300003322 Bacteria 9230
15 rootL2_10033367 3300003322 Bacteria 8550
16 rootH1_10002599 3300003316 Bacteria 7117
17 rootH1_10002599 3300003323 Bacteria 52591
18 rootH1_10027970 3300003323 Bacteria 2715
19 rootH1_10029269 3300003323 Bacteria 5270
20 rootH1_10052813 3300003323 Bacteria 3790
21 rootH1_10100022 3300003323 Bacteria 1243
22 Ga0065165_1007023 3300005262 Bacteria 5676
23 Ga0065714_10003718 3300005288 Bacteria 9007
24 Ga0065714_10076271 3300005288 Bacteria 2811
25 Ga0065714_10263545 3300005288 Bacteria 752
26 Ga0065714_10400664 3300005288 Bacteria 584
27 Ga0065704_10302631 3300005289 Bacteria 882
28 Ga0065707_10255691 3300005295 Bacteria 1112
29 Ga0070658_10104568 3300005327 Bacteria 2342
30 Ga0070658_10367116 3300005327 Bacteria 1234
31 Ga0070676_10000231 3300005328 Bacteria 23863
32 Ga0070676_10743144 3300005328 Unclassified 720
33 Ga0068869_100002049 3300005334 Bacteria 12106
34 Ga0068869_100157523 3300005334 Bacteria 1766
35 Ga0068869_100366804 3300005334 Bacteria 1177
36 Ga0068869_100557167 3300005334 Bacteria 964
37 Ga0068869_101151799 3300005334 Bacteria 680
38 Ga0070666_10000078 3300005335 Bacteria 69922
39 Ga0070666_10980979 3300005335 Unclassified 626
40 Ga0068868_100008072 3300005338 Bacteria 7529
41 Ga0068868_100028945 3300005338 Bacteria 4240
42 Ga0068868_100106199 3300005338 Bacteria 2277
43 Ga0068868_100249591 3300005338 Bacteria 1493
44 Ga0068868_100816863 3300005338 Bacteria 842
45 Ga0068868_101398951 3300005338 Unclassified 652
46 Ga0070689_100521400 3300005340 Bacteria 1020
47 Ga0070687_100862824 3300005343 Bacteria 646
48 Ga0070661_100578755 3300005344 Bacteria 906
49 Ga0070661_101268405 3300005344 Bacteria 617
50 Ga0070661_101559674 3300005344 Bacteria 558
51 Ga0070668_100081121 3300005347 Bacteria 2543
52 Ga0070668_100633423 3300005347 Bacteria 938
53 Ga0070668_101051238 3300005347 Bacteria 733
54 Ga0070675_100175229 3300005354 Bacteria 1852
55 Ga0070675_100192214 3300005354 Bacteria 1769
56 Ga0070675_101036663 3300005354 Bacteria 754
57 Ga0070671_100061553 3300005355 Bacteria 3126
58 Ga0070671_100134878 3300005355 Bacteria 2081
59 Ga0070671_100143560 3300005355 Bacteria 2015
60 Ga0070671_100149624 3300005355 Bacteria 1971
61 Ga0070674_100282843 3300005356 Bacteria 1315
62 Ga0070674_101264134 3300005356 Bacteria 657
63 Ga0070673_100018285 3300005364 Bacteria 5002
64 Ga0070673_100062741 3300005364 Bacteria 2954
65 Ga0070673_100073158 3300005364 Bacteria 2758
66 Ga0070673_100493944 3300005364 Bacteria 1106
67 Ga0070673_102281815 3300005364 Bacteria 514
68 Ga0070688_100057899 3300005365 Bacteria 2438
69 Ga0070688_101316324 3300005365 Bacteria 583
70 Ga0070688_101739910 3300005365 Bacteria 511
71 Ga0070667_100011803 3300005367 Bacteria 7222
72 Ga0070667_100026421 3300005367 Bacteria 4829
73 Ga0070667_100087311 3300005367 Bacteria 2677
74 Ga0070667_100743791 3300005367 Bacteria 909
75 Ga0070667_100822763 3300005367 Bacteria 863
76 Ga0070667_101514261 3300005367 Bacteria 630
77 Ga0070700_100141012 3300005441 Bacteria 1638
78 Ga0070700_100148338 3300005441 Bacteria 1601
79 Ga0070663_100364896 3300005455 Unclassified 1172
80 Ga0070663_100673765 3300005455 Bacteria 877
81 Ga0070678_100189429 3300005456 Bacteria 1690
82 Ga0070678_100393105 3300005456 Unclassified 1203
83 Ga0070678_100789775 3300005456 Bacteria 861
84 Ga0070662_100331851 3300005457 Unclassified 1243
85 Ga0068867_100000586 3300005459 Bacteria 24122
86 Ga0068867_100180724 3300005459 Bacteria 1677
87 Ga0068867_100590481 3300005459 Bacteria 967
88 Ga0068867_101964633 3300005459 Bacteria 552
89 Ga0070685_10013986 3300005466 Bacteria 4246
90 Ga0070685_10800480 3300005466 Bacteria 695
91 Ga0070685_10821806 3300005466 Bacteria 686
92 Ga0070685_11113106 3300005466 Bacteria 597
93 Ga0070679_100147590 3300005530 Unclassified 2329
94 Ga0068853_100007787 3300005539 Bacteria 8592
95 Ga0068853_100013770 3300005539 Bacteria 6608
96 Ga0068853_100091439 3300005539 Bacteria 2676
97 Ga0068853_100163124 3300005539 Bacteria 2012
98 Ga0070672_100102064 3300005543 Bacteria 2328
99 Ga0070672_100223214 3300005543 Bacteria 1581
100 Ga0070672_100261544 3300005543 Unclassified 1459
101 Ga0070672_100330760 3300005543 Bacteria 1296
102 Ga0070672_100801359 3300005543 Bacteria 829
103 Ga0070665_101761329 3300005548 Unclassified 626
104 Ga0068855_100053370 3300005563 Bacteria 4756
105 Ga0068855_100061731 3300005563 Bacteria 4378
106 Ga0068857_100059756 3300005577 Bacteria 3387
107 Ga0068857_101986428 3300005577 Unclassified 570
108 Ga0068854_100130757 3300005578 Bacteria 1916
109 Ga0068854_100293820 3300005578 Bacteria 1312
110 Ga0068854_100421874 3300005578 Bacteria 1108
111 Ga0068856_100003542 3300005614 Bacteria 15720
112 Ga0068856_100010896 3300005614 Bacteria 8825
113 Ga0068856_101259362 3300005614 Archaea 755
114 Ga0068856_101888544 3300005614 Bacteria 608
115 Ga0068852_100000614 3300005616 Bacteria 23382
116 Ga0068852_100002267 3300005616 Bacteria 13207
117 Ga0068852_100693104 3300005616 Bacteria 1028
118 Ga0068852_101397974 3300005616 Bacteria 722
119 Ga0068852_102302514 3300005616 Bacteria 560
120 Ga0068859_100000003 3300005617 Bacteria 479218
121 Ga0068859_100018877 3300005617 Bacteria 6929
122 Ga0068859_100081374 3300005617 Bacteria 3281
123 Ga0068859_100204161 3300005617 Bacteria 2061
124 Ga0068859_100336376 3300005617 Bacteria 1604
125 Ga0068859_101044336 3300005617 Bacteria 898
126 Ga0068864_100003917 3300005618 Bacteria 12262
127 Ga0068864_100167138 3300005618 Bacteria 2003
128 Ga0068864_100308683 3300005618 Bacteria 1483
129 Ga0068864_101851077 3300005618 Bacteria 609
130 Ga0068866_10001781 3300005718 Bacteria 9071
