F469797
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 619 | 295 | 615 | 306 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100036922|Ga0070671_1000369224 |
| Length | 358 |
| Sequence | VQTDPVNHGVQAIVGPAYQSRYGVVRSTKLYGSALPDYSTLPLAFLSHSDCGLHDTGWGHPEHVGRLRAIPRALRNDFELFELVEHREARHASADEVAIAHDARYVEMVRQLAEAGGGRLDADTVVSEGSWAAATAGTGAVLDAVDLAFGDGPRRSFCAVRPPGHHALRSSGMGFCLFGNVAVGAHYARKTHGAERVLIVDWDVHHGNGTQALVQDTPDIRFVSMHQWPWYPGTGPATDRGPHGSVWNVPMAAGLPRDAYVTTFLSAVDSATVGFTPDLVLVSAGFDSLAGDPLGGFTLEMDDVDRLTREMVSRAEQWCGGRLVSSLEGGYAPERLGEACVVHMRGLTGAGRGVGGAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 2 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 3 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 4 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 162 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 163 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 169 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 179 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 189 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 191 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 197 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 198 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 199 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 200 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 201 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 202 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.19 |
| Metatranscriptomes | 0.16 |
| Isolates | 0.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.1 |
| Nodule | 0 |
| Rhizoplane | 2.42 |
| Rhizosphere | 94.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1003540 | 3300002737 | Bacteria | 4417 |
| 2 | JGI25162J39368_1004704 | 3300002737 | Bacteria | 3039 |
| 3 | JGI25164J39214_1001713 | 3300002772 | Bacteria | 4421 |
| 4 | JGI25164J39214_1001717 | 3300002772 | Bacteria | 4417 |
| 5 | JGI25165J46597_1003126 | 3300003214 | Bacteria | 4418 |
| 6 | JGI25165J46597_1003610 | 3300003214 | Bacteria | 3741 |
| 7 | Ga0070658_10002354 | 3300005327 | Bacteria | 15843 |
| 8 | Ga0070658_10064669 | 3300005327 | Bacteria | 2984 |
| 9 | Ga0070658_10146947 | 3300005327 | Unclassified | 1972 |
| 10 | Ga0070658_10428545 | 3300005327 | Bacteria | 1138 |
| 11 | Ga0070676_10040675 | 3300005328 | Bacteria | 2693 |
| 12 | Ga0070683_100010567 | 3300005329 | Bacteria | 7937 |
| 13 | Ga0070683_100021736 | 3300005329 | Bacteria | 5729 |
| 14 | Ga0070683_100046459 | 3300005329 | Bacteria | 4011 |
| 15 | Ga0070683_100125742 | 3300005329 | Bacteria | 2424 |
| 16 | Ga0070683_100407893 | 3300005329 | Unclassified | 1296 |
| 17 | Ga0070670_100008009 | 3300005331 | Bacteria | 8987 |
| 18 | Ga0070670_100012711 | 3300005331 | Bacteria | 7204 |
| 19 | Ga0070670_100032694 | 3300005331 | Bacteria | 4481 |
| 20 | Ga0070670_100063617 | 3300005331 | Bacteria | 3167 |
| 21 | Ga0068869_100022207 | 3300005334 | Bacteria | 4370 |
| 22 | Ga0070680_100014934 | 3300005336 | Bacteria | 6078 |
| 23 | Ga0070680_100025277 | 3300005336 | Bacteria | 4745 |
| 24 | Ga0070680_100059214 | 3300005336 | Bacteria | 3133 |
| 25 | Ga0070680_100066100 | 3300005336 | Bacteria | 2965 |
