F469738

General Info

Members Datasets Scaffolds Average Seq Length
618 193 1236 362

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10106894|Ga0207709_101068942
Length 358
Sequence MVALFDPLMLGALDLPNRIVMAPLTRARAGREGVPNELMAAYYGQRASSGLIISEATGISREGLGWPNAPGLWSEAQVEGWKLVTKAVHDRGGRIVAQLWHMGRLVHPLVSGMEPVSSSATTAPDYAHTYEGKRPYLEARAATQDDLRRIVGDYARAASNAVAAGFDGVQVHGANGYLVDQFLRDGANFRTDDYGGPIDQRLRFMSAVLEAVGMARVGIRFSPNIYSQGVEDAYPIALFEAVARRLEEHKVPWIELREPRHPTSAGAIPTEPVSPAMRPLYSGRIVINSDYDWGDAWERVGAGHADAVSIGRLFIANPDLVKRIALGFPLNEGDSSTYYSGGASGYVDYPTLDEARAA

Samples

Sample ID Description Type Environment
1 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
157 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
158 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
170 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 4.37
Rhizosphere 95.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207709_10106894 3300025935 Bacteria 1862
2 JGI24740J21852_10000554 3300001979 Bacteria 16027
3 JGI24739J22299_10000405 3300001989 Bacteria 14994
4 JGI24737J22298_10000061 3300001990 Bacteria 32526
5 JGI24737J22298_10002804 3300001990 Bacteria 6171
6 JGI24737J22298_10011266 3300001990 Bacteria 2934
7 JGI24738J21930_10000146 3300002075 Bacteria 17468
8 JGI24751J29686_10005552 3300002459 Bacteria 2568
9 Ga0065712_10138290 3300005290 Bacteria 1475
10 Ga0065715_10000291 3300005293 Bacteria 19586
11 Ga0065715_10133866 3300005293 Bacteria 1965
12 Ga0070658_10001056 3300005327 Bacteria 23556
13 Ga0070658_10001507 3300005327 Bacteria 19770
14 Ga0070658_10011106 3300005327 Bacteria 7221
15 Ga0070658_10047896 3300005327 Bacteria 3460
16 Ga0070658_10063072 3300005327 Bacteria 3021
17 Ga0070676_10008049 3300005328 Bacteria 5668
18 Ga0070676_10092736 3300005328 Bacteria 1853
19 Ga0070683_100001823 3300005329 Bacteria 16621
20 Ga0070690_100003412 3300005330 Bacteria 8690
21 Ga0070690_100081178 3300005330 Bacteria 2121
22 Ga0070670_100003544 3300005331 Bacteria 12981
23 Ga0070670_100007835 3300005331 Bacteria 9089
24 Ga0070670_100022832 3300005331 Bacteria 5384
25 Ga0070670_100028300 3300005331 Bacteria 4824
26 Ga0070670_100082354 3300005331 Bacteria 2765
27 Ga0070670_100134665 3300005331 Bacteria 2135
28 Ga0070677_10005808 3300005333 Bacteria 4083
29 Ga0070677_10007168 3300005333 Bacteria 3717
30 Ga0070677_10011411 3300005333 Bacteria 3064
31 Ga0070677_10016162 3300005333 Bacteria 2654
32 Ga0068869_100000493 3300005334 Bacteria 21956
33 Ga0068869_100033200 3300005334 Bacteria 3642
34 Ga0070666_10000310 3300005335 Bacteria 31154
35 Ga0070666_10044871 3300005335 Bacteria 2963
36 Ga0070666_10108188 3300005335 Bacteria 1921
37 Ga0070680_100001306 3300005336 Bacteria 18035
38 Ga0068868_100009873 3300005338 Bacteria 6893
39 Ga0068868_100063238 3300005338 Bacteria 2936
40 Ga0070660_100000393 3300005339 Bacteria 29017
41 Ga0070660_100002280 3300005339 Bacteria 13171
42 Ga0070660_100052230 3300005339 Bacteria 3151
43 Ga0070660_100100714 3300005339 Bacteria 2289
44 Ga0070660_100210468 3300005339 Bacteria 1578
45 Ga0070660_100257655 3300005339 Bacteria 1424
46 Ga0070661_100001818 3300005344 Bacteria 14787
47 Ga0070661_100031076 3300005344 Bacteria 3861
48 Ga0070661_100032079 3300005344 Bacteria 3801
49 Ga0070692_10056009 3300005345 Bacteria 2063
50 Ga0070692_10106386 3300005345 Bacteria 1545
51 Ga0070668_100001945 3300005347 Bacteria 15069
52 Ga0070668_100009752 3300005347 Bacteria 7119
53 Ga0070668_100018998 3300005347 Bacteria 5165
54 Ga0070668_100053578 3300005347 Bacteria 3111
55 Ga0070668_100124276 3300005347 Bacteria 2066
56 Ga0070669_100000532 3300005353 Bacteria 28333
57 Ga0070669_100021191 3300005353 Bacteria 4645
58 Ga0070669_100027300 3300005353 Bacteria 4108
59 Ga0070669_100054797 3300005353 Bacteria 2921
60 Ga0070669_100143954 3300005353 Bacteria 1840
61 Ga0070669_100195716 3300005353 Bacteria 1588
62 Ga0070675_100004774 3300005354 Bacteria 10338
63 Ga0070675_100018719 3300005354 Bacteria 5512
64 Ga0070671_100000254 3300005355 Bacteria 35845
65 Ga0070671_100000539 3300005355 Bacteria 26673
66 Ga0070671_100001204 3300005355 Bacteria 19366
67 Ga0070671_100008371 3300005355 Bacteria 8287
68 Ga0070671_100018815 3300005355 Bacteria 5614
69 Ga0070671_100033828 3300005355 Bacteria 4230
70 Ga0070671_100064368 3300005355 Bacteria 3054
71 Ga0070671_100076411 3300005355 Bacteria 2798
72 Ga0070671_100085050 3300005355 Bacteria 2645
73 Ga0070671_100104872 3300005355 Bacteria 2373
74 Ga0070671_100240431 3300005355 Bacteria 1537
75 Ga0070674_100004769 3300005356 Bacteria 7767
76 Ga0070674_100007740 3300005356 Bacteria 6346
77 Ga0070674_100166305 3300005356 Bacteria 1678
78 Ga0070673_100000058 3300005364 Bacteria 45772
79 Ga0070673_100011087 3300005364 Bacteria 6143
80 Ga0070673_100049943 3300005364 Bacteria 3268
81 Ga0070673_100123357 3300005364 Bacteria 2164
82 Ga0070673_100300939 3300005364 Bacteria 1412
83 Ga0070673_100413366 3300005364 Bacteria 1208
84 Ga0070659_100000564 3300005366 Bacteria 27103
85 Ga0070659_100002195 3300005366 Bacteria 13892
86 Ga0070659_100004781 3300005366 Bacteria 9681
87 Ga0070659_100010127 3300005366 Bacteria 6940
88 Ga0070659_100039287 3300005366 Bacteria 3694
89 Ga0070659_100046658 3300005366 Bacteria 3396
90 Ga0070659_100309051 3300005366 Bacteria 1320
91 Ga0070667_100003138 3300005367 Bacteria 14187
92 Ga0070667_100019854 3300005367 Bacteria 5576
93 Ga0070667_100021388 3300005367 Bacteria 5372
94 Ga0070667_100099897 3300005367 Bacteria 2505
95 Ga0070667_100105703 3300005367 Bacteria 2436
96 Ga0070667_100407463 3300005367 Bacteria 1238
97 Ga0070714_100043420 3300005435 Bacteria 3802
98 Ga0070694_100006264 3300005444 Bacteria 7223
99 Ga0070663_100000271 3300005455 Bacteria 26098
100 Ga0070663_100028965 3300005455 Bacteria 3777
101 Ga0070663_100059055 3300005455 Bacteria 2756
102 Ga0070663_100099972 3300005455 Bacteria 2163
103 Ga0070678_100034362 3300005456 Bacteria 3530