131 Ga0068866_10173086 3300005718 Unclassified 1269
132 Ga0068861_101452453 3300005719 Bacteria 671
133 Ga0068861_102162576 3300005719 Bacteria 557
134 Ga0068851_10028995 3300005834 Bacteria 2737
135 Ga0068851_10082916 3300005834 Bacteria 1677
136 Ga0068851_10099533 3300005834 Bacteria 1541
137 Ga0068851_10578827 3300005834 Bacteria 681
138 Ga0068863_100006890 3300005841 Bacteria 11136
139 Ga0068863_100265284 3300005841 Bacteria 1661
140 Ga0068863_100441702 3300005841 Bacteria 1276
141 Ga0068863_101311389 3300005841 Unclassified 731
142 Ga0068863_101565280 3300005841 Bacteria 668
143 Ga0068863_102043464 3300005841 Bacteria 583
144 Ga0068858_100002816 3300005842 Bacteria 17485
145 Ga0068858_101406486 3300005842 Bacteria 687
146 Ga0068860_100002009 3300005843 Bacteria 21464
147 Ga0068860_100007756 3300005843 Bacteria 10722
148 Ga0068860_100016973 3300005843 Bacteria 7095
149 Ga0068860_100704279 3300005843 Bacteria 1020
150 Ga0068860_101019895 3300005843 Bacteria 846
151 Ga0068860_102051766 3300005843 Unclassified 593
152 Ga0068862_100133101 3300005844 Bacteria 2201
153 Ga0068862_101787858 3300005844 Bacteria 624
154 Ga0075369_10341444 3300006186 Bacteria 702
155 Ga0075366_10000091 3300006195 Bacteria 36066
156 Ga0075366_10092113 3300006195 Bacteria 1816
157 Ga0075366_10558183 3300006195 Bacteria 709
158 Ga0097621_100000777 3300006237 Bacteria 22354
159 Ga0097621_100001974 3300006237 Bacteria 13971
160 Ga0097621_100143444 3300006237 Bacteria 2043
161 Ga0097621_100738492 3300006237 Bacteria 908
162 Ga0097621_100894428 3300006237 Unclassified 827
163 Ga0097621_101036554 3300006237 Bacteria 768
164 Ga0075370_10596015 3300006353 Bacteria 669
165 Ga0068871_100000154 3300006358 Bacteria 45466
166 Ga0068871_100074646 3300006358 Bacteria 2798
167 Ga0068871_100180249 3300006358 Bacteria 1815
168 Ga0068871_101179246 3300006358 Bacteria 718
169 Ga0068871_101388425 3300006358 Bacteria 662
170 Ga0068871_101849478 3300006358 Bacteria 574
171 Ga0075430_100128116 3300006846 Bacteria 2116
172 Ga0075431_100915216 3300006847 Bacteria 846
173 Ga0068865_100000172 3300006881 Bacteria 35866
174 Ga0068865_100182295 3300006881 Bacteria 1618
175 Ga0068865_100253168 3300006881 Bacteria 1391
176 Ga0068865_101536913 3300006881 Unclassified 597
177 Ga0097620_100000003 3300006931 Bacteria 479218
178 Ga0097620_100018877 3300006931 Bacteria 6929
179 Ga0097620_100081377 3300006931 Bacteria 3281
180 Ga0097620_100204160 3300006931 Bacteria 2061
181 Ga0097620_100336379 3300006931 Bacteria 1604
182 Ga0097620_101044479 3300006931 Bacteria 898
183 Ga0105240_11649717 3300009093 Bacteria 670
184 Ga0105240_11863377 3300009093 Bacteria 626
185 Ga0105240_12443212 3300009093 Bacteria 541
186 Ga0111539_10018476 3300009094 Bacteria 8635
187 Ga0111539_10024964 3300009094 Bacteria 7325
188 Ga0111539_10342300 3300009094 Bacteria 1741
189 Ga0111539_11216489 3300009094 Bacteria 875
190 Ga0111539_11365601 3300009094 Bacteria 822
191 Ga0105245_10504692 3300009098 Bacteria 1226
192 Ga0105245_10714983 3300009098 Bacteria 1036
193 Ga0105247_10001017 3300009101 Bacteria 21132
194 Ga0105247_10402581 3300009101 Bacteria 976
195 Ga0105247_10823230 3300009101 Unclassified 710
196 Ga0105243_10207292 3300009148 Bacteria 1723
197 Ga0105243_10618732 3300009148 Bacteria 1045
198 Ga0105243_12410793 3300009148 Bacteria 565
199 Ga0105241_10000847 3300009174 Bacteria 23164
200 Ga0105241_10013980 3300009174 Bacteria 5886
201 Ga0105241_10374406 3300009174 Bacteria 1242
202 Ga0105241_12369509 3300009174 Bacteria 529
203 Ga0105242_10020115 3300009176 Bacteria 5232
204 Ga0105242_10083586 3300009176 Bacteria 2674
205 Ga0105242_10104661 3300009176 Unclassified 2403
206 Ga0105242_10784764 3300009176 Bacteria 941
207 Ga0105242_12137198 3300009176 Unclassified 604
208 Ga0105242_12147183 3300009176 Bacteria 603
209 Ga0105248_10497438 3300009177 Bacteria 1374
210 Ga0105237_10001395 3300009545 Bacteria 31908
211 Ga0105237_10001455 3300009545 Bacteria 31241
212 Ga0105237_10466611 3300009545 Bacteria 1269
213 Ga0105237_12399183 3300009545 Bacteria 538
214 Ga0105237_12767060 3300009545 Bacteria 502
215 Ga0105238_10596424 3300009551 Unclassified 1112
216 Ga0105238_11200254 3300009551 Bacteria 783
217 Ga0105238_11568767 3300009551 Bacteria 688
218 Ga0105249_10005639 3300009553 Bacteria 10832
219 Ga0105249_10687441 3300009553 Bacteria 1082
220 Ga0105249_11752232 3300009553 Bacteria 694
221 Ga0105249_12597274 3300009553 Bacteria 579
222 Ga0105249_12642204 3300009553 Unclassified 574
223 Ga0105239_10054410 3300010375 Bacteria 4390
224 Ga0105239_10064333 3300010375 Bacteria 4026
225 Ga0105239_10160641 3300010375 Bacteria 2510
226 Ga0105239_10176462 3300010375 Bacteria 2390
227 Ga0105239_10513044 3300010375 Bacteria 1363
228 Ga0105239_11841067 3300010375 Bacteria 702
229 Ga0105246_10087476 3300011119 Bacteria 2237
230 Ga0105246_10291745 3300011119 Bacteria 1313
231 Ga0157371_10042159 3300013102 Bacteria 3254
232 Ga0157370_10231082 3300013104 Bacteria 1712
233 Ga0157370_10399185 3300013104 Unclassified 1266
234 Ga0157370_10914332 3300013104 Bacteria 796
235 Ga0157370_11278688 3300013104 Bacteria 661
236 Ga0157369_10185088 3300013105 Bacteria 2190
237 Ga0157374_10000849 3300013296 Bacteria 26704
238 Ga0157374_10131243 3300013296 Bacteria 2425
239 Ga0157374_10211921 3300013296 Bacteria 1899
240 Ga0157374_10294586 3300013296 Bacteria 1604
241 Ga0157374_10388546 3300013296 Bacteria 1391
242 Ga0157374_11134958 3300013296 Bacteria 802
243 Ga0157374_11256376 3300013296 Bacteria 762
244 Ga0157378_10007598 3300013297 Bacteria 9463
245 Ga0157378_10038908 3300013297 Bacteria 4217