| 26 | Ga0070660_100008136 | 3300005339 | Bacteria | 7328 |
| 27 | Ga0070660_100012191 | 3300005339 | Bacteria | 6137 |
| 28 | Ga0070660_100047855 | 3300005339 | Bacteria | 3283 |
| 29 | Ga0070660_100050925 | 3300005339 | Bacteria | 3187 |
| 30 | Ga0070660_100056719 | 3300005339 | Bacteria | 3031 |
| 31 | Ga0070660_100064485 | 3300005339 | Bacteria | 2850 |
| 32 | Ga0070660_100354535 | 3300005339 | Bacteria | 1209 |
| 33 | Ga0070689_100279796 | 3300005340 | Bacteria | 1384 |
| 34 | Ga0070687_100013515 | 3300005343 | Bacteria | 3640 |
| 35 | Ga0070661_100001621 | 3300005344 | Bacteria | 15562 |
| 36 | Ga0070661_100009120 | 3300005344 | Bacteria | 6857 |
| 37 | Ga0070661_100039749 | 3300005344 | Bacteria | 3428 |
| 38 | Ga0070661_100242216 | 3300005344 | Bacteria | 1389 |
| 39 | Ga0070668_100023636 | 3300005347 | Bacteria | 4650 |
| 40 | Ga0070668_100134395 | 3300005347 | Bacteria | 1988 |
| 41 | Ga0070669_100018006 | 3300005353 | Bacteria | 5047 |
| 42 | Ga0070669_100025846 | 3300005353 | Bacteria | 4220 |
| 43 | Ga0070675_100001250 | 3300005354 | Bacteria | 18554 |
| 44 | Ga0070675_100018662 | 3300005354 | Bacteria | 5521 |
| 45 | Ga0070675_100387576 | 3300005354 | Bacteria | 1245 |
| 46 | Ga0070671_100036922 | 3300005355 | Bacteria | 4051 |
| 47 | Ga0070674_100021122 | 3300005356 | Bacteria | 4173 |
| 48 | Ga0070673_100019055 | 3300005364 | Bacteria | 4921 |
| 49 | Ga0070673_100117736 | 3300005364 | Bacteria | 2211 |
| 50 | Ga0070673_100177518 | 3300005364 | Bacteria | 1821 |
| 51 | Ga0070659_100049345 | 3300005366 | Bacteria | 3309 |
| 52 | Ga0070659_100094830 | 3300005366 | Bacteria | 2397 |
| 53 | Ga0070659_100098279 | 3300005366 | Bacteria | 2354 |
| 54 | Ga0070659_100133951 | 3300005366 | Bacteria | 2014 |
| 55 | Ga0070659_100154950 | 3300005366 | Bacteria | 1870 |
| 56 | Ga0070667_100020670 | 3300005367 | Bacteria | 5466 |
| 57 | Ga0070667_100060093 | 3300005367 | Bacteria | 3216 |
| 58 | Ga0070667_100130057 | 3300005367 | Bacteria | 2196 |
| 59 | Ga0070667_100136265 | 3300005367 | Unclassified | 2147 |
| 60 | Ga0070709_10005361 | 3300005434 | Bacteria | 6948 |
| 61 | Ga0070709_10005715 | 3300005434 | Bacteria | 6748 |
| 62 | Ga0070714_100002900 | 3300005435 | Bacteria | 12692 |
| 63 | Ga0070714_100047003 | 3300005435 | Bacteria | 3664 |
| 64 | Ga0070713_100000157 | 3300005436 | Bacteria | 46028 |
| 65 | Ga0070713_100006772 | 3300005436 | Bacteria | 7983 |
| 66 | Ga0070710_10035114 | 3300005437 | Bacteria | 2732 |
| 67 | Ga0070708_100078550 | 3300005445 | Bacteria | 2983 |
| 68 | Ga0070663_100023831 | 3300005455 | Bacteria | 4109 |
| 69 | Ga0070678_100004646 | 3300005456 | Bacteria | 7810 |
| 70 | Ga0070678_100173786 | 3300005456 | Bacteria | 1757 |
| 71 | Ga0070662_100153031 | 3300005457 | Unclassified | 1797 |
| 72 | Ga0070681_10000838 | 3300005458 | Bacteria | 25763 |
| 73 | Ga0070681_10000845 | 3300005458 | Bacteria | 25708 |
| 74 | Ga0070681_10016973 | 3300005458 | Bacteria | 7273 |
| 75 | Ga0070681_10017582 | 3300005458 | Bacteria | 7145 |
| 76 | Ga0070681_10106087 | 3300005458 | Bacteria | 2751 |
| 77 | Ga0070681_10117006 | 3300005458 | Bacteria | 2602 |