104 Ga0070678_100192611 3300005456 Bacteria 1677
105 Ga0070662_100000280 3300005457 Bacteria 30084
106 Ga0070662_100001326 3300005457 Bacteria 15206
107 Ga0070662_100002356 3300005457 Bacteria 11616
108 Ga0070662_100014088 3300005457 Bacteria 5333
109 Ga0070662_100022052 3300005457 Bacteria 4355
110 Ga0070662_100057035 3300005457 Bacteria 2837
111 Ga0070662_100112618 3300005457 Bacteria 2075
112 Ga0070662_100122369 3300005457 Bacteria 1996
113 Ga0070662_100144287 3300005457 Bacteria 1848
114 Ga0070681_10185287 3300005458 Bacteria 2002
115 Ga0068867_100000581 3300005459 Bacteria 24213
116 Ga0068867_100015265 3300005459 Bacteria 5445
117 Ga0068867_100034864 3300005459 Bacteria 3648
118 Ga0068867_100036996 3300005459 Bacteria 3547
119 Ga0070679_100000346 3300005530 Bacteria 39334
120 Ga0070684_100223481 3300005535 Bacteria 1718
121 Ga0068853_100000783 3300005539 Bacteria 22097
122 Ga0068853_100180146 3300005539 Bacteria 1916
123 Ga0070672_100003912 3300005543 Bacteria 9703
124 Ga0070672_100019251 3300005543 Bacteria 4952
125 Ga0070672_100030589 3300005543 Bacteria 4047
126 Ga0070672_100036550 3300005543 Bacteria 3742
127 Ga0070672_100092487 3300005543 Bacteria 2442
128 Ga0070672_100192909 3300005543 Bacteria 1701
129 Ga0070686_100057220 3300005544 Bacteria 2504
130 Ga0070665_100001540 3300005548 Bacteria 26631
131 Ga0070665_100004875 3300005548 Bacteria 13935
132 Ga0070665_100031329 3300005548 Bacteria 5352
133 Ga0070665_100047018 3300005548 Bacteria 4332
134 Ga0070665_100059010 3300005548 Bacteria 3846
135 Ga0070665_100386481 3300005548 Bacteria 1407
136 Ga0068855_100001416 3300005563 Bacteria 29777
137 Ga0068855_100001751 3300005563 Bacteria 27092
138 Ga0068855_100009125 3300005563 Bacteria 11978
139 Ga0068855_100145767 3300005563 Bacteria 2696
140 Ga0070664_100003969 3300005564 Bacteria 11899
141 Ga0070664_100011906 3300005564 Bacteria 7060
142 Ga0070664_100038862 3300005564 Bacteria 4007
143 Ga0070664_100122406 3300005564 Bacteria 2279
144 Ga0070664_100210794 3300005564 Bacteria 1736
145 Ga0068857_100000531 3300005577 Bacteria 27554
146 Ga0068857_100008327 3300005577 Bacteria 8959
147 Ga0068857_100021196 3300005577 Bacteria 5718
148 Ga0068857_100025898 3300005577 Bacteria 5166
149 Ga0068854_100003661 3300005578 Bacteria 9614
150 Ga0068854_100014014 3300005578 Bacteria 5275
151 Ga0068854_100044109 3300005578 Bacteria 3164
152 Ga0068856_100018394 3300005614 Bacteria 6772
153 Ga0068852_100003205 3300005616 Bacteria 11426
154 Ga0068852_100099279 3300005616 Bacteria 2624
155 Ga0068852_100182603 3300005616 Bacteria 1974
156 Ga0068859_100000136 3300005617 Bacteria 68907
157 Ga0068859_100001019 3300005617 Bacteria 28705
158 Ga0068859_100003244 3300005617 Bacteria 16555
159 Ga0068859_100047591 3300005617 Bacteria 4309
160 Ga0068859_100248933 3300005617 Bacteria 1867
161 Ga0068864_100000235 3300005618 Bacteria 49611
162 Ga0068864_100000540 3300005618 Bacteria 32248
163 Ga0068864_100000711 3300005618 Bacteria 27933
164 Ga0068864_100073022 3300005618 Bacteria 2991
165 Ga0068866_10084861 3300005718 Bacteria 1710
166 Ga0068861_100049365 3300005719 Bacteria 3186
167 Ga0068851_10057641 3300005834 Bacteria 1984
168 Ga0068863_100000140 3300005841 Bacteria 76175
169 Ga0068863_100001845 3300005841 Bacteria 21053
170 Ga0068863_100011565 3300005841 Bacteria 8537
171 Ga0068863_100014473 3300005841 Bacteria 7596
172 Ga0068863_100028097 3300005841 Bacteria 5369
173 Ga0068863_100120273 3300005841 Bacteria 2504
174 Ga0068858_100000514 3300005842 Bacteria 40588
175 Ga0068858_100002498 3300005842 Bacteria 18554
176 Ga0068858_100004922 3300005842 Bacteria 13083
177 Ga0068858_100010778 3300005842 Bacteria 8643
178 Ga0068858_100014241 3300005842 Bacteria 7499
179 Ga0068858_100032216 3300005842 Bacteria 4869
180 Ga0068858_100053887 3300005842 Bacteria 3719
181 Ga0068860_100026574 3300005843 Bacteria 5579
182 Ga0068860_100038700 3300005843 Bacteria 4563
183 Ga0068862_100032002 3300005844 Bacteria 4443
184 Ga0068862_100036248 3300005844 Bacteria 4181
185 Ga0068862_100106957 3300005844 Bacteria 2453
186 Ga0068862_100124023 3300005844 Bacteria 2279
187 Ga0068862_100137987 3300005844 Bacteria 2163
188 Ga0070717_10091811 3300006028 Bacteria 2564
189 Ga0097621_100098802 3300006237 Bacteria 2453
190 Ga0068871_100025268 3300006358 Bacteria 4618
191 Ga0075431_100143299 3300006847 Bacteria 2463
192 Ga0068865_100000697 3300006881 Bacteria 18907
193 Ga0068865_100011665 3300006881 Bacteria 5506
194 Ga0068865_100047539 3300006881 Bacteria 2949
195 Ga0068865_100135199 3300006881 Bacteria 1851
196 Ga0097620_100000136 3300006931 Bacteria 68907
197 Ga0097620_100001019 3300006931 Bacteria 28705
198 Ga0097620_100003244 3300006931 Bacteria 16555
199 Ga0097620_100047593 3300006931 Bacteria 4309
200 Ga0097620_100248931 3300006931 Bacteria 1867
201 Ga0111539_10067835 3300009094 Bacteria 4212
202 Ga0105245_10000170 3300009098 Bacteria 61721
203 Ga0105243_10127687 3300009148 Bacteria 2153
204 Ga0105241_10056381 3300009174 Bacteria 3012
205 Ga0105242_10268553 3300009176 Bacteria 1544
206 Ga0105248_10000184 3300009177 Bacteria 72728
207 Ga0105248_10001263 3300009177 Bacteria 28281
208 Ga0105248_10001269 3300009177 Bacteria 28212
209 Ga0105248_10003825 3300009177 Bacteria 16686
210 Ga0105248_10006079 3300009177 Bacteria 13251
211 Ga0105248_10011624 3300009177 Bacteria 9698
212 Ga0105248_10028196 3300009177 Bacteria 6253
213 Ga0105248_10245851 3300009177 Bacteria 2014
214 Ga0105238_10221656 3300009551 Bacteria 1867
215 Ga0105249_10175678 3300009553 Bacteria 2080
216 Ga0105249_10231839 3300009553 Bacteria 1821
217 Ga0105249_10481622 3300009553 Bacteria 1284
218 Ga0105239_10029054 3300010375 Bacteria 6078
219 Ga0105239_10093563 3300010375 Bacteria 3319
220 Ga0157373_10064478 3300013100 Bacteria 2593
221 Ga0157371_10000443 3300013102 Bacteria 50736
222 Ga0157371_10001298 3300013102 Bacteria 26285