246 Ga0157378_10080319 3300013297 Bacteria 2946
247 Ga0157378_10158378 3300013297 Bacteria 2116
248 Ga0157378_10617202 3300013297 Bacteria 1097
249 Ga0157378_11732384 3300013297 Bacteria 672
250 Ga0157378_12878957 3300013297 Bacteria 533
251 Ga0157378_13032038 3300013297 Bacteria 521
252 Ga0163162_10000361 3300013306 Bacteria 41263
253 Ga0163162_10000568 3300013306 Bacteria 34113
254 Ga0163162_10061419 3300013306 Bacteria 3796
255 Ga0163162_10065676 3300013306 Bacteria 3676
256 Ga0163162_10172866 3300013306 Bacteria 2285
257 Ga0163162_10456307 3300013306 Bacteria 1410
258 Ga0163162_10593971 3300013306 Bacteria 1234
259 Ga0163162_10775708 3300013306 Unclassified 1077
260 Ga0163162_11239030 3300013306 Unclassified 847
261 Ga0163162_11905804 3300013306 Bacteria 680
262 Ga0157372_10001279 3300013307 Bacteria 27221
263 Ga0157372_10027329 3300013307 Bacteria 6213
264 Ga0157372_11032845 3300013307 Bacteria 952
265 Ga0157375_10003003 3300013308 Bacteria 14649
266 Ga0157375_10239294 3300013308 Bacteria 1975
267 Ga0157375_10309110 3300013308 Bacteria 1745
268 Ga0157375_10364905 3300013308 Bacteria 1610
269 Ga0157375_10416474 3300013308 Bacteria 1510
270 Ga0157375_11184975 3300013308 Bacteria 896
271 Ga0157375_11283565 3300013308 Bacteria 860
272 Ga0157375_13342079 3300013308 Bacteria 535
273 Ga0163163_10086565 3300014325 Bacteria 3143
274 Ga0163163_10098735 3300014325 Bacteria 2941
275 Ga0163163_10623390 3300014325 Bacteria 1142
276 Ga0163163_10831385 3300014325 Bacteria 987
277 Ga0163163_11095282 3300014325 Unclassified 859
278 Ga0163163_12098616 3300014325 Bacteria 625
279 Ga0163163_12139922 3300014325 Bacteria 619
280 Ga0157380_10000046 3300014326 Bacteria 73022
281 Ga0157380_10009471 3300014326 Bacteria 6980
282 Ga0157380_10021434 3300014326 Bacteria 4846
283 Ga0157380_10591603 3300014326 Bacteria 1096
284 Ga0157380_10794307 3300014326 Bacteria 963
285 Ga0157380_12417229 3300014326 Bacteria 591
286 Ga0157380_13310532 3300014326 Bacteria 515
287 Ga0157377_10540315 3300014745 Unclassified 821
288 Ga0157377_10561183 3300014745 Bacteria 808
289 Ga0157377_10759002 3300014745 Bacteria 711
290 Ga0157379_10123204 3300014968 Bacteria 2333
291 Ga0157379_10245139 3300014968 Bacteria 1625
292 Ga0157379_11535403 3300014968 Bacteria 649
293 Ga0157379_12131652 3300014968 Bacteria 556
294 Ga0157376_10082731 3300014969 Unclassified 2759
295 Ga0157376_10319822 3300014969 Unclassified 1475
296 Ga0157376_11329550 3300014969 Bacteria 749
297 Ga0157376_12037201 3300014969 Bacteria 612
298 Ga0163161_10222185 3300017792 Bacteria 1463
299 Ga0163161_11763991 3300017792 Bacteria 549
300 Ga0206351_10503684 3300020077 Bacteria 1872
301 Ga0209258_128797 3300025242 Bacteria 527
302 Ga0209026_1000226 3300025250 Bacteria 77076
303 Ga0207656_10018556 3300025321 Bacteria 2741
304 Ga0207656_10018811 3300025321 Bacteria 2724
305 Ga0207656_10400381 3300025321 Bacteria 690
306 Ga0207656_10593079 3300025321 Bacteria 566
307 Ga0207682_10191800 3300025893 Bacteria 937
308 Ga0207682_10205562 3300025893 Bacteria 907
309 Ga0207682_10541329 3300025893 Unclassified 551
310 Ga0207642_10254681 3300025899 Unclassified 998
311 Ga0207710_10021990 3300025900 Bacteria 2735
312 Ga0207710_10222228 3300025900 Bacteria 938
313 Ga0207688_10815651 3300025901 Unclassified 591
314 Ga0207680_10000102 3300025903 Bacteria 39308
315 Ga0207680_11196778 3300025903 Unclassified 542
316 Ga0207647_10028556 3300025904 Bacteria 3621
317 Ga0207647_10247553 3300025904 Bacteria 1023
318 Ga0207647_10430505 3300025904 Bacteria 741
319 Ga0207645_10000146 3300025907 Bacteria 55323
320 Ga0207645_10627096 3300025907 Bacteria 730
321 Ga0207705_10373636 3300025909 Bacteria 1101
322 Ga0207654_10010768 3300025911 Bacteria 4657
323 Ga0207654_10023238 3300025911 Bacteria 3318
324 Ga0207654_10968169 3300025911 Bacteria 618
325 Ga0207695_11317652 3300025913 Bacteria 602
326 Ga0207671_10007457 3300025914 Bacteria 9492
327 Ga0207671_10194657 3300025914 Unclassified 1582
328 Ga0207649_11069273 3300025920 Bacteria 636
329 Ga0207649_11118181 3300025920 Bacteria 622
330 Ga0207649_11356511 3300025920 Bacteria 563
331 Ga0207652_11064618 3300025921 Unclassified 709
332 Ga0207681_10505150 3300025923 Bacteria 990
333 Ga0207681_10658458 3300025923 Bacteria 869
334 Ga0207694_10009457 3300025924 Bacteria 7347
335 Ga0207650_10036252 3300025925 Bacteria 3587
336 Ga0207650_10087490 3300025925 Bacteria 2374
337 Ga0207650_10292844 3300025925 Bacteria 1328
338 Ga0207650_11394195 3300025925 Bacteria 596
339 Ga0207650_11538583 3300025925 Bacteria 565
340 Ga0207659_10107535 3300025926 Bacteria 2114
341 Ga0207659_10820061 3300025926 Bacteria 799
342 Ga0207687_10534911 3300025927 Bacteria 981
343 Ga0207687_10919561 3300025927 Bacteria 749
344 Ga0207644_10021819 3300025931 Bacteria 4367
345 Ga0207644_10043479 3300025931 Bacteria 3188
346 Ga0207644_10086484 3300025931 Bacteria 2328
347 Ga0207706_10226838 3300025933 Bacteria 1635
348 Ga0207686_10097460 3300025934 Bacteria 1956
349 Ga0207686_10188577 3300025934 Bacteria 1468
350 Ga0207686_10329227 3300025934 Unclassified 1144
351 Ga0207709_10218997 3300025935 Bacteria 1371
352 Ga0207669_11463752 3300025937 Bacteria 582
353 Ga0207704_10000205 3300025938 Bacteria 30268
354 Ga0207704_10131108 3300025938 Bacteria 1736
355 Ga0207704_11356321 3300025938 Bacteria 609
356 Ga0207691_10120725 3300025940 Bacteria 2323
357 Ga0207691_10128331 3300025940 Unclassified 2242
358 Ga0207691_10178850 3300025940 Bacteria 1854
359 Ga0207691_10286780 3300025940 Bacteria 1416
360 Ga0207689_10003994 3300025942 Bacteria 13420
361 Ga0207689_10205674 3300025942 Unclassified 1626