| 78 | Ga0070681_10128564 | 3300005458 | Bacteria | 2466 |
| 79 | Ga0070681_10145058 | 3300005458 | Bacteria | 2303 |
| 80 | Ga0070681_10195600 | 3300005458 | Bacteria | 1941 |
| 81 | Ga0070681_10440311 | 3300005458 | Bacteria | 1215 |
| 82 | Ga0068867_100042096 | 3300005459 | Bacteria | 3339 |
| 83 | Ga0070685_10020078 | 3300005466 | Bacteria | 3614 |
| 84 | Ga0070685_10145916 | 3300005466 | Bacteria | 1495 |
| 85 | Ga0070706_100252149 | 3300005467 | Bacteria | 1647 |
| 86 | Ga0070707_100053878 | 3300005468 | Bacteria | 3856 |
| 87 | Ga0070707_100084177 | 3300005468 | Bacteria | 3073 |
| 88 | Ga0070698_100021816 | 3300005471 | Bacteria | 6707 |
| 89 | Ga0070698_100041842 | 3300005471 | Bacteria | 4704 |
| 90 | Ga0070699_100003804 | 3300005518 | Bacteria | 13341 |
| 91 | Ga0070699_100025162 | 3300005518 | Bacteria | 5133 |
| 92 | Ga0070699_100063536 | 3300005518 | Bacteria | 3201 |
| 93 | Ga0070699_100064740 | 3300005518 | Bacteria | 3171 |
| 94 | Ga0070679_100002461 | 3300005530 | Bacteria | 16770 |
| 95 | Ga0070679_100010382 | 3300005530 | Bacteria | 8831 |
| 96 | Ga0070679_100011557 | 3300005530 | Bacteria | 8414 |
| 97 | Ga0070679_100016930 | 3300005530 | Bacteria | 7048 |
| 98 | Ga0070679_100020200 | 3300005530 | Bacteria | 6493 |
| 99 | Ga0070679_100031797 | 3300005530 | Archaea | 5218 |
| 100 | Ga0070679_100054951 | 3300005530 | Bacteria | 3965 |
| 101 | Ga0070679_100066673 | 3300005530 | Bacteria | 3588 |
| 102 | Ga0070679_100198702 | 3300005530 | Bacteria | 1972 |
| 103 | Ga0070679_100523171 | 3300005530 | Bacteria | 1130 |
| 104 | Ga0070684_100034253 | 3300005535 | Bacteria | 4341 |
| 105 | Ga0070684_100051342 | 3300005535 | Bacteria | 3582 |
| 106 | Ga0070684_100082581 | 3300005535 | Bacteria | 2845 |
| 107 | Ga0070684_100169308 | 3300005535 | Bacteria | 1984 |
| 108 | Ga0068853_100040545 | 3300005539 | Bacteria | 3973 |
| 109 | Ga0070672_100099536 | 3300005543 | Unclassified | 2356 |
| 110 | Ga0070695_100012797 | 3300005545 | Bacteria | 5037 |
| 111 | Ga0070696_100000464 | 3300005546 | Bacteria | 25407 |
| 112 | Ga0070696_100028078 | 3300005546 | Bacteria | 3838 |
| 113 | Ga0070696_100030306 | 3300005546 | Bacteria | 3703 |
| 114 | Ga0070696_100034715 | 3300005546 | Bacteria | 3471 |
| 115 | Ga0070693_100015117 | 3300005547 | Bacteria | 3969 |
| 116 | Ga0070693_100032905 | 3300005547 | Bacteria | 2856 |
| 117 | Ga0070693_100060264 | 3300005547 | Unclassified | 2202 |
| 118 | Ga0070693_100236923 | 3300005547 | Bacteria | 1203 |
| 119 | Ga0070665_100050932 | 3300005548 | Bacteria | 4155 |
| 120 | Ga0070704_100066780 | 3300005549 | Bacteria | 2595 |
| 121 | Ga0068855_100002422 | 3300005563 | Bacteria | 23029 |
| 122 | Ga0068855_100017339 | 3300005563 | Bacteria | 8665 |
| 123 | Ga0068855_100497731 | 3300005563 | Unclassified | 1325 |
| 124 | Ga0070664_100001432 | 3300005564 | Bacteria | 19026 |
| 125 | Ga0070664_100016011 | 3300005564 | Bacteria | 6143 |
| 126 | Ga0070664_100051351 | 3300005564 | Bacteria | 3491 |
| 127 | Ga0070664_100130188 | 3300005564 | Bacteria | 2210 |
| 128 | Ga0070664_100134498 | 3300005564 | Bacteria | 2173 |
| 129 | Ga0070664_100526060 | 3300005564 | Bacteria | 1092 |