223 Ga0157371_10086142 3300013102 Bacteria 2225
224 Ga0157370_10009490 3300013104 Bacteria 10384
225 Ga0157369_10148055 3300013105 Bacteria 2482
226 Ga0157378_10000312 3300013297 Bacteria 47527
227 Ga0163162_10006506 3300013306 Bacteria 11316
228 Ga0163162_10060796 3300013306 Bacteria 3814
229 Ga0163162_10281198 3300013306 Bacteria 1796
230 Ga0157372_10081710 3300013307 Bacteria 3658
231 Ga0157372_10487859 3300013307 Bacteria 1437
232 Ga0157375_10011093 3300013308 Bacteria 7946
233 Ga0157375_10025124 3300013308 Bacteria 5527
234 Ga0157375_10044879 3300013308 Bacteria 4299
235 Ga0157375_10099813 3300013308 Bacteria 2982
236 Ga0163163_10000131 3300014325 Bacteria 76809
237 Ga0163163_10388618 3300014325 Bacteria 1453
238 Ga0157380_10003736 3300014326 Bacteria 10475
239 Ga0157377_10019088 3300014745 Bacteria 3577
240 Ga0157379_10001982 3300014968 Bacteria 16935
241 Ga0157379_10320097 3300014968 Bacteria 1416
242 Ga0163161_10031389 3300017792 Bacteria 3785
243 Ga0206353_11034454 3300020082 Bacteria 4286
244 Ga0207697_10000063 3300025315 Bacteria 45019
245 Ga0207697_10000134 3300025315 Bacteria 35648
246 Ga0207697_10012389 3300025315 Bacteria 3575
247 Ga0207656_10001771 3300025321 Bacteria 7186
248 Ga0207682_10001817 3300025893 Bacteria 9749
249 Ga0207642_10003851 3300025899 Bacteria 4783
250 Ga0207688_10000106 3300025901 Bacteria 33178
251 Ga0207688_10074054 3300025901 Bacteria 1936
252 Ga0207680_10013612 3300025903 Bacteria 4185
253 Ga0207680_10058986 3300025903 Bacteria 2329
254 Ga0207680_10123938 3300025903 Bacteria 1694
255 Ga0207647_10000246 3300025904 Bacteria 44259
256 Ga0207647_10001685 3300025904 Bacteria 17028
257 Ga0207647_10047406 3300025904 Bacteria 2673
258 Ga0207647_10070855 3300025904 Bacteria 2104
259 Ga0207645_10001636 3300025907 Bacteria 18270
260 Ga0207645_10002473 3300025907 Bacteria 14517
261 Ga0207645_10017581 3300025907 Bacteria 4715
262 Ga0207643_10103522 3300025908 Bacteria 1671
263 Ga0207643_10178755 3300025908 Bacteria 1283
264 Ga0207705_10000270 3300025909 Bacteria 49639
265 Ga0207705_10000654 3300025909 Bacteria 28865
266 Ga0207705_10021694 3300025909 Bacteria 4581
267 Ga0207705_10036638 3300025909 Bacteria 3510
268 Ga0207705_10037664 3300025909 Bacteria 3460
269 Ga0207660_10002965 3300025917 Bacteria 11098
270 Ga0207660_10113000 3300025917 Bacteria 2047
271 Ga0207657_10000165 3300025919 Bacteria 67173
272 Ga0207657_10001091 3300025919 Bacteria 28769
273 Ga0207657_10002106 3300025919 Bacteria 21522
274 Ga0207657_10004437 3300025919 Bacteria 14844
275 Ga0207657_10117611 3300025919 Bacteria 2189
276 Ga0207657_10142195 3300025919 Bacteria 1960
277 Ga0207649_10025955 3300025920 Bacteria 3422
278 Ga0207649_10078632 3300025920 Bacteria 2129
279 Ga0207652_10000058 3300025921 Bacteria 113620
280 Ga0207652_10234716 3300025921 Bacteria 1653
281 Ga0207681_10000712 3300025923 Bacteria 21864
282 Ga0207681_10005179 3300025923 Bacteria 8006
283 Ga0207681_10018945 3300025923 Bacteria 4341
284 Ga0207681_10038999 3300025923 Bacteria 3151
285 Ga0207681_10072741 3300025923 Bacteria 2402
286 Ga0207681_10092359 3300025923 Bacteria 2164
287 Ga0207694_10222498 3300025924 Bacteria 1540
288 Ga0207694_10269206 3300025924 Bacteria 1397
289 Ga0207650_10017570 3300025925 Bacteria 5009
290 Ga0207650_10029240 3300025925 Bacteria 3960
291 Ga0207650_10034836 3300025925 Bacteria 3652
292 Ga0207650_10052250 3300025925 Bacteria 3027
293 Ga0207650_10257576 3300025925 Bacteria 1414
294 Ga0207659_10058140 3300025926 Bacteria 2775
295 Ga0207659_10090847 3300025926 Bacteria 2280
296 Ga0207664_10051524 3300025929 Bacteria 3251
297 Ga0207644_10001112 3300025931 Bacteria 17264
298 Ga0207644_10011791 3300025931 Bacteria 5788
299 Ga0207644_10012065 3300025931 Bacteria 5731
300 Ga0207644_10013797 3300025931 Bacteria 5398
301 Ga0207644_10014968 3300025931 Bacteria 5201
302 Ga0207644_10023425 3300025931 Bacteria 4229
303 Ga0207644_10039626 3300025931 Bacteria 3326
304 Ga0207644_10084201 3300025931 Bacteria 2357
305 Ga0207690_10002306 3300025932 Bacteria 11636
306 Ga0207690_10002510 3300025932 Bacteria 11089
307 Ga0207690_10010985 3300025932 Bacteria 5400
308 Ga0207706_10000224 3300025933 Bacteria 62043
309 Ga0207706_10003287 3300025933 Bacteria 15471
310 Ga0207706_10004293 3300025933 Bacteria 13391
311 Ga0207706_10008924 3300025933 Bacteria 9227
312 Ga0207706_10013030 3300025933 Bacteria 7567
313 Ga0207706_10022603 3300025933 Bacteria 5644
314 Ga0207706_10022695 3300025933 Bacteria 5633
315 Ga0207706_10045173 3300025933 Bacteria 3903
316 Ga0207706_10052300 3300025933 Bacteria 3606
317 Ga0207706_10197722 3300025933 Bacteria 1763
318 Ga0207669_10012986 3300025937 Bacteria 4118
319 Ga0207704_10013542 3300025938 Bacteria 4085
320 Ga0207704_10054173 3300025938 Bacteria 2444
321 Ga0207704_10113647 3300025938 Bacteria 1836
322 Ga0207691_10000750 3300025940 Bacteria 32085
323 Ga0207691_10016053 3300025940 Bacteria 7113
324 Ga0207691_10016539 3300025940 Bacteria 7004
325 Ga0207691_10022329 3300025940 Bacteria 5968
326 Ga0207691_10041076 3300025940 Bacteria 4273
327 Ga0207691_10043740 3300025940 Bacteria 4126
328 Ga0207691_10068953 3300025940 Bacteria 3195
329 Ga0207691_10072558 3300025940 Bacteria 3105
330 Ga0207691_10079118 3300025940 Bacteria 2959
331 Ga0207691_10117052 3300025940 Bacteria 2365
332 Ga0207691_10132368 3300025940 Bacteria 2202
333 Ga0207711_10000105 3300025941 Bacteria 90036
334 Ga0207711_10000190 3300025941 Bacteria 65723
335 Ga0207711_10000908 3300025941 Bacteria 28478
336 Ga0207711_10001131 3300025941 Bacteria 25459
337 Ga0207711_10002435 3300025941 Bacteria 16611
338 Ga0207711_10029578 3300025941 Bacteria 4623
339 Ga0207711_10032566 3300025941 Bacteria 4408
340 Ga0207711_10158829 3300025941 Bacteria 2045
341 Ga0207689_10000051 3300025942 Bacteria 88480
342 Ga0207689_10026198 3300025942 Bacteria 4883
343 Ga0207689_10037169 3300025942 Bacteria 4040
344 Ga0207689_10084910 3300025942 Bacteria 2602