362 Ga0207679_10738451 3300025945 Bacteria 895
363 Ga0207679_11225023 3300025945 Bacteria 689
364 Ga0207667_10070023 3300025949 Bacteria 3651
365 Ga0207667_10438577 3300025949 Bacteria 1328
366 Ga0207667_11250387 3300025949 Bacteria 720
367 Ga0207651_10042253 3300025960 Bacteria 3033
368 Ga0207651_10214971 3300025960 Unclassified 1550
369 Ga0207651_10663007 3300025960 Bacteria 916
370 Ga0207651_12028967 3300025960 Bacteria 517
371 Ga0207712_10001952 3300025961 Bacteria 13536
372 Ga0207712_10101960 3300025961 Bacteria 2135
373 Ga0207712_10247582 3300025961 Bacteria 1439
374 Ga0207712_11651169 3300025961 Unclassified 574
375 Ga0207668_10147319 3300025972 Bacteria 1818
376 Ga0207668_10252846 3300025972 Bacteria 1432
377 Ga0207668_11459364 3300025972 Bacteria 617
378 Ga0207640_10264593 3300025981 Bacteria 1342
379 Ga0207658_10024854 3300025986 Bacteria 4191
380 Ga0207658_10059050 3300025986 Bacteria 2857
381 Ga0207658_10075189 3300025986 Bacteria 2569
382 Ga0207658_10473783 3300025986 Unclassified 1112
383 Ga0207658_11194764 3300025986 Bacteria 695
384 Ga0207677_10002126 3300026023 Bacteria 10402
385 Ga0207677_10043214 3300026023 Bacteria 2994
386 Ga0207677_10192782 3300026023 Bacteria 1613
387 Ga0207677_11224845 3300026023 Bacteria 688
388 Ga0207703_10004081 3300026035 Bacteria 12045
389 Ga0207703_11324738 3300026035 Bacteria 693
390 Ga0207703_12169099 3300026035 Bacteria 532
391 Ga0207639_10009956 3300026041 Bacteria 6569
392 Ga0207639_10034913 3300026041 Unclassified 3720
393 Ga0207639_10064192 3300026041 Bacteria 2846
394 Ga0207639_10152291 3300026041 Bacteria 1938
395 Ga0207639_10207681 3300026041 Bacteria 1684
396 Ga0207639_11126736 3300026041 Bacteria 736
397 Ga0207678_10747799 3300026067 Unclassified 862
398 Ga0207708_10153497 3300026075 Bacteria 1815
399 Ga0207702_10024888 3300026078 Bacteria 4967
400 Ga0207702_10029754 3300026078 Bacteria 4546
401 Ga0207641_10000015 3300026088 Bacteria 321332
402 Ga0207641_10012810 3300026088 Bacteria 6875
403 Ga0207641_10801050 3300026088 Unclassified 932
404 Ga0207641_11301333 3300026088 Bacteria 727
405 Ga0207648_10000747 3300026089 Bacteria 36518
406 Ga0207648_10047974 3300026089 Bacteria 3741
407 Ga0207648_10223369 3300026089 Bacteria 1674
408 Ga0207648_11614730 3300026089 Unclassified 609
409 Ga0207648_12066969 3300026089 Bacteria 531
410 Ga0207676_10002059 3300026095 Bacteria 14593
411 Ga0207676_10262176 3300026095 Bacteria 1561
412 Ga0207676_10842640 3300026095 Bacteria 896
413 Ga0207676_10963491 3300026095 Unclassified 839
414 Ga0207676_11342469 3300026095 Bacteria 710
415 Ga0207674_10314308 3300026116 Bacteria 1516
416 Ga0207674_10913472 3300026116 Bacteria 846
417 Ga0207675_100731756 3300026118 Bacteria 1000
418 Ga0207675_100774128 3300026118 Bacteria 972
419 Ga0207683_10006913 3300026121 Bacteria 9712
420 Ga0207683_10168572 3300026121 Bacteria 1982
421 Ga0207683_10211041 3300026121 Bacteria 1767
422 Ga0207683_10967059 3300026121 Bacteria 791
423 Ga0207698_10003892 3300026142 Bacteria 9039
424 Ga0207698_10021755 3300026142 Unclassified 4442
425 Ga0207698_10895928 3300026142 Bacteria 894
426 Ga0207698_11523284 3300026142 Bacteria 684
427 Ga0207698_11840514 3300026142 Unclassified 620
428 Ga0209968_1040181 3300027526 Bacteria 799
429 Ga0209966_1026011 3300027695 Bacteria 1164
430 Ga0207428_10019792 3300027907 Bacteria 5733
431 Ga0207428_10611661 3300027907 Bacteria 784
432 Ga0268265_10475192 3300028380 Bacteria 1173
433 Ga0268265_10504424 3300028380 Bacteria 1141
434 Ga0268265_12062726 3300028380 Bacteria 577
435 Ga0268264_10001199 3300028381 Bacteria 25035
436 Ga0268264_10002153 3300028381 Bacteria 17563
437 Ga0268264_10003263 3300028381 Bacteria 14030
438 Ga0268264_11297099 3300028381 Bacteria 738
439 Ga0307515_10000001 3300028794 Bacteria 4259510
440 Ga0307515_10000031 3300028794 Bacteria 358648
441 Ga0307515_10000667 3300028794 Bacteria 79135
442 Ga0307515_10000790 3300028794 Bacteria 72891
443 Ga0307515_10461049 3300028794 Bacteria 885
444 Ga0307513_10254115 3300031456 Bacteria 1552
445 Ga0307513_10356067 3300031456 Bacteria 1210
446 Ga0307513_10732073 3300031456 Bacteria 695
447 Ga0307509_10278917 3300031507 Bacteria 1434
448 Ga0307509_10399904 3300031507 Bacteria 1081
449 Ga0307408_100077086 3300031548 Bacteria 2482
450 Ga0307514_10051268 3300031649 Bacteria 3199
451 Ga0307514_10415306 3300031649 Bacteria 679
452 Ga0307516_10307902 3300031730 Bacteria 1258
453 Ga0307516_10453204 3300031730 Bacteria 939
454 Ga0307413_10164185 3300031824 Bacteria 1564
455 Ga0307410_11427670 3300031852 Bacteria 608
456 Ga0307412_11616238 3300031911 Unclassified 592
457 Ga0307416_102413489 3300032002 Bacteria 625
458 Ga0307414_10141912 3300032004 Unclassified 1882
459 Ga0307411_12057236 3300032005 Bacteria 534
460 Ga0307507_10000144 3300033179 Bacteria 123842
461 Ga0373945_0533537 3300035116 Bacteria 525
462 Ga0395899_0037668 3300037312 Bacteria 3625
463 Ga0395900_0027720 3300037418 Bacteria 5803
464 Ga0395898_0827926 3300037466 Bacteria 865
465 Ga0395905_0000003 3300037471 Bacteria 1347396
466 Ga0395905_0000049 3300037471 Bacteria 230719
467 Ga0395905_0001249 3300037471 Bacteria 31492
468 Ga0395901_0003386 3300038443 Bacteria 16061
469 Ga0439436_0143721 3300041404 Unclassified 671
470 Ga0439453_0178518 3300041408 Bacteria 517
471 Ga0451787_422665 3300041441 Unclassified 523
472 Ga0451789_0303625 3300041443 Bacteria 1449
473 Ga0451791_0797082 3300041451 Bacteria 546
474 Ga0451793_0259997 3300041452 Bacteria 2004
475 Ga0451793_0929927 3300041452 Bacteria 789
476 Ga0451797_0007636 3300041453 Bacteria 515
477 Ga0451800_0613430 3300041459 Unclassified 511