| 130 | Ga0068857_100000356 | 3300005577 | Bacteria | 31874 |
| 131 | Ga0068857_100050020 | 3300005577 | Bacteria | 3708 |
| 132 | Ga0068857_100076689 | 3300005577 | Bacteria | 2981 |
| 133 | Ga0068854_100007214 | 3300005578 | Bacteria | 7097 |
| 134 | Ga0068854_100086611 | 3300005578 | Bacteria | 2323 |
| 135 | Ga0068856_100126498 | 3300005614 | Bacteria | 2559 |
| 136 | Ga0068856_100296308 | 3300005614 | Bacteria | 1635 |
| 137 | Ga0068856_100413995 | 3300005614 | Bacteria | 1368 |
| 138 | Ga0068852_100005832 | 3300005616 | Bacteria | 8844 |
| 139 | Ga0068852_100025667 | 3300005616 | Bacteria | 4777 |
| 140 | Ga0068852_100030124 | 3300005616 | Bacteria | 4464 |
| 141 | Ga0068852_100308835 | 3300005616 | Bacteria | 1533 |
| 142 | Ga0068859_100006842 | 3300005617 | Bacteria | 11583 |
| 143 | Ga0068859_100367748 | 3300005617 | Bacteria | 1533 |
| 144 | Ga0068864_100105509 | 3300005618 | Bacteria | 2504 |
| 145 | Ga0068864_100124045 | 3300005618 | Bacteria | 2312 |
| 146 | Ga0068866_10000069 | 3300005718 | Bacteria | 40892 |
| 147 | Ga0068866_10058572 | 3300005718 | Bacteria | 1990 |
| 148 | Ga0068861_100022430 | 3300005719 | Unclassified | 4549 |
| 149 | Ga0068851_10127024 | 3300005834 | Bacteria | 1376 |
| 150 | Ga0068858_100126379 | 3300005842 | Unclassified | 2395 |
| 151 | Ga0068862_100124231 | 3300005844 | Bacteria | 2277 |
| 152 | Ga0070712_100020311 | 3300006175 | Bacteria | 4346 |
| 153 | Ga0097621_100063602 | 3300006237 | Bacteria | 3033 |
| 154 | Ga0075428_100091397 | 3300006844 | Bacteria | 3320 |
| 155 | Ga0075430_100006281 | 3300006846 | Bacteria | 10023 |
| 156 | Ga0075430_100035238 | 3300006846 | Bacteria | 4247 |
| 157 | Ga0075431_100073370 | 3300006847 | Bacteria | 3530 |
| 158 | Ga0075434_100017286 | 3300006871 | Bacteria | 6946 |
| 159 | Ga0075434_100022791 | 3300006871 | Bacteria | 6098 |
| 160 | Ga0075434_100139367 | 3300006871 | Bacteria | 2445 |
| 161 | Ga0075429_100051333 | 3300006880 | Bacteria | 3589 |
| 162 | Ga0068865_100047716 | 3300006881 | Bacteria | 2944 |
| 163 | Ga0097620_100006842 | 3300006931 | Bacteria | 11583 |
| 164 | Ga0097620_100367739 | 3300006931 | Bacteria | 1533 |
| 165 | Ga0075435_100197035 | 3300007076 | Bacteria | 1706 |
| 166 | Ga0075435_100284069 | 3300007076 | Bacteria | 1413 |
| 167 | Ga0075435_100459063 | 3300007076 | Bacteria | 1099 |
| 168 | Ga0105240_10030293 | 3300009093 | Bacteria | 7032 |
| 169 | Ga0111539_10079978 | 3300009094 | Bacteria | 3845 |
| 170 | Ga0105245_10030649 | 3300009098 | Bacteria | 4757 |
| 171 | Ga0105245_10056982 | 3300009098 | Unclassified | 3514 |
| 172 | Ga0105245_10098428 | 3300009098 | Bacteria | 2702 |
| 173 | Ga0114129_10109937 | 3300009147 | Bacteria | 3805 |
| 174 | Ga0114129_10553021 | 3300009147 | Bacteria | 1496 |
| 175 | Ga0114129_10688811 | 3300009147 | Bacteria | 1315 |
| 176 | Ga0105243_10102681 | 3300009148 | Bacteria | 2376 |
| 177 | Ga0105241_10041960 | 3300009174 | Bacteria | 3459 |
| 178 | Ga0105242_10002701 | 3300009176 | Bacteria | 13877 |
| 179 | Ga0105248_10000553 | 3300009177 | Bacteria | 42444 |
| 180 | Ga0105248_10285525 | 3300009177 | Unclassified | 1858 |
| 181 | Ga0105238_10022967 | 3300009551 | Bacteria | 6358 |