345 Ga0207689_10122965 3300025942 Bacteria 2134
346 Ga0207661_10002950 3300025944 Bacteria 11762
347 Ga0207679_10022639 3300025945 Bacteria 4282
348 Ga0207679_10045361 3300025945 Bacteria 3178
349 Ga0207679_10098481 3300025945 Bacteria 2280
350 Ga0207679_10104923 3300025945 Bacteria 2218
351 Ga0207679_10150221 3300025945 Bacteria 1895
352 Ga0207667_10000579 3300025949 Bacteria 47716
353 Ga0207667_10006485 3300025949 Bacteria 14155
354 Ga0207667_10012465 3300025949 Bacteria 9792
355 Ga0207651_10000226 3300025960 Bacteria 24290
356 Ga0207651_10031763 3300025960 Bacteria 3381
357 Ga0207651_10038101 3300025960 Bacteria 3156
358 Ga0207712_10013421 3300025961 Bacteria 5252
359 Ga0207712_10310069 3300025961 Bacteria 1298
360 Ga0207668_10000086 3300025972 Bacteria 69871
361 Ga0207668_10004997 3300025972 Bacteria 7806
362 Ga0207668_10025381 3300025972 Bacteria 3835
363 Ga0207668_10041535 3300025972 Bacteria 3110
364 Ga0207668_10154422 3300025972 Bacteria 1781
365 Ga0207640_10000428 3300025981 Bacteria 25901
366 Ga0207658_10002031 3300025986 Bacteria 15107
367 Ga0207658_10002254 3300025986 Bacteria 14276
368 Ga0207658_10008914 3300025986 Bacteria 6803
369 Ga0207658_10030169 3300025986 Bacteria 3837
370 Ga0207658_10049703 3300025986 Bacteria 3082
371 Ga0207658_10051031 3300025986 Bacteria 3047
372 Ga0207677_10000578 3300026023 Bacteria 22844
373 Ga0207677_10039632 3300026023 Bacteria 3100
374 Ga0207703_10006127 3300026035 Bacteria 9627
375 Ga0207703_10006394 3300026035 Bacteria 9419
376 Ga0207703_10007523 3300026035 Bacteria 8644
377 Ga0207703_10013542 3300026035 Bacteria 6353
378 Ga0207703_10047395 3300026035 Bacteria 3465
379 Ga0207639_10004387 3300026041 Bacteria 9521
380 Ga0207639_10168845 3300026041 Bacteria 1851
381 Ga0207639_10187687 3300026041 Bacteria 1763
382 Ga0207678_10000217 3300026067 Bacteria 51179
383 Ga0207678_10028227 3300026067 Bacteria 4900
384 Ga0207678_10049040 3300026067 Bacteria 3648
385 Ga0207678_10058756 3300026067 Bacteria 3309
386 Ga0207678_10068668 3300026067 Bacteria 3040
387 Ga0207678_10115760 3300026067 Bacteria 2287
388 Ga0207678_10120685 3300026067 Bacteria 2237
389 Ga0207702_10013141 3300026078 Bacteria 6883
390 Ga0207702_10017620 3300026078 Bacteria 5911
391 Ga0207641_10000172 3300026088 Bacteria 90549
392 Ga0207641_10013909 3300026088 Bacteria 6600
393 Ga0207641_10015982 3300026088 Bacteria 6144
394 Ga0207641_10019848 3300026088 Bacteria 5516
395 Ga0207641_10109167 3300026088 Bacteria 2450
396 Ga0207641_10121959 3300026088 Bacteria 2327
397 Ga0207648_10001346 3300026089 Bacteria 27263
398 Ga0207648_10001535 3300026089 Bacteria 25421
399 Ga0207648_10005651 3300026089 Bacteria 12555
400 Ga0207648_10006756 3300026089 Bacteria 11374
401 Ga0207648_10038813 3300026089 Bacteria 4190
402 Ga0207676_10000300 3300026095 Bacteria 42535
403 Ga0207676_10001388 3300026095 Bacteria 18023
404 Ga0207676_10002706 3300026095 Bacteria 12613
405 Ga0207676_10034395 3300026095 Bacteria 3836
406 Ga0207676_10098089 3300026095 Bacteria 2422
407 Ga0207674_10001184 3300026116 Bacteria 33891
408 Ga0207674_10001894 3300026116 Bacteria 26625
409 Ga0207674_10010389 3300026116 Bacteria 10551
410 Ga0207674_10017887 3300026116 Bacteria 7725
411 Ga0207675_100019233 3300026118 Bacteria 6373
412 Ga0207683_10002394 3300026121 Bacteria 16388
413 Ga0207683_10024963 3300026121 Bacteria 5152
414 Ga0207683_10045072 3300026121 Bacteria 3856
415 Ga0207683_10115487 3300026121 Bacteria 2406
416 Ga0207698_10252621 3300026142 Bacteria 1614
417 Ga0209974_10001669 3300027876 Bacteria 8032
418 Ga0207428_10236043 3300027907 Bacteria 1367
419 Ga0268266_10000200 3300028379 Bacteria 104456
420 Ga0268266_10032344 3300028379 Bacteria 4445
421 Ga0268266_10034821 3300028379 Bacteria 4284
422 Ga0268266_10034827 3300028379 Bacteria 4283
423 Ga0268266_10036783 3300028379 Bacteria 4170
424 Ga0268265_10002511 3300028380 Bacteria 13738
425 Ga0268265_10004607 3300028380 Bacteria 9529
426 Ga0268265_10006624 3300028380 Bacteria 7841
427 Ga0268265_10029772 3300028380 Bacteria 3925
428 Ga0268265_10142620 3300028380 Bacteria 2008
429 Ga0268264_10002073 3300028381 Bacteria 17893
430 Ga0268264_10002535 3300028381 Bacteria 16046
431 Ga0268264_10003947 3300028381 Bacteria 12698
432 Ga0307408_100014535 3300031548 Bacteria 5230
433 Ga0307408_100136971 3300031548 Bacteria 1917
434 Ga0307408_100196454 3300031548 Bacteria 1629
435 Ga0307405_10022850 3300031731 Bacteria 3543
436 Ga0307405_10127868 3300031731 Bacteria 1750
437 Ga0307413_10000501 3300031824 Bacteria 12919
438 Ga0307413_10012107 3300031824 Bacteria 4277
439 Ga0307413_10015940 3300031824 Bacteria 3865
440 Ga0307413_10075802 3300031824 Bacteria 2136
441 Ga0307413_10110922 3300031824 Bacteria 1836
442 Ga0307413_10134667 3300031824 Bacteria 1697
443 Ga0307410_10000194 3300031852 Bacteria 22605
444 Ga0307410_10000659 3300031852 Bacteria 14273
445 Ga0307410_10003653 3300031852 Bacteria 7768
446 Ga0307410_10062206 3300031852 Bacteria 2557
447 Ga0307410_10087068 3300031852 Bacteria 2208
448 Ga0307410_10087815 3300031852 Bacteria 2200
449 Ga0307410_10098322 3300031852 Bacteria 2093
450 Ga0307410_10121987 3300031852 Bacteria 1902
451 Ga0307410_10166169 3300031852 Bacteria 1658
452 Ga0307406_10014646 3300031901 Bacteria 4515
453 Ga0307406_10050187 3300031901 Bacteria 2644
454 Ga0307406_10053523 3300031901 Bacteria 2571
455 Ga0307406_10060778 3300031901 Bacteria 2438
456 Ga0307406_10125628 3300031901 Bacteria 1791
457 Ga0307407_10005193 3300031903 Bacteria 5620
458 Ga0307407_10009974 3300031903 Bacteria 4453
459 Ga0307407_10047857 3300031903 Bacteria 2430
460 Ga0307407_10099369 3300031903 Bacteria 1802
461 Ga0307412_10041981 3300031911 Bacteria 2968
462 Ga0307412_10175788 3300031911 Bacteria 1605
463 Ga0307409_100000069 3300031995 Bacteria 37984
464 Ga0307409_100001351 3300031995 Bacteria 11931
465 Ga0307409_100002642 3300031995 Bacteria 9432