478 Ga0451800_0742141 3300041459 Unclassified 602
479 Ga0451802_0652972 3300041460 Bacteria 509
480 Ga0451802_1007957 3300041460 Bacteria 674
481 Ga0451802_1093250 3300041460 Bacteria 823
482 Ga0451807_0874893 3300041486 Unclassified 670
483 Ga0451849_0096302 3300041505 Bacteria 561
484 Ga0451849_0521996 3300041505 Unclassified 1395
485 Ga0451849_1063937 3300041505 Bacteria 534
486 Ga0451851_0284543 3300041507 Bacteria 906
487 Ga0451851_1334134 3300041507 Unclassified 740
488 Ga0451853_0724937 3300041512 Unclassified 525
489 Ga0451853_0791209 3300041512 Bacteria 634
490 Ga0451853_1889411 3300041512 Bacteria 656
491 Ga0451853_2398176 3300041512 Bacteria 544
492 Ga0466966_0066002 3300044684 Unclassified 2275
493 Ga0466964_0085184 3300044706 Bacteria 1364
494 Ga0453684_0748735 3300044712 Bacteria 1058
495 Ga0466967_1979102 3300045976 Bacteria 579
496 Ga0495592_0478108 3300046454 Bacteria 776
497 Ga0495592_0775841 3300046454 Bacteria 571
498 Ga0495629_0121363 3300046459 Bacteria 1821
499 Ga0495629_0879716 3300046459 Bacteria 588
500 Ga0495638_0247841 3300046460 Bacteria 983
501 Ga0495651_0180197 3300046462 Bacteria 1496
502 Ga0495651_0759170 3300046462 Bacteria 601
503 Ga0495650_0000095 3300046471 Bacteria 218020
504 Ga0495585_0000057 3300046492 Bacteria 113069
505 Ga0495585_0002733 3300046492 Bacteria 12319
506 Ga0495585_0011600 3300046492 Bacteria 5211
507 Ga0495583_0005597 3300046506 Bacteria 8469
508 Ga0495583_0381052 3300046506 Bacteria 555
509 Ga0495606_0000009 3300046507 Bacteria 306313
510 Ga0495606_0191418 3300046507 Bacteria 1172
511 Ga0495608_0076564 3300046511 Bacteria 2179
512 Ga0495610_0000867 3300046512 Bacteria 28278
513 Ga0495610_0260541 3300046512 Bacteria 683
514 Ga0495610_0306604 3300046512 Bacteria 610
515 Ga0495616_0000733 3300046513 Bacteria 24135
516 Ga0495618_0670649 3300046514 Bacteria 612
517 Ga0495628_0076588 3300046516 Bacteria 2603
518 Ga0495628_1161392 3300046516 Bacteria 525
519 Ga0495631_0120747 3300046518 Bacteria 1127
520 Ga0495631_0120947 3300046518 Bacteria 1126
521 Ga0495637_0117271 3300046520 Bacteria 1027
522 Ga0495637_0135435 3300046520 Bacteria 938
523 Ga0495648_0003800 3300046524 Bacteria 13122
524 Ga0495648_0036248 3300046524 Bacteria 3185
525 Ga0495648_0057079 3300046524 Bacteria 2344
526 Ga0495663_0196072 3300046525 Bacteria 703
527 Ga0495652_0304302 3300046529 Bacteria 1158
528 Ga0495652_0368867 3300046529 Bacteria 1024
529 Ga0495654_0078110 3300046530 Bacteria 1557
530 Ga0495654_0242893 3300046530 Bacteria 753
531 Ga0495598_0178109 3300046537 Bacteria 757
532 Ga0495609_0015217 3300046538 Bacteria 3603
533 Ga0495609_0018877 3300046538 Bacteria 3193
534 Ga0495609_0037794 3300046538 Bacteria 2177
535 Ga0495621_0063398 3300046539 Bacteria 1347
536 Ga0495622_0008647 3300046557 Bacteria 4718
537 Ga0495622_0037148 3300046557 Bacteria 2269
538 Ga0495622_0220672 3300046557 Bacteria 840
539 Ga0495633_0000275 3300046558 Bacteria 60032
540 Ga0495633_0003968 3300046558 Bacteria 9609
541 Ga0495668_0000017 3300046616 Bacteria 434025
542 Ga0495668_0198463 3300046616 Bacteria 1099
543 Ga0495625_0000007 3300046660 Bacteria 565749
544 Ga0495625_0000435 3300046660 Bacteria 62758
545 Ga0495625_0001213 3300046660 Bacteria 32692
546 Ga0495625_0040215 3300046660 Bacteria 3412
547 Ga0495661_0000576 3300046665 Bacteria 38166
548 Ga0495588_0102322 3300046674 Bacteria 1506
549 Ga0495658_0025386 3300046683 Bacteria 3167
550 Ga0495658_0044823 3300046683 Bacteria 2479
551 Ga0495670_0151582 3300046691 Bacteria 1216
552 Ga0495670_0844602 3300046691 Bacteria 500
553 Ga0495671_0027550 3300046692 Bacteria 2934
554 Ga0495649_0000007 3300046694 Bacteria 518037
555 Ga0495600_0219554 3300046809 Bacteria 1216
556 Ga0495600_0686852 3300046809 Bacteria 617
557 Ga0495660_0020251 3300046810 Bacteria 3812
558 Ga0495660_0102272 3300046810 Bacteria 1473
559 Ga0495636_0120574 3300047318 Bacteria 1160
560 Ga0495672_0037564 3300047320 Bacteria 2962
561 Ga0495676_0441869 3300047321 Bacteria 859
562 Ga0495683_0082685 3300047323 Bacteria 1564
563 Ga0495687_000440 3300047443 Bacteria 51285
564 Ga0495687_036112 3300047443 Bacteria 2214
565 Ga0495677_0447931 3300047445 Bacteria 511
566 Ga0495679_160294 3300047446 Bacteria 601
567 Ga0495673_0029094 3300047469 Bacteria 2611
568 Ga0495686_0031274 3300047472 Bacteria 3453
569 Ga0495686_0619986 3300047472 Bacteria 558
570 Ga0495602_0879454 3300048088 Bacteria 597
571 Ga0495614_0019267 3300048089 Bacteria 2953
572 Ga0495626_0117421 3300048091 Bacteria 1147
573 Ga0496110_1333775 3300048913 Bacteria 627
574 Ga0495682_0052571 3300049460 Bacteria 1480
575 Ga0501322_012301 3300049538 Bacteria 679
576 Ga0501323_019456 3300049539 Bacteria 885
577 Ga0501032_0107271 3300049569 Bacteria 1850
578 Ga0501034_0000002 3300049571 Bacteria 565510
579 Ga0501036_0564675 3300049572 Bacteria 945
580 Ga0501037_0424039 3300049573 Bacteria 910
581 Ga0501047_0430720 3300049581 Bacteria 1150
582 Ga0501202_061324 3300049652 Unclassified 851
583 Ga0501236_001209 3300049670 Bacteria 2928
584 Ga0501264_002656 3300049761 Bacteria 1647
585 nmdc:mga0k408_490_c1 3300050493 Bacteria 21695
586 nmdc:mga0k408_5994_c1 3300050493 Bacteria 6487
587 nmdc:mga0k408_656162_c1 3300050493 Bacteria 617
588 nmdc:mga07m45_548033_c1 3300050496 Bacteria 669
589 nmdc:mga0qj67_50936_c1 3300050509 Bacteria 3273
590 nmdc:mga06r32_983902_c1 3300050510 Bacteria 797
591 nmdc:mga08y16_22038_c1 3300050511 Bacteria 6727
592 nmdc:mga08y16_22108_c1 3300050511 Bacteria 6714
593 nmdc:mga08y16_284540_c1 3300050511 Bacteria 1705
594 nmdc:mga0sz30_160790_c1 3300050516 Bacteria 995
595 Ga0500646_0143247 3300053090 Bacteria 786