| 182 | Ga0105238_10080977 | 3300009551 | Bacteria | 3236 |
| 183 | Ga0105239_10042753 | 3300010375 | Bacteria | 4965 |
| 184 | Ga0157373_10011898 | 3300013100 | Bacteria | 6392 |
| 185 | Ga0157373_10035030 | 3300013100 | Bacteria | 3605 |
| 186 | Ga0157371_10006820 | 3300013102 | Bacteria | 9332 |
| 187 | Ga0157370_10046177 | 3300013104 | Bacteria | 4176 |
| 188 | Ga0157369_10010539 | 3300013105 | Bacteria | 10519 |
| 189 | Ga0157369_10012404 | 3300013105 | Bacteria | 9674 |
| 190 | Ga0157369_10093706 | 3300013105 | Bacteria | 3205 |
| 191 | Ga0157369_10205921 | 3300013105 | Bacteria | 2063 |
| 192 | Ga0157374_10032888 | 3300013296 | Bacteria | 4727 |
| 193 | Ga0157378_10024116 | 3300013297 | Bacteria | 5351 |
| 194 | Ga0157378_10110395 | 3300013297 | Bacteria | 2521 |
| 195 | Ga0163162_10068549 | 3300013306 | Bacteria | 3599 |
| 196 | Ga0163162_10088838 | 3300013306 | Bacteria | 3170 |
| 197 | Ga0157372_10013674 | 3300013307 | Bacteria | 8674 |
| 198 | Ga0157372_10014644 | 3300013307 | Bacteria | 8390 |
| 199 | Ga0157372_10027724 | 3300013307 | Bacteria | 6173 |
| 200 | Ga0157372_10047288 | 3300013307 | Bacteria | 4780 |
| 201 | Ga0157372_10068787 | 3300013307 | Bacteria | 3981 |
| 202 | Ga0157372_10073978 | 3300013307 | Bacteria | 3841 |
| 203 | Ga0157372_10133149 | 3300013307 | Bacteria | 2862 |
| 204 | Ga0157372_10651514 | 3300013307 | Bacteria | 1226 |
| 205 | Ga0157375_10036261 | 3300013308 | Bacteria | 4716 |
| 206 | Ga0157375_10120780 | 3300013308 | Bacteria | 2729 |
| 207 | Ga0157375_10142680 | 3300013308 | Bacteria | 2523 |
| 208 | Ga0163163_10006004 | 3300014325 | Bacteria | 10566 |
| 209 | Ga0157380_10019696 | 3300014326 | Bacteria | 5033 |
| 210 | Ga0157380_10122824 | 3300014326 | Unclassified | 2202 |
| 211 | Ga0157380_10261827 | 3300014326 | Bacteria | 1571 |
| 212 | Ga0182008_10000770 | 3300014497 | Bacteria | 22485 |
| 213 | Ga0157377_10079634 | 3300014745 | Bacteria | 1912 |
| 214 | Ga0157379_10036860 | 3300014968 | Bacteria | 4360 |
| 215 | Ga0182007_10010691 | 3300015262 | Bacteria | 3612 |
| 216 | Ga0206353_11313939 | 3300020082 | Bacteria | 1906 |
| 217 | Ga0213876_10002895 | 3300021384 | Bacteria | 9967 |
| 218 | Ga0209674_101135 | 3300025226 | Bacteria | 7739 |
| 219 | Ga0207427_100134 | 3300025231 | Bacteria | 91077 |
| 220 | Ga0207427_100656 | 3300025231 | Bacteria | 16685 |
| 221 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 222 | Ga0209437_100200 | 3300025233 | Bacteria | 119306 |
| 223 | Ga0209026_1000017 | 3300025250 | Bacteria | 385214 |
| 224 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 225 | Ga0209233_1000193 | 3300025261 | Bacteria | 126812 |
| 226 | Ga0207656_10133798 | 3300025321 | Bacteria | 1163 |
| 227 | Ga0207699_10006412 | 3300025906 | Bacteria | 5695 |
| 228 | Ga0207699_10017589 | 3300025906 | Bacteria | 3767 |
| 229 | Ga0207645_10000122 | 3300025907 | Bacteria | 58946 |
| 230 | Ga0207645_10003450 | 3300025907 | Bacteria | 12009 |
| 231 | Ga0207645_10053606 | 3300025907 | Bacteria | 2577 |
| 232 | Ga0207643_10001798 | 3300025908 | Bacteria | 11922 |
| 233 | Ga0207643_10031666 | 3300025908 | Bacteria | 2950 |