466 Ga0307409_100008461 3300031995 Bacteria 6248
467 Ga0307409_100009398 3300031995 Bacteria 6004
468 Ga0307409_100070075 3300031995 Bacteria 2781
469 Ga0307409_100122998 3300031995 Bacteria 2201
470 Ga0307416_100026375 3300032002 Bacteria 4281
471 Ga0307416_100027002 3300032002 Bacteria 4242
472 Ga0307416_100028804 3300032002 Bacteria 4137
473 Ga0307416_100038812 3300032002 Bacteria 3678
474 Ga0307416_100039397 3300032002 Bacteria 3658
475 Ga0307416_100092263 3300032002 Bacteria 2604
476 Ga0307414_10000651 3300032004 Bacteria 17739
477 Ga0307414_10000834 3300032004 Bacteria 15720
478 Ga0307414_10014060 3300032004 Bacteria 4784
479 Ga0307414_10026705 3300032004 Bacteria 3720
480 Ga0307414_10114529 3300032004 Bacteria 2060
481 Ga0307414_10187431 3300032004 Bacteria 1670
482 Ga0307411_10001475 3300032005 Bacteria 9664
483 Ga0307411_10002773 3300032005 Bacteria 7885
484 Ga0307411_10014422 3300032005 Bacteria 4395
485 Ga0307411_10021069 3300032005 Bacteria 3805
486 Ga0307411_10021860 3300032005 Bacteria 3754
487 Ga0307411_10021910 3300032005 Bacteria 3751
488 Ga0307411_10225984 3300032005 Bacteria 1455
489 Ga0307415_100003122 3300032126 Bacteria 8390
490 Ga0307415_100007803 3300032126 Bacteria 5879
491 Ga0307415_100048792 3300032126 Bacteria 2858
492 Ga0307415_100085000 3300032126 Bacteria 2272
493 Ga0307415_100189869 3300032126 Bacteria 1620
494 Ga0395899_0000998 3300037312 Bacteria 25996
495 Ga0395899_0001390 3300037312 Bacteria 20752
496 Ga0395899_0003175 3300037312 Bacteria 13042
497 Ga0395899_0024353 3300037312 Bacteria 4577
498 Ga0395899_0027967 3300037312 Bacteria 4247
499 Ga0395900_0000290 3300037418 Bacteria 75444
500 Ga0395900_0004722 3300037418 Bacteria 14370
501 Ga0395900_0009923 3300037418 Bacteria 9749
502 Ga0395900_0043706 3300037418 Bacteria 4618
503 Ga0395900_0059316 3300037418 Bacteria 3939
504 Ga0395900_0089484 3300037418 Bacteria 3164
505 Ga0395900_0118125 3300037418 Bacteria 2721
506 Ga0395900_0123203 3300037418 Bacteria 2659
507 Ga0395900_0255922 3300037418 Bacteria 1750
508 Ga0395898_0000054 3300037466 Bacteria 279561
509 Ga0395898_0002537 3300037466 Bacteria 21412
510 Ga0395898_0002720 3300037466 Bacteria 20390
511 Ga0395898_0020658 3300037466 Bacteria 6686
512 Ga0395898_0041320 3300037466 Bacteria 4555
513 Ga0395898_0046065 3300037466 Bacteria 4284
514 Ga0395898_0286211 3300037466 Bacteria 1572
515 Ga0395905_0000046 3300037471 Bacteria 240463
516 Ga0395905_0001881 3300037471 Bacteria 24188
517 Ga0395905_0003151 3300037471 Bacteria 17763
518 Ga0395905_0004285 3300037471 Bacteria 14873
519 Ga0395905_0007333 3300037471 Bacteria 10985
520 Ga0395905_0007948 3300037471 Bacteria 10491
521 Ga0395905_0008923 3300037471 Bacteria 9847
522 Ga0395905_0009946 3300037471 Bacteria 9268
523 Ga0395905_0011831 3300037471 Bacteria 8424
524 Ga0395905_0012556 3300037471 Bacteria 8148
525 Ga0395905_0015579 3300037471 Bacteria 7223
526 Ga0395905_0022116 3300037471 Bacteria 6016
527 Ga0395905_0040463 3300037471 Bacteria 4373
528 Ga0395905_0044960 3300037471 Bacteria 4142
529 Ga0395905_0054473 3300037471 Bacteria 3743
530 Ga0395905_0061948 3300037471 Bacteria 3499
531 Ga0395905_0084874 3300037471 Bacteria 2967
532 Ga0395905_0089664 3300037471 Bacteria 2882
533 Ga0395905_0108987 3300037471 Bacteria 2600
534 Ga0395905_0110415 3300037471 Bacteria 2582
535 Ga0395905_0125912 3300037471 Bacteria 2409
536 Ga0395905_0154652 3300037471 Bacteria 2157
537 Ga0395901_0000102 3300038443 Bacteria 115611
538 Ga0395901_0003921 3300038443 Bacteria 14966
539 Ga0395901_0004019 3300038443 Bacteria 14813
540 Ga0395901_0004628 3300038443 Bacteria 13884
541 Ga0395901_0008199 3300038443 Bacteria 10557
542 Ga0395901_0008454 3300038443 Bacteria 10402
543 Ga0395901_0021833 3300038443 Bacteria 6561
544 Ga0395901_0088285 3300038443 Bacteria 3243
545 Ga0395901_0107380 3300038443 Bacteria 2930
546 Ga0395901_0110317 3300038443 Bacteria 2888
547 Ga0395901_0115931 3300038443 Bacteria 2814
548 Ga0395901_0199899 3300038443 Bacteria 2095
549 Ga0395901_0380027 3300038443 Bacteria 1454
550 Ga0395901_0381421 3300038443 Bacteria 1451
551 Ga0395901_0520355 3300038443 Bacteria 1209
552 Ga0439432_016328 3300042006 Bacteria 2500
553 Ga0439449_0021347 3300042007 Bacteria 2425
554 Ga0439458_0003767 3300042157 Bacteria 3511
555 Ga0466969_0057952 3300044656 Bacteria 1887
556 Ga0466972_0013676 3300044658 Bacteria 4072
557 Ga0466966_0047394 3300044684 Bacteria 2740
558 Ga0466966_0048941 3300044684 Bacteria 2692
559 Ga0466963_0135050 3300044694 Bacteria 1706
560 Ga0466971_0019852 3300044719 Bacteria 2985
561 Ga0466957_0081655 3300044842 Bacteria 2013
562 Ga0466959_0029553 3300045049 Bacteria 4061
563 Ga0466959_0032655 3300045049 Bacteria 3853
564 Ga0466959_0312786 3300045049 Bacteria 1075
565 Ga0466958_0009773 3300045836 Bacteria 5352
566 Ga0466958_0061275 3300045836 Bacteria 2291
567 Ga0466967_0036825 3300045976 Bacteria 4181
568 Ga0495585_0053016 3300046492 Bacteria 2245
569 Ga0495663_0001341 3300046525 Bacteria 7780
570 Ga0495642_0043133 3300046528 Bacteria 1839
571 Ga0495621_0003469 3300046539 Bacteria 4351
572 Ga0495621_0011641 3300046539 Bacteria 2727
573 Ga0495668_0005141 3300046616 Bacteria 8993
574 Ga0495668_0006700 3300046616 Bacteria 7502
575 Ga0495669_0000644 3300046684 Bacteria 15189
576 Ga0495669_0010498 3300046684 Bacteria 3916
577 Ga0495669_0012236 3300046684 Bacteria 3649
578 Ga0495669_0013035 3300046684 Bacteria 3542
579 Ga0495669_0026403 3300046684 Bacteria 2538
580 Ga0495669_0027132 3300046684 Bacteria 2504
581 Ga0495669_0047355 3300046684 Bacteria 1920
582 Ga0495669_0145956 3300046684 Bacteria 1118
583 Ga0495670_0013778 3300046691 Bacteria 3975
584 Ga0495677_0004567 3300047445 Bacteria 5295
585 Ga0495677_0014711 3300047445 Bacteria 2846
586 Ga0496101_0046155 3300048904 Bacteria 3124
587 Ga0496102_0615579 3300048905 Bacteria 1009
588 Ga0496103_0112290 3300048906 Bacteria 1732