596 Ga0500646_0289881 3300053090 Bacteria 585
597 Ga0500646_0292639 3300053090 Bacteria 582
598 Ga0500562_086968 3300053108 Bacteria 847
599 Ga0500594_0210115 3300053118 Bacteria 641
600 Ga0500618_000033 3300053125 Bacteria 121886
601 Ga0500618_033636 3300053125 Bacteria 1195
602 Ga0500655_031304 3300053133 Bacteria 1025
603 Ga0500658_0250366 3300053134 Bacteria 814
604 Ga0500561_0168618 3300053137 Bacteria 686
605 Ga0500604_0001406 3300053151 Bacteria 6702
606 Ga0500622_0000012 3300053156 Bacteria 383183
607 Ga0500622_0000030 3300053156 Bacteria 208734
608 Ga0500622_0012337 3300053156 Bacteria 4627
609 Ga0500627_0066865 3300053158 Bacteria 1588
610 Ga0500634_0124452 3300053161 Bacteria 1249
611 Ga0500567_259717 3300053723 Bacteria 505
612 Ga0500661_003220 3300055283 Bacteria 3074
613 Ga0207645_10672470
614 CNA_F7QKVOU01BIBUY
615 MBSR1b_contig_1436207
616 JGI24740J21852_10080703
617 JGI24737J22298_10000148
618 JGI24735J21928_10000020
619 rootH1_10000337
620 rootH1_10021873
621 rootH2_10001223
622 rootH2_10003246
623 rootH2_10340990
624 rootL2_10021639
625 rootL2_10023564
626 rootL2_10033367
627 rootH1_10002599
628 rootH1_10027970
629 rootH1_10029269
630 rootH1_10052813
631 rootH1_10100022
632 Ga0065165_1007023
633 Ga0065714_10003718
634 Ga0065714_10076271
635 Ga0065714_10263545
636 Ga0065714_10400664
637 Ga0065704_10302631
638 Ga0065707_10255691
639 Ga0070658_10104568
640 Ga0070658_10367116
641 Ga0070676_10000231
642 Ga0070676_10743144
643 Ga0068869_100002049
644 Ga0068869_100157523
645 Ga0068869_100366804
646 Ga0068869_100557167
647 Ga0068869_101151799
648 Ga0070666_10000078
649 Ga0070666_10980979
650 Ga0068868_100008072
651 Ga0068868_100028945
652 Ga0068868_100106199
653 Ga0068868_100249591
654 Ga0068868_100816863
655 Ga0068868_101398951
656 Ga0070689_100521400
657 Ga0070687_100862824
658 Ga0070661_100578755
659 Ga0070661_101268405
660 Ga0070661_101559674
661 Ga0070668_100081121
662 Ga0070668_100633423
663 Ga0070668_101051238
664 Ga0070675_100175229
665 Ga0070675_100192214
666 Ga0070675_101036663
667 Ga0070671_100061553
668 Ga0070671_100134878
669 Ga0070671_100143560
670 Ga0070671_100149624
671 Ga0070674_100282843
672 Ga0070674_101264134
673 Ga0070673_100018285
674 Ga0070673_100062741
675 Ga0070673_100073158
676 Ga0070673_100493944
677 Ga0070673_102281815
678 Ga0070688_100057899
679 Ga0070688_101316324
680 Ga0070688_101739910
681 Ga0070667_100011803
682 Ga0070667_100026421
683 Ga0070667_100087311
684 Ga0070667_100743791
685 Ga0070667_100822763
686 Ga0070667_101514261
687 Ga0070700_100141012
688 Ga0070700_100148338
689 Ga0070663_100364896
690 Ga0070663_100673765
691 Ga0070678_100189429
692 Ga0070678_100393105
693 Ga0070678_100789775
694 Ga0070662_100331851
695 Ga0068867_100000586
696 Ga0068867_100180724
697 Ga0068867_100590481
698 Ga0068867_101964633
699 Ga0070685_10013986
700 Ga0070685_10800480
701 Ga0070685_10821806
702 Ga0070685_11113106
703 Ga0070679_100147590
704 Ga0068853_100007787
705 Ga0068853_100013770
706 Ga0068853_100091439
707 Ga0068853_100163124
708 Ga0070672_100102064
709 Ga0070672_100223214
710 Ga0070672_100261544
711 Ga0070672_100330760
712 Ga0070672_100801359
713 Ga0070665_101761329
714 Ga0068855_100053370
715 Ga0068855_100061731
716 Ga0068857_100059756
717 Ga0068857_101986428
718 Ga0068854_100130757
719 Ga0068854_100293820
720 Ga0068854_100421874
721 Ga0068856_100003542
722 Ga0068856_100010896
723 Ga0068856_101259362
724 Ga0068856_101888544
725 Ga0068852_100000614
726 Ga0068852_100002267
727 Ga0068852_100693104
728 Ga0068852_101397974
729 Ga0068852_102302514
730 Ga0068859_100000003
731 Ga0068859_100018877
732 Ga0068859_100081374
733 Ga0068859_100204161
734 Ga0068859_100336376
735 Ga0068859_101044336
736 Ga0068864_100003917
737 Ga0068864_100167138
738 Ga0068864_100308683
739 Ga0068864_101851077
740 Ga0068866_10001781
741 Ga0068866_10173086
742 Ga0068861_101452453
743 Ga0068861_102162576
744 Ga0068851_10028995
745 Ga0068851_10082916
746 Ga0068851_10099533
747 Ga0068851_10578827
748 Ga0068863_100006890
749 Ga0068863_100265284
750 Ga0068863_100441702
751 Ga0068863_101311389
752 Ga0068863_101565280
753 Ga0068863_102043464
754 Ga0068858_100002816
755 Ga0068858_101406486
756 Ga0068860_100002009
757 Ga0068860_100007756
758 Ga0068860_100016973
759 Ga0068860_100704279
760 Ga0068860_101019895
761 Ga0068860_102051766
762 Ga0068862_100133101
763 Ga0068862_101787858
764 Ga0075369_10341444
765 Ga0075366_10000091
766 Ga0075366_10092113
767 Ga0075366_10558183
768 Ga0097621_100000777
769 Ga0097621_100001974
770 Ga0097621_100143444
771 Ga0097621_100738492
772 Ga0097621_100894428
773 Ga0097621_101036554
774 Ga0075370_10596015
775 Ga0068871_100000154
776 Ga0068871_100074646
777 Ga0068871_100180249
778 Ga0068871_101179246
779 Ga0068871_101388425
780 Ga0068871_101849478
781 Ga0075430_100128116
782 Ga0075431_100915216
783 Ga0068865_100000172
784 Ga0068865_100182295
785 Ga0068865_100253168
786 Ga0068865_101536913
787 Ga0097620_100000003
788 Ga0097620_100018877
789 Ga0097620_100081377
790 Ga0097620_100204160
791 Ga0097620_100336379
792 Ga0097620_101044479
793 Ga0105240_11649717
794 Ga0105240_11863377
795 Ga0105240_12443212
796 Ga0111539_10018476
797 Ga0111539_10024964
798 Ga0111539_10342300
799 Ga0111539_11216489
800 Ga0111539_11365601
801 Ga0105245_10504692
802 Ga0105245_10714983
803 Ga0105247_10001017
804 Ga0105247_10402581
805 Ga0105247_10823230
806 Ga0105243_10207292
807 Ga0105243_10618732
808 Ga0105243_12410793
809 Ga0105241_10000847
810 Ga0105241_10013980
811 Ga0105241_10374406
812 Ga0105241_12369509
813 Ga0105242_10020115
814 Ga0105242_10083586
815 Ga0105242_10104661
816 Ga0105242_10784764