| 234 | Ga0207705_10076617 | 3300025909 | Bacteria | 2432 |
| 235 | Ga0207705_10080073 | 3300025909 | Bacteria | 2380 |
| 236 | Ga0207705_10095823 | 3300025909 | Bacteria | 2178 |
| 237 | Ga0207705_10145629 | 3300025909 | Bacteria | 1772 |
| 238 | Ga0207684_10081736 | 3300025910 | Bacteria | 2750 |
| 239 | Ga0207707_10000583 | 3300025912 | Bacteria | 37074 |
| 240 | Ga0207707_10001488 | 3300025912 | Bacteria | 21644 |
| 241 | Ga0207707_10012238 | 3300025912 | Bacteria | 7459 |
| 242 | Ga0207707_10012431 | 3300025912 | Bacteria | 7401 |
| 243 | Ga0207707_10015396 | 3300025912 | Bacteria | 6662 |
| 244 | Ga0207707_10016173 | 3300025912 | Bacteria | 6509 |
| 245 | Ga0207707_10034668 | 3300025912 | Bacteria | 4415 |
| 246 | Ga0207707_10079337 | 3300025912 | Bacteria | 2866 |
| 247 | Ga0207707_10222341 | 3300025912 | Bacteria | 1644 |
| 248 | Ga0207695_10207702 | 3300025913 | Bacteria | 1870 |
| 249 | Ga0207671_10415162 | 3300025914 | Bacteria | 1071 |
| 250 | Ga0207693_10008288 | 3300025915 | Bacteria | 8509 |
| 251 | Ga0207693_10017450 | 3300025915 | Bacteria | 5725 |
| 252 | Ga0207663_10070036 | 3300025916 | Bacteria | 2258 |
| 253 | Ga0207660_10001988 | 3300025917 | Bacteria | 13621 |
| 254 | Ga0207660_10011444 | 3300025917 | Bacteria | 5776 |
| 255 | Ga0207660_10012132 | 3300025917 | Bacteria | 5631 |
| 256 | Ga0207660_10046321 | 3300025917 | Bacteria | 3068 |
| 257 | Ga0207660_10382156 | 3300025917 | Bacteria | 1132 |
| 258 | Ga0207657_10017664 | 3300025919 | Bacteria | 6836 |
| 259 | Ga0207657_10035171 | 3300025919 | Bacteria | 4495 |
| 260 | Ga0207657_10237593 | 3300025919 | Bacteria | 1456 |
| 261 | Ga0207649_10003595 | 3300025920 | Bacteria | 8470 |
| 262 | Ga0207649_10004384 | 3300025920 | Bacteria | 7659 |
| 263 | Ga0207649_10077084 | 3300025920 | Bacteria | 2147 |
| 264 | Ga0207649_10229308 | 3300025920 | Bacteria | 1327 |
| 265 | Ga0207652_10001470 | 3300025921 | Bacteria | 20851 |
| 266 | Ga0207652_10004128 | 3300025921 | Bacteria | 11856 |
| 267 | Ga0207652_10009917 | 3300025921 | Bacteria | 7666 |
| 268 | Ga0207652_10014428 | 3300025921 | Bacteria | 6400 |
| 269 | Ga0207652_10028743 | 3300025921 | Bacteria | 4641 |
| 270 | Ga0207652_10041231 | 3300025921 | Bacteria | 3923 |
| 271 | Ga0207652_10051125 | 3300025921 | Bacteria | 3542 |
| 272 | Ga0207652_10129676 | 3300025921 | Unclassified | 2248 |
| 273 | Ga0207652_10312725 | 3300025921 | Unclassified | 1418 |
| 274 | Ga0207652_10373285 | 3300025921 | Bacteria | 1287 |
| 275 | Ga0207646_10042279 | 3300025922 | Bacteria | 4094 |
| 276 | Ga0207646_10125538 | 3300025922 | Bacteria | 2307 |
| 277 | Ga0207681_10006238 | 3300025923 | Bacteria | 7312 |
| 278 | Ga0207694_10031485 | 3300025924 | Bacteria | 4053 |
| 279 | Ga0207650_10003064 | 3300025925 | Bacteria | 11518 |
| 280 | Ga0207650_10297902 | 3300025925 | Bacteria | 1316 |
| 281 | Ga0207659_10006807 | 3300025926 | Bacteria | 7026 |
| 282 | Ga0207700_10000529 | 3300025928 | Bacteria | 22476 |
| 283 | Ga0207700_10001431 | 3300025928 | Bacteria | 13532 |
| 284 | Ga0207664_10009705 | 3300025929 | Bacteria | 6767 |
| 285 | Ga0207664_10015952 | 3300025929 | Bacteria | 5471 |