589 Ga0496103_0150333 3300048906 Bacteria 1492
590 Ga0496104_0088229 3300048907 Bacteria 2963
591 Ga0496107_0001322 3300048910 Bacteria 15195
592 Ga0496107_0096407 3300048910 Bacteria 2165
593 Ga0496108_0007117 3300048911 Bacteria 9064
594 Ga0496108_0034858 3300048911 Bacteria 4181
595 Ga0496108_0150214 3300048911 Bacteria 2010
596 Ga0496109_0003294 3300048912 Bacteria 13487
597 Ga0496109_0079464 3300048912 Bacteria 3022
598 Ga0496109_0086239 3300048912 Bacteria 2899
599 Ga0496110_0023225 3300048913 Bacteria 5273
600 Ga0496110_0032219 3300048913 Bacteria 4525
601 Ga0496111_0025676 3300048914 Bacteria 4157
602 Ga0496111_0043684 3300048914 Bacteria 3221
603 Ga0496111_0310864 3300048914 Bacteria 1168
604 Ga0496112_0000242 3300048915 Bacteria 35031
605 Ga0496112_0137145 3300048915 Bacteria 2416
606 Ga0496112_0200497 3300048915 Bacteria 1955
607 Ga0496112_0257639 3300048915 Bacteria 1694
608 Ga0496112_0294767 3300048915 Bacteria 1568
609 Ga0496113_0002738 3300048916 Bacteria 10360
610 Ga0496113_0011264 3300048916 Bacteria 5956
611 Ga0496113_0013132 3300048916 Bacteria 5594
612 Ga0496114_0083136 3300048917 Bacteria 2708
613 Ga0501069_0020563 3300049585 Bacteria 3577
614 nmdc:mga06r32_100419_c1 3300050510 Bacteria 2839
615 nmdc:mga08y16_277904_c1 3300050511 Bacteria 1728
616 nmdc:mga0rr50_417799_c1 3300050513 Bacteria 1134
617 Ga0500658_0000032 3300053134 Bacteria 90863
618 Ga0466962_0036732 3300061719 Bacteria 2345
619 Ga0207709_10106894
620 JGI24740J21852_10000554
621 JGI24739J22299_10000405
622 JGI24737J22298_10000061
623 JGI24737J22298_10002804
624 JGI24737J22298_10011266
625 JGI24738J21930_10000146
626 JGI24751J29686_10005552
627 Ga0065712_10138290
628 Ga0065715_10000291
629 Ga0065715_10133866
630 Ga0070658_10001056
631 Ga0070658_10001507
632 Ga0070658_10011106
633 Ga0070658_10047896
634 Ga0070658_10063072
635 Ga0070676_10008049
636 Ga0070676_10092736
637 Ga0070683_100001823
638 Ga0070690_100003412
639 Ga0070690_100081178
640 Ga0070670_100003544
641 Ga0070670_100007835
642 Ga0070670_100022832
643 Ga0070670_100028300
644 Ga0070670_100082354
645 Ga0070670_100134665
646 Ga0070677_10005808
647 Ga0070677_10007168
648 Ga0070677_10011411
649 Ga0070677_10016162
650 Ga0068869_100000493
651 Ga0068869_100033200
652 Ga0070666_10000310
653 Ga0070666_10044871
654 Ga0070666_10108188
655 Ga0070680_100001306
656 Ga0068868_100009873
657 Ga0068868_100063238
658 Ga0070660_100000393
659 Ga0070660_100002280
660 Ga0070660_100052230
661 Ga0070660_100100714
662 Ga0070660_100210468
663 Ga0070660_100257655
664 Ga0070661_100001818
665 Ga0070661_100031076
666 Ga0070661_100032079
667 Ga0070692_10056009
668 Ga0070692_10106386
669 Ga0070668_100001945
670 Ga0070668_100009752
671 Ga0070668_100018998
672 Ga0070668_100053578
673 Ga0070668_100124276
674 Ga0070669_100000532
675 Ga0070669_100021191
676 Ga0070669_100027300
677 Ga0070669_100054797
678 Ga0070669_100143954
679 Ga0070669_100195716
680 Ga0070675_100004774
681 Ga0070675_100018719
682 Ga0070671_100000254
683 Ga0070671_100000539
684 Ga0070671_100001204
685 Ga0070671_100008371
686 Ga0070671_100018815
687 Ga0070671_100033828
688 Ga0070671_100064368
689 Ga0070671_100076411
690 Ga0070671_100085050
691 Ga0070671_100104872
692 Ga0070671_100240431
693 Ga0070674_100004769
694 Ga0070674_100007740
695 Ga0070674_100166305
696 Ga0070673_100000058
697 Ga0070673_100011087
698 Ga0070673_100049943
699 Ga0070673_100123357
700 Ga0070673_100300939
701 Ga0070673_100413366
702 Ga0070659_100000564
703 Ga0070659_100002195
704 Ga0070659_100004781
705 Ga0070659_100010127
706 Ga0070659_100039287
707 Ga0070659_100046658
708 Ga0070659_100309051
709 Ga0070667_100003138
710 Ga0070667_100019854
711 Ga0070667_100021388
712 Ga0070667_100099897
713 Ga0070667_100105703
714 Ga0070667_100407463
715 Ga0070714_100043420
716 Ga0070694_100006264
717 Ga0070663_100000271
718 Ga0070663_100028965
719 Ga0070663_100059055
720 Ga0070663_100099972
721 Ga0070678_100034362
722 Ga0070678_100192611
723 Ga0070662_100000280
724 Ga0070662_100001326
725 Ga0070662_100002356
726 Ga0070662_100014088
727 Ga0070662_100022052
728 Ga0070662_100057035
729 Ga0070662_100112618
730 Ga0070662_100122369
731 Ga0070662_100144287
732 Ga0070681_10185287
733 Ga0068867_100000581
734 Ga0068867_100015265
735 Ga0068867_100034864
736 Ga0068867_100036996
737 Ga0070679_100000346
738 Ga0070684_100223481
739 Ga0068853_100000783
740 Ga0068853_100180146
741 Ga0070672_100003912
742 Ga0070672_100019251
743 Ga0070672_100030589
744 Ga0070672_100036550
745 Ga0070672_100092487
746 Ga0070672_100192909
747 Ga0070686_100057220
748 Ga0070665_100001540
749 Ga0070665_100004875
750 Ga0070665_100031329
751 Ga0070665_100047018
752 Ga0070665_100059010
753 Ga0070665_100386481
754 Ga0068855_100001416
755 Ga0068855_100001751
756 Ga0068855_100009125
757 Ga0068855_100145767
758 Ga0070664_100003969
759 Ga0070664_100011906
760 Ga0070664_100038862
761 Ga0070664_100122406
762 Ga0070664_100210794
763 Ga0068857_100000531
764 Ga0068857_100008327
765 Ga0068857_100021196
766 Ga0068857_100025898
767 Ga0068854_100003661
768 Ga0068854_100014014
769 Ga0068854_100044109
770 Ga0068856_100018394
771 Ga0068852_100003205
772 Ga0068852_100099279
773 Ga0068852_100182603
774 Ga0068859_100000136
775 Ga0068859_100001019
776 Ga0068859_100003244
777 Ga0068859_100047591
778 Ga0068859_100248933
779 Ga0068864_100000235
780 Ga0068864_100000540
781 Ga0068864_100000711
782 Ga0068864_100073022
783 Ga0068866_10084861
784 Ga0068861_100049365
785 Ga0068851_10057641
786 Ga0068863_100000140
787 Ga0068863_100001845
788 Ga0068863_100011565
789 Ga0068863_100014473
790 Ga0068863_100028097
791 Ga0068863_100120273
792 Ga0068858_100000514
793 Ga0068858_100002498
794 Ga0068858_100004922
795 Ga0068858_100010778
796 Ga0068858_100014241
797 Ga0068858_100032216
798 Ga0068858_100053887
799 Ga0068860_100026574
800 Ga0068860_100038700
801 Ga0068862_100032002
802 Ga0068862_100036248
803 Ga0068862_100106957