817 Ga0105242_12137198
818 Ga0105242_12147183
819 Ga0105248_10497438
820 Ga0105237_10001395
821 Ga0105237_10001455
822 Ga0105237_10466611
823 Ga0105237_12399183
824 Ga0105237_12767060
825 Ga0105238_10596424
826 Ga0105238_11200254
827 Ga0105238_11568767
828 Ga0105249_10005639
829 Ga0105249_10687441
830 Ga0105249_11752232
831 Ga0105249_12597274
832 Ga0105249_12642204
833 Ga0105239_10054410
834 Ga0105239_10064333
835 Ga0105239_10160641
836 Ga0105239_10176462
837 Ga0105239_10513044
838 Ga0105239_11841067
839 Ga0105246_10087476
840 Ga0105246_10291745
841 Ga0157371_10042159
842 Ga0157370_10231082
843 Ga0157370_10399185
844 Ga0157370_10914332
845 Ga0157370_11278688
846 Ga0157369_10185088
847 Ga0157374_10000849
848 Ga0157374_10131243
849 Ga0157374_10211921
850 Ga0157374_10294586
851 Ga0157374_10388546
852 Ga0157374_11134958
853 Ga0157374_11256376
854 Ga0157378_10007598
855 Ga0157378_10038908
856 Ga0157378_10080319
857 Ga0157378_10158378
858 Ga0157378_10617202
859 Ga0157378_11732384
860 Ga0157378_12878957
861 Ga0157378_13032038
862 Ga0163162_10000361
863 Ga0163162_10000568
864 Ga0163162_10061419
865 Ga0163162_10065676
866 Ga0163162_10172866
867 Ga0163162_10456307
868 Ga0163162_10593971
869 Ga0163162_10775708
870 Ga0163162_11239030
871 Ga0163162_11905804
872 Ga0157372_10001279
873 Ga0157372_10027329
874 Ga0157372_11032845
875 Ga0157375_10003003
876 Ga0157375_10239294
877 Ga0157375_10309110
878 Ga0157375_10364905
879 Ga0157375_10416474
880 Ga0157375_11184975
881 Ga0157375_11283565
882 Ga0157375_13342079
883 Ga0163163_10086565
884 Ga0163163_10098735
885 Ga0163163_10623390
886 Ga0163163_10831385
887 Ga0163163_11095282
888 Ga0163163_12098616
889 Ga0163163_12139922
890 Ga0157380_10000046
891 Ga0157380_10009471
892 Ga0157380_10021434
893 Ga0157380_10591603
894 Ga0157380_10794307
895 Ga0157380_12417229
896 Ga0157380_13310532
897 Ga0157377_10540315
898 Ga0157377_10561183
899 Ga0157377_10759002
900 Ga0157379_10123204
901 Ga0157379_10245139
902 Ga0157379_11535403
903 Ga0157379_12131652
904 Ga0157376_10082731
905 Ga0157376_10319822
906 Ga0157376_11329550
907 Ga0157376_12037201
908 Ga0163161_10222185
909 Ga0163161_11763991
910 Ga0206351_10503684
911 Ga0209258_128797
912 Ga0209026_1000226
913 Ga0207656_10018556
914 Ga0207656_10018811
915 Ga0207656_10400381
916 Ga0207656_10593079
917 Ga0207682_10191800
918 Ga0207682_10205562
919 Ga0207682_10541329
920 Ga0207642_10254681
921 Ga0207710_10021990
922 Ga0207710_10222228
923 Ga0207688_10815651
924 Ga0207680_10000102
925 Ga0207680_11196778
926 Ga0207647_10028556
927 Ga0207647_10247553
928 Ga0207647_10430505
929 Ga0207645_10000146
930 Ga0207645_10627096
931 Ga0207705_10373636
932 Ga0207654_10010768
933 Ga0207654_10023238
934 Ga0207654_10968169
935 Ga0207695_11317652
936 Ga0207671_10007457
937 Ga0207671_10194657
938 Ga0207649_11069273
939 Ga0207649_11118181
940 Ga0207649_11356511
941 Ga0207652_11064618
942 Ga0207681_10505150
943 Ga0207681_10658458
944 Ga0207694_10009457
945 Ga0207650_10036252
946 Ga0207650_10087490
947 Ga0207650_10292844
948 Ga0207650_11394195
949 Ga0207650_11538583
950 Ga0207659_10107535
951 Ga0207659_10820061
952 Ga0207687_10534911
953 Ga0207687_10919561
954 Ga0207644_10021819
955 Ga0207644_10043479
956 Ga0207644_10086484
957 Ga0207706_10226838
958 Ga0207686_10097460
959 Ga0207686_10188577
960 Ga0207686_10329227
961 Ga0207709_10218997
962 Ga0207669_11463752
963 Ga0207704_10000205
964 Ga0207704_10131108
965 Ga0207704_11356321
966 Ga0207691_10120725
967 Ga0207691_10128331
968 Ga0207691_10178850
969 Ga0207691_10286780
970 Ga0207689_10003994
971 Ga0207689_10205674
972 Ga0207679_10738451
973 Ga0207679_11225023
974 Ga0207667_10070023
975 Ga0207667_10438577
976 Ga0207667_11250387
977 Ga0207651_10042253
978 Ga0207651_10214971
979 Ga0207651_10663007
980 Ga0207651_12028967
981 Ga0207712_10001952
982 Ga0207712_10101960
983 Ga0207712_10247582
984 Ga0207712_11651169
985 Ga0207668_10147319
986 Ga0207668_10252846
987 Ga0207668_11459364
988 Ga0207640_10264593
989 Ga0207658_10024854
990 Ga0207658_10059050
991 Ga0207658_10075189
992 Ga0207658_10473783
993 Ga0207658_11194764
994 Ga0207677_10002126
995 Ga0207677_10043214
996 Ga0207677_10192782
997 Ga0207677_11224845
998 Ga0207703_10004081
999 Ga0207703_11324738
1000 Ga0207703_12169099
1001 Ga0207639_10009956
1002 Ga0207639_10034913
1003 Ga0207639_10064192
1004 Ga0207639_10152291
1005 Ga0207639_10207681
1006 Ga0207639_11126736
1007 Ga0207678_10747799
1008 Ga0207708_10153497
1009 Ga0207702_10024888
1010 Ga0207702_10029754
1011 Ga0207641_10000015
1012 Ga0207641_10012810
1013 Ga0207641_10801050
1014 Ga0207641_11301333
1015 Ga0207648_10000747
1016 Ga0207648_10047974
1017 Ga0207648_10223369
1018 Ga0207648_11614730
1019 Ga0207648_12066969
1020 Ga0207676_10002059
1021 Ga0207676_10262176
1022 Ga0207676_10842640
1023 Ga0207676_10963491
1024 Ga0207676_11342469
1025 Ga0207674_10314308
1026 Ga0207674_10913472
1027 Ga0207675_100731756
1028 Ga0207675_100774128
1029 Ga0207683_10006913
1030 Ga0207683_10168572
1031 Ga0207683_10211041
1032 Ga0207683_10967059
1033 Ga0207698_10003892
1034 Ga0207698_10021755
1035 Ga0207698_10895928
1036 Ga0207698_11523284
1037 Ga0207698_11840514
1038 Ga0209968_1040181
1039 Ga0209966_1026011
1040 Ga0207428_10019792
1041 Ga0207428_10611661
1042 Ga0268265_10475192
1043 Ga0268265_10504424
1044 Ga0268265_12062726
1045 Ga0268264_10001199
1046 Ga0268264_10002153
1047 Ga0268264_10003263
1048 Ga0268264_11297099
1049 Ga0307515_10000001
1050 Ga0307515_10000031
1051 Ga0307515_10000667
1052 Ga0307515_10000790
1053 Ga0307515_10461049
1054 Ga0307513_10254115
1055 Ga0307513_10356067
1056 Ga0307513_10732073