| 286 | Ga0207664_10089627 | 3300025929 | Bacteria | 2519 |
| 287 | Ga0207690_10002250 | 3300025932 | Bacteria | 11770 |
| 288 | Ga0207690_10009509 | 3300025932 | Bacteria | 5775 |
| 289 | Ga0207690_10077845 | 3300025932 | Bacteria | 2306 |
| 290 | Ga0207690_10146917 | 3300025932 | Bacteria | 1744 |
| 291 | Ga0207706_10000025 | 3300025933 | Bacteria | 150958 |
| 292 | Ga0207706_10330581 | 3300025933 | Bacteria | 1326 |
| 293 | Ga0207686_10000686 | 3300025934 | Bacteria | 21009 |
| 294 | Ga0207686_10036320 | 3300025934 | Unclassified | 2965 |
| 295 | Ga0207669_10000317 | 3300025937 | Bacteria | 22016 |
| 296 | Ga0207704_10013066 | 3300025938 | Bacteria | 4143 |
| 297 | Ga0207665_10000337 | 3300025939 | Bacteria | 32435 |
| 298 | Ga0207691_10002572 | 3300025940 | Bacteria | 17729 |
| 299 | Ga0207691_10004930 | 3300025940 | Bacteria | 12882 |
| 300 | Ga0207691_10030204 | 3300025940 | Bacteria | 5065 |
| 301 | Ga0207691_10053494 | 3300025940 | Bacteria | 3686 |
| 302 | Ga0207711_10002951 | 3300025941 | Bacteria | 14875 |
| 303 | Ga0207711_10086900 | 3300025941 | Bacteria | 2742 |
| 304 | Ga0207689_10547667 | 3300025942 | Bacteria | 972 |
| 305 | Ga0207661_10002524 | 3300025944 | Bacteria | 12595 |
| 306 | Ga0207661_10013320 | 3300025944 | Bacteria | 6006 |
| 307 | Ga0207661_10027382 | 3300025944 | Bacteria | 4354 |
| 308 | Ga0207661_10234176 | 3300025944 | Bacteria | 1627 |
| 309 | Ga0207679_10002534 | 3300025945 | Bacteria | 11258 |
| 310 | Ga0207679_10007502 | 3300025945 | Bacteria | 6923 |
| 311 | Ga0207679_10010275 | 3300025945 | Bacteria | 6023 |
| 312 | Ga0207679_10051669 | 3300025945 | Bacteria | 3010 |
| 313 | Ga0207679_10112302 | 3300025945 | Bacteria | 2153 |
| 314 | Ga0207679_10171019 | 3300025945 | Bacteria | 1789 |
| 315 | Ga0207679_10328120 | 3300025945 | Bacteria | 1327 |
| 316 | Ga0207667_10057724 | 3300025949 | Bacteria | 4073 |
| 317 | Ga0207667_10059647 | 3300025949 | Bacteria | 3995 |
| 318 | Ga0207667_10424681 | 3300025949 | Bacteria | 1352 |
| 319 | Ga0207651_10024463 | 3300025960 | Bacteria | 3736 |
| 320 | Ga0207712_10153227 | 3300025961 | Bacteria | 1783 |
| 321 | Ga0207712_10489983 | 3300025961 | Bacteria | 1049 |
| 322 | Ga0207668_10184636 | 3300025972 | Bacteria | 1648 |
| 323 | Ga0207640_10010347 | 3300025981 | Bacteria | 5253 |
| 324 | Ga0207658_10035149 | 3300025986 | Bacteria | 3588 |
| 325 | Ga0207658_10140280 | 3300025986 | Unclassified | 1955 |
| 326 | Ga0207677_10032481 | 3300026023 | Bacteria | 3356 |
| 327 | Ga0207639_10050387 | 3300026041 | Bacteria | 3162 |
| 328 | Ga0207639_10063874 | 3300026041 | Bacteria | 2852 |
| 329 | Ga0207678_10020134 | 3300026067 | Bacteria | 5859 |
| 330 | Ga0207678_10148420 | 3300026067 | Bacteria | 2001 |
| 331 | Ga0207708_10027300 | 3300026075 | Bacteria | 4321 |
| 332 | Ga0207708_10054179 | 3300026075 | Bacteria | 3058 |
| 333 | Ga0207708_10076639 | 3300026075 | Bacteria | 2565 |
| 334 | Ga0207702_10043357 | 3300026078 | Bacteria | 3777 |
| 335 | Ga0207702_10525068 | 3300026078 | Bacteria | 1156 |
| 336 | Ga0207641_10212229 | 3300026088 | Bacteria | 1791 |
| 337 | Ga0207648_10000138 | 3300026089 | Bacteria | 72558 |
| 338 | Ga0207648_10022381 | 3300026089 | Bacteria | 5677 |