804 Ga0068862_100124023
805 Ga0068862_100137987
806 Ga0070717_10091811
807 Ga0097621_100098802
808 Ga0068871_100025268
809 Ga0075431_100143299
810 Ga0068865_100000697
811 Ga0068865_100011665
812 Ga0068865_100047539
813 Ga0068865_100135199
814 Ga0097620_100000136
815 Ga0097620_100001019
816 Ga0097620_100003244
817 Ga0097620_100047593
818 Ga0097620_100248931
819 Ga0111539_10067835
820 Ga0105245_10000170
821 Ga0105243_10127687
822 Ga0105241_10056381
823 Ga0105242_10268553
824 Ga0105248_10000184
825 Ga0105248_10001263
826 Ga0105248_10001269
827 Ga0105248_10003825
828 Ga0105248_10006079
829 Ga0105248_10011624
830 Ga0105248_10028196
831 Ga0105248_10245851
832 Ga0105238_10221656
833 Ga0105249_10175678
834 Ga0105249_10231839
835 Ga0105249_10481622
836 Ga0105239_10029054
837 Ga0105239_10093563
838 Ga0157373_10064478
839 Ga0157371_10000443
840 Ga0157371_10001298
841 Ga0157371_10086142
842 Ga0157370_10009490
843 Ga0157369_10148055
844 Ga0157378_10000312
845 Ga0163162_10006506
846 Ga0163162_10060796
847 Ga0163162_10281198
848 Ga0157372_10081710
849 Ga0157372_10487859
850 Ga0157375_10011093
851 Ga0157375_10025124
852 Ga0157375_10044879
853 Ga0157375_10099813
854 Ga0163163_10000131
855 Ga0163163_10388618
856 Ga0157380_10003736
857 Ga0157377_10019088
858 Ga0157379_10001982
859 Ga0157379_10320097
860 Ga0163161_10031389
861 Ga0206353_11034454
862 Ga0207697_10000063
863 Ga0207697_10000134
864 Ga0207697_10012389
865 Ga0207656_10001771
866 Ga0207682_10001817
867 Ga0207642_10003851
868 Ga0207688_10000106
869 Ga0207688_10074054
870 Ga0207680_10013612
871 Ga0207680_10058986
872 Ga0207680_10123938
873 Ga0207647_10000246
874 Ga0207647_10001685
875 Ga0207647_10047406
876 Ga0207647_10070855
877 Ga0207645_10001636
878 Ga0207645_10002473
879 Ga0207645_10017581
880 Ga0207643_10103522
881 Ga0207643_10178755
882 Ga0207705_10000270
883 Ga0207705_10000654
884 Ga0207705_10021694
885 Ga0207705_10036638
886 Ga0207705_10037664
887 Ga0207660_10002965
888 Ga0207660_10113000
889 Ga0207657_10000165
890 Ga0207657_10001091
891 Ga0207657_10002106
892 Ga0207657_10004437
893 Ga0207657_10117611
894 Ga0207657_10142195
895 Ga0207649_10025955
896 Ga0207649_10078632
897 Ga0207652_10000058
898 Ga0207652_10234716
899 Ga0207681_10000712
900 Ga0207681_10005179
901 Ga0207681_10018945
902 Ga0207681_10038999
903 Ga0207681_10072741
904 Ga0207681_10092359
905 Ga0207694_10222498
906 Ga0207694_10269206
907 Ga0207650_10017570
908 Ga0207650_10029240
909 Ga0207650_10034836
910 Ga0207650_10052250
911 Ga0207650_10257576
912 Ga0207659_10058140
913 Ga0207659_10090847
914 Ga0207664_10051524
915 Ga0207644_10001112
916 Ga0207644_10011791
917 Ga0207644_10012065
918 Ga0207644_10013797
919 Ga0207644_10014968
920 Ga0207644_10023425
921 Ga0207644_10039626
922 Ga0207644_10084201
923 Ga0207690_10002306
924 Ga0207690_10002510
925 Ga0207690_10010985
926 Ga0207706_10000224
927 Ga0207706_10003287
928 Ga0207706_10004293
929 Ga0207706_10008924
930 Ga0207706_10013030
931 Ga0207706_10022603
932 Ga0207706_10022695
933 Ga0207706_10045173
934 Ga0207706_10052300
935 Ga0207706_10197722
936 Ga0207669_10012986
937 Ga0207704_10013542
938 Ga0207704_10054173
939 Ga0207704_10113647
940 Ga0207691_10000750
941 Ga0207691_10016053
942 Ga0207691_10016539
943 Ga0207691_10022329
944 Ga0207691_10041076
945 Ga0207691_10043740
946 Ga0207691_10068953
947 Ga0207691_10072558
948 Ga0207691_10079118
949 Ga0207691_10117052
950 Ga0207691_10132368
951 Ga0207711_10000105
952 Ga0207711_10000190
953 Ga0207711_10000908
954 Ga0207711_10001131
955 Ga0207711_10002435
956 Ga0207711_10029578
957 Ga0207711_10032566
958 Ga0207711_10158829
959 Ga0207689_10000051
960 Ga0207689_10026198
961 Ga0207689_10037169
962 Ga0207689_10084910
963 Ga0207689_10122965
964 Ga0207661_10002950
965 Ga0207679_10022639
966 Ga0207679_10045361
967 Ga0207679_10098481
968 Ga0207679_10104923
969 Ga0207679_10150221
970 Ga0207667_10000579
971 Ga0207667_10006485
972 Ga0207667_10012465
973 Ga0207651_10000226
974 Ga0207651_10031763
975 Ga0207651_10038101
976 Ga0207712_10013421
977 Ga0207712_10310069
978 Ga0207668_10000086
979 Ga0207668_10004997
980 Ga0207668_10025381
981 Ga0207668_10041535
982 Ga0207668_10154422
983 Ga0207640_10000428
984 Ga0207658_10002031
985 Ga0207658_10002254
986 Ga0207658_10008914
987 Ga0207658_10030169
988 Ga0207658_10049703
989 Ga0207658_10051031
990 Ga0207677_10000578
991 Ga0207677_10039632
992 Ga0207703_10006127
993 Ga0207703_10006394
994 Ga0207703_10007523
995 Ga0207703_10013542
996 Ga0207703_10047395
997 Ga0207639_10004387
998 Ga0207639_10168845
999 Ga0207639_10187687
1000 Ga0207678_10000217
1001 Ga0207678_10028227
1002 Ga0207678_10049040
1003 Ga0207678_10058756
1004 Ga0207678_10068668
1005 Ga0207678_10115760
1006 Ga0207678_10120685
1007 Ga0207702_10013141
1008 Ga0207702_10017620
1009 Ga0207641_10000172
1010 Ga0207641_10013909
1011 Ga0207641_10015982
1012 Ga0207641_10019848
1013 Ga0207641_10109167
1014 Ga0207641_10121959
1015 Ga0207648_10001346
1016 Ga0207648_10001535
1017 Ga0207648_10005651
1018 Ga0207648_10006756
1019 Ga0207648_10038813
1020 Ga0207676_10000300
1021 Ga0207676_10001388
1022 Ga0207676_10002706
1023 Ga0207676_10034395
1024 Ga0207676_10098089
1025 Ga0207674_10001184
1026 Ga0207674_10001894
1027 Ga0207674_10010389
1028 Ga0207674_10017887
1029 Ga0207675_100019233
1030 Ga0207683_10002394
1031 Ga0207683_10024963
1032 Ga0207683_10045072
1033 Ga0207683_10115487
1034 Ga0207698_10252621
1035 Ga0209974_10001669
1036 Ga0207428_10236043
1037 Ga0268266_10000200
1038 Ga0268266_10032344
1039 Ga0268266_10034821
1040 Ga0268266_10034827
1041 Ga0268266_10036783
1042 Ga0268265_10002511
1043 Ga0268265_10004607
1044 Ga0268265_10006624
1045 Ga0268265_10029772
1046 Ga0268265_10142620
1047 Ga0268264_10002073
1048 Ga0268264_10002535
1049 Ga0268264_10003947
1050 Ga0307408_100014535
1051 Ga0307408_100136971
1052 Ga0307408_100196454
1053 Ga0307405_10022850
1054 Ga0307405_10127868
1055 Ga0307413_10000501