1057 Ga0307509_10278917
1058 Ga0307509_10399904
1059 Ga0307408_100077086
1060 Ga0307514_10051268
1061 Ga0307514_10415306
1062 Ga0307516_10307902
1063 Ga0307516_10453204
1064 Ga0307413_10164185
1065 Ga0307410_11427670
1066 Ga0307412_11616238
1067 Ga0307416_102413489
1068 Ga0307414_10141912
1069 Ga0307411_12057236
1070 Ga0307507_10000144
1071 Ga0373945_0533537
1072 Ga0395899_0037668
1073 Ga0395900_0027720
1074 Ga0395898_0827926
1075 Ga0395905_0000003
1076 Ga0395905_0000049
1077 Ga0395905_0001249
1078 Ga0395901_0003386
1079 Ga0439436_0143721
1080 Ga0439453_0178518
1081 Ga0451787_422665
1082 Ga0451789_0303625
1083 Ga0451791_0797082
1084 Ga0451793_0259997
1085 Ga0451793_0929927
1086 Ga0451797_0007636
1087 Ga0451800_0613430
1088 Ga0451800_0742141
1089 Ga0451802_0652972
1090 Ga0451802_1007957
1091 Ga0451802_1093250
1092 Ga0451807_0874893
1093 Ga0451849_0096302
1094 Ga0451849_0521996
1095 Ga0451849_1063937
1096 Ga0451851_0284543
1097 Ga0451851_1334134
1098 Ga0451853_0724937
1099 Ga0451853_0791209
1100 Ga0451853_1889411
1101 Ga0451853_2398176
1102 Ga0466966_0066002
1103 Ga0466964_0085184
1104 Ga0453684_0748735
1105 Ga0466967_1979102
1106 Ga0495592_0478108
1107 Ga0495592_0775841
1108 Ga0495629_0121363
1109 Ga0495629_0879716
1110 Ga0495638_0247841
1111 Ga0495651_0180197
1112 Ga0495651_0759170
1113 Ga0495650_0000095
1114 Ga0495585_0000057
1115 Ga0495585_0002733
1116 Ga0495585_0011600
1117 Ga0495583_0005597
1118 Ga0495583_0381052
1119 Ga0495606_0000009
1120 Ga0495606_0191418
1121 Ga0495608_0076564
1122 Ga0495610_0000867
1123 Ga0495610_0260541
1124 Ga0495610_0306604
1125 Ga0495616_0000733
1126 Ga0495618_0670649
1127 Ga0495628_0076588
1128 Ga0495628_1161392
1129 Ga0495631_0120747
1130 Ga0495631_0120947
1131 Ga0495637_0117271
1132 Ga0495637_0135435
1133 Ga0495648_0003800
1134 Ga0495648_0036248
1135 Ga0495648_0057079
1136 Ga0495663_0196072
1137 Ga0495652_0304302
1138 Ga0495652_0368867
1139 Ga0495654_0078110
1140 Ga0495654_0242893
1141 Ga0495598_0178109
1142 Ga0495609_0015217
1143 Ga0495609_0018877
1144 Ga0495609_0037794
1145 Ga0495621_0063398
1146 Ga0495622_0008647
1147 Ga0495622_0037148
1148 Ga0495622_0220672
1149 Ga0495633_0000275
1150 Ga0495633_0003968
1151 Ga0495668_0000017
1152 Ga0495668_0198463
1153 Ga0495625_0000007
1154 Ga0495625_0000435
1155 Ga0495625_0001213
1156 Ga0495625_0040215
1157 Ga0495661_0000576
1158 Ga0495588_0102322
1159 Ga0495658_0025386
1160 Ga0495658_0044823
1161 Ga0495670_0151582
1162 Ga0495670_0844602
1163 Ga0495671_0027550
1164 Ga0495649_0000007
1165 Ga0495600_0219554
1166 Ga0495600_0686852
1167 Ga0495660_0020251
1168 Ga0495660_0102272
1169 Ga0495636_0120574
1170 Ga0495672_0037564
1171 Ga0495676_0441869
1172 Ga0495683_0082685
1173 Ga0495687_000440
1174 Ga0495687_036112
1175 Ga0495677_0447931
1176 Ga0495679_160294
1177 Ga0495673_0029094
1178 Ga0495686_0031274
1179 Ga0495686_0619986
1180 Ga0495602_0879454
1181 Ga0495614_0019267
1182 Ga0495626_0117421
1183 Ga0496110_1333775
1184 Ga0495682_0052571
1185 Ga0501322_012301
1186 Ga0501323_019456
1187 Ga0501032_0107271
1188 Ga0501034_0000002
1189 Ga0501036_0564675
1190 Ga0501037_0424039
1191 Ga0501047_0430720
1192 Ga0501202_061324
1193 Ga0501236_001209
1194 Ga0501264_002656
1195 nmdc:mga0k408_490_c1
1196 nmdc:mga0k408_5994_c1
1197 nmdc:mga0k408_656162_c1
1198 nmdc:mga07m45_548033_c1
1199 nmdc:mga0qj67_50936_c1
1200 nmdc:mga06r32_983902_c1
1201 nmdc:mga08y16_22038_c1
1202 nmdc:mga08y16_22108_c1
1203 nmdc:mga08y16_284540_c1
1204 nmdc:mga0sz30_160790_c1
1205 Ga0500646_0143247
1206 Ga0500646_0289881
1207 Ga0500646_0292639
1208 Ga0500562_086968
1209 Ga0500594_0210115
1210 Ga0500618_000033
1211 Ga0500618_033636
1212 Ga0500655_031304
1213 Ga0500658_0250366
1214 Ga0500561_0168618
1215 Ga0500604_0001406
1216 Ga0500622_0000012
1217 Ga0500622_0000030
1218 Ga0500622_0012337
1219 Ga0500627_0066865
1220 Ga0500634_0124452
1221 Ga0500567_259717
1222 Ga0500661_003220

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00550

PP-binding

Phosphopantetheine attachment site

28

95

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f80-assembly1.cif.gz_F holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein) 0.8765 5 75
8odw-assembly1.cif.gz_A crystal structure of lbma ox-acp didomain in complex with nadp and ethyl glycinate from the lobatamide pks (gynuella sunshinyii) 0.8749 3 85
1f80-assembly1.cif.gz_D holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein) 0.8677 4 75
2fac-assembly1.cif.gz_A crystal structure of e. coli hexanoyl-acp 0.8631 6 77
8jfh-assembly1.cif.gz_E crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-octanoyl-acp from helicobacter pylori in an inactive form that priors the acyl substrate delivery 0.8618 4 77
ID Description Score Start End Superfamily
af_Q9VIC9_329_406_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9051 3 81 1.10.1200.10
af_P9WQF1_4_84_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8855 2 81 1.10.1200.10
1f80F00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8765 5 75 1.10.1200.10
af_G5ECV9_328_405_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8764 3 76 1.10.1200.10
1f80D00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8677 4 75 1.10.1200.10
ID Description Score Start End GO Terms
AF-A0A4R8DVQ6-F1-model_v4 Acyl carrier protein (ACP) 0.9917 3 79 GO:0000035
GO:0000036
GO:0005829
GO:0009245
GO:0016020
AF-A0A3D3CVK0-F1-model_v4 Acyl carrier protein 0.9864 1 80
AF-A0A512RL56-F1-model_v4 Acyl carrier protein (ACP) 0.9769 1 85 GO:0000036
GO:0005737
AF-A0A1T5P029-F1-model_v4 Acyl carrier protein 0.9767 1 85 GO:0000035
GO:0000036
AF-A0A3D2HNG3-F1-model_v4 deleted 0.9764 1 82

Map