1056 Ga0307413_10012107
1057 Ga0307413_10015940
1058 Ga0307413_10075802
1059 Ga0307413_10110922
1060 Ga0307413_10134667
1061 Ga0307410_10000194
1062 Ga0307410_10000659
1063 Ga0307410_10003653
1064 Ga0307410_10062206
1065 Ga0307410_10087068
1066 Ga0307410_10087815
1067 Ga0307410_10098322
1068 Ga0307410_10121987
1069 Ga0307410_10166169
1070 Ga0307406_10014646
1071 Ga0307406_10050187
1072 Ga0307406_10053523
1073 Ga0307406_10060778
1074 Ga0307406_10125628
1075 Ga0307407_10005193
1076 Ga0307407_10009974
1077 Ga0307407_10047857
1078 Ga0307407_10099369
1079 Ga0307412_10041981
1080 Ga0307412_10175788
1081 Ga0307409_100000069
1082 Ga0307409_100001351
1083 Ga0307409_100002642
1084 Ga0307409_100008461
1085 Ga0307409_100009398
1086 Ga0307409_100070075
1087 Ga0307409_100122998
1088 Ga0307416_100026375
1089 Ga0307416_100027002
1090 Ga0307416_100028804
1091 Ga0307416_100038812
1092 Ga0307416_100039397
1093 Ga0307416_100092263
1094 Ga0307414_10000651
1095 Ga0307414_10000834
1096 Ga0307414_10014060
1097 Ga0307414_10026705
1098 Ga0307414_10114529
1099 Ga0307414_10187431
1100 Ga0307411_10001475
1101 Ga0307411_10002773
1102 Ga0307411_10014422
1103 Ga0307411_10021069
1104 Ga0307411_10021860
1105 Ga0307411_10021910
1106 Ga0307411_10225984
1107 Ga0307415_100003122
1108 Ga0307415_100007803
1109 Ga0307415_100048792
1110 Ga0307415_100085000
1111 Ga0307415_100189869
1112 Ga0395899_0000998
1113 Ga0395899_0001390
1114 Ga0395899_0003175
1115 Ga0395899_0024353
1116 Ga0395899_0027967
1117 Ga0395900_0000290
1118 Ga0395900_0004722
1119 Ga0395900_0009923
1120 Ga0395900_0043706
1121 Ga0395900_0059316
1122 Ga0395900_0089484
1123 Ga0395900_0118125
1124 Ga0395900_0123203
1125 Ga0395900_0255922
1126 Ga0395898_0000054
1127 Ga0395898_0002537
1128 Ga0395898_0002720
1129 Ga0395898_0020658
1130 Ga0395898_0041320
1131 Ga0395898_0046065
1132 Ga0395898_0286211
1133 Ga0395905_0000046
1134 Ga0395905_0001881
1135 Ga0395905_0003151
1136 Ga0395905_0004285
1137 Ga0395905_0007333
1138 Ga0395905_0007948
1139 Ga0395905_0008923
1140 Ga0395905_0009946
1141 Ga0395905_0011831
1142 Ga0395905_0012556
1143 Ga0395905_0015579
1144 Ga0395905_0022116
1145 Ga0395905_0040463
1146 Ga0395905_0044960
1147 Ga0395905_0054473
1148 Ga0395905_0061948
1149 Ga0395905_0084874
1150 Ga0395905_0089664
1151 Ga0395905_0108987
1152 Ga0395905_0110415
1153 Ga0395905_0125912
1154 Ga0395905_0154652
1155 Ga0395901_0000102
1156 Ga0395901_0003921
1157 Ga0395901_0004019
1158 Ga0395901_0004628
1159 Ga0395901_0008199
1160 Ga0395901_0008454
1161 Ga0395901_0021833
1162 Ga0395901_0088285
1163 Ga0395901_0107380
1164 Ga0395901_0110317
1165 Ga0395901_0115931
1166 Ga0395901_0199899
1167 Ga0395901_0380027
1168 Ga0395901_0381421
1169 Ga0395901_0520355
1170 Ga0439432_016328
1171 Ga0439449_0021347
1172 Ga0439458_0003767
1173 Ga0466969_0057952
1174 Ga0466972_0013676
1175 Ga0466966_0047394
1176 Ga0466966_0048941
1177 Ga0466963_0135050
1178 Ga0466971_0019852
1179 Ga0466957_0081655
1180 Ga0466959_0029553
1181 Ga0466959_0032655
1182 Ga0466959_0312786
1183 Ga0466958_0009773
1184 Ga0466958_0061275
1185 Ga0466967_0036825
1186 Ga0495585_0053016
1187 Ga0495663_0001341
1188 Ga0495642_0043133
1189 Ga0495621_0003469
1190 Ga0495621_0011641
1191 Ga0495668_0005141
1192 Ga0495668_0006700
1193 Ga0495669_0000644
1194 Ga0495669_0010498
1195 Ga0495669_0012236
1196 Ga0495669_0013035
1197 Ga0495669_0026403
1198 Ga0495669_0027132
1199 Ga0495669_0047355
1200 Ga0495669_0145956
1201 Ga0495670_0013778
1202 Ga0495677_0004567
1203 Ga0495677_0014711
1204 Ga0496101_0046155
1205 Ga0496102_0615579
1206 Ga0496103_0112290
1207 Ga0496103_0150333
1208 Ga0496104_0088229
1209 Ga0496107_0001322
1210 Ga0496107_0096407
1211 Ga0496108_0007117
1212 Ga0496108_0034858
1213 Ga0496108_0150214
1214 Ga0496109_0003294
1215 Ga0496109_0079464
1216 Ga0496109_0086239
1217 Ga0496110_0023225
1218 Ga0496110_0032219
1219 Ga0496111_0025676
1220 Ga0496111_0043684
1221 Ga0496111_0310864
1222 Ga0496112_0000242
1223 Ga0496112_0137145
1224 Ga0496112_0200497
1225 Ga0496112_0257639
1226 Ga0496112_0294767
1227 Ga0496113_0002738
1228 Ga0496113_0011264
1229 Ga0496113_0013132
1230 Ga0496114_0083136
1231 Ga0501069_0020563
1232 nmdc:mga06r32_100419_c1
1233 nmdc:mga08y16_277904_c1
1234 nmdc:mga0rr50_417799_c1
1235 Ga0500658_0000032
1236 Ga0466962_0036732

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00724

Oxidored_FMN

NADH:flavin oxidoreductase / NADH oxidase family

3

331

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6myw-assembly2.cif.gz_B gluconobacter ene-reductase (gluer) mutant - t36a 0.978 1 356
6o08-assembly1.cif.gz_A gluconobacter ene-reductase (gluer) 0.977 1 358
8fw1-assembly3.cif.gz_C gluconobacter ene-reductase (gluer) mutant - pager 0.9766 1 357
6myw-assembly2.cif.gz_B gluconobacter ene-reductase (gluer) mutant - t36a 0.9753 1 356
4a3u-assembly2.cif.gz_B x-structure of the old yellow enzyme homologue from zymomonas mobilis (ncr) 0.9743 2 356
ID Description Score Start End Superfamily
4a3uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9761 2 356 3.20.20.70
4a3uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9734 2 356 3.20.20.70
af_E9AGH8_6_374_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9523 2 356 3.20.20.70
af_Q4CNI1_1_256_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9483 4 227 3.20.20.70
af_E9AGH7_3_365_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9483 4 356 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6M1QEG4-F1-model_v4 deleted 0.9944 1 110
AF-A0A2T0KAG2-F1-model_v4 NADH:flavin oxidoreductase/NADH oxidase family protein 0.9865 1 147 GO:0005829
GO:0010181
GO:0016491
AF-A0A164GDP6-F1-model_v4 NADH-dependent flavin oxidoreductase yqiG-like protein 0.9846 154 250 GO:0005829
GO:0010181
GO:0016491
AF-A0A4Q2X3D4-F1-model_v4 deleted 0.9836 1 295
AF-A0A090QN19-F1-model_v4 2,4-dienoyl-CoA reductase (EC 1.3.1.34) 0.9824 4 262 GO:0005829
GO:0008670
GO:0010181

Map