| 339 | Ga0207648_10089690 | 3300026089 | Bacteria | 2686 |
| 340 | Ga0207648_10187247 | 3300026089 | Bacteria | 1833 |
| 341 | Ga0207674_10000477 | 3300026116 | Bacteria | 52707 |
| 342 | Ga0207674_10000761 | 3300026116 | Bacteria | 42085 |
| 343 | Ga0207674_10026085 | 3300026116 | Bacteria | 6217 |
| 344 | Ga0207674_10027590 | 3300026116 | Bacteria | 6004 |
| 345 | Ga0207675_100044595 | 3300026118 | Bacteria | 4144 |
| 346 | Ga0207683_10008478 | 3300026121 | Bacteria | 8796 |
| 347 | Ga0207683_10356181 | 3300026121 | Bacteria | 1344 |
| 348 | Ga0207698_10102856 | 3300026142 | Bacteria | 2372 |
| 349 | Ga0209969_1003052 | 3300027360 | Unclassified | 2315 |
| 350 | Ga0209967_1003644 | 3300027364 | Bacteria | 2031 |
| 351 | Ga0210000_1011034 | 3300027462 | Bacteria | 1337 |
| 352 | Ga0209966_1003067 | 3300027695 | Unclassified | 2803 |
| 353 | Ga0268266_10055399 | 3300028379 | Bacteria | 3409 |
| 354 | Ga0265332_10013540 | 3300031238 | Bacteria | 3613 |
| 355 | Ga0265327_10081599 | 3300031251 | Bacteria | 1596 |
| 356 | Ga0307408_100008051 | 3300031548 | Bacteria | 6968 |
| 357 | Ga0307408_100027190 | 3300031548 | Bacteria | 3940 |
| 358 | Ga0307408_100092000 | 3300031548 | Bacteria | 2292 |
| 359 | Ga0307408_100117829 | 3300031548 | Bacteria | 2052 |
| 360 | Ga0265314_10023891 | 3300031711 | Bacteria | 4647 |
| 361 | Ga0265314_10072218 | 3300031711 | Bacteria | 2306 |
| 362 | Ga0265342_10191723 | 3300031712 | Bacteria | 1115 |
| 363 | Ga0307405_10008799 | 3300031731 | Bacteria | 5140 |
| 364 | Ga0307405_10009049 | 3300031731 | Bacteria | 5087 |
| 365 | Ga0307405_10085742 | 3300031731 | Bacteria | 2071 |
| 366 | Ga0307405_10137272 | 3300031731 | Bacteria | 1699 |
| 367 | Ga0307405_10247617 | 3300031731 | Bacteria | 1324 |
| 368 | Ga0307413_10000895 | 3300031824 | Bacteria | 10542 |
| 369 | Ga0307413_10078198 | 3300031824 | Bacteria | 2110 |
| 370 | Ga0307413_10136295 | 3300031824 | Bacteria | 1688 |
| 371 | Ga0307410_10003621 | 3300031852 | Bacteria | 7788 |
| 372 | Ga0307410_10033129 | 3300031852 | Bacteria | 3333 |
| 373 | Ga0307410_10096474 | 3300031852 | Bacteria | 2110 |
| 374 | Ga0307410_10140067 | 3300031852 | Bacteria | 1788 |
| 375 | Ga0307410_10149064 | 3300031852 | Bacteria | 1739 |
| 376 | Ga0307410_10171805 | 3300031852 | Bacteria | 1634 |
| 377 | Ga0307406_10003655 | 3300031901 | Bacteria | 8379 |
| 378 | Ga0307406_10004115 | 3300031901 | Bacteria | 7918 |
| 379 | Ga0307406_10004952 | 3300031901 | Bacteria | 7258 |
| 380 | Ga0307406_10280815 | 3300031901 | Bacteria | 1270 |
| 381 | Ga0307407_10014966 | 3300031903 | Bacteria | 3815 |
| 382 | Ga0307407_10020047 | 3300031903 | Bacteria | 3417 |
| 383 | Ga0307407_10133188 | 3300031903 | Bacteria | 1593 |
| 384 | Ga0307412_10014508 | 3300031911 | Bacteria | 4647 |
| 385 | Ga0307412_10055616 | 3300031911 | Bacteria | 2633 |
| 386 | Ga0307409_100115906 | 3300031995 | Bacteria | 2257 |
| 387 | Ga0307409_100136003 | 3300031995 | Bacteria | 2109 |
| 388 | Ga0307409_100140988 | 3300031995 | Bacteria | 2077 |
| 389 | Ga0307409_100164568 | 3300031995 | Bacteria | 1944 |
| 390 | Ga0307409_100235026 | 3300031995 | Bacteria | 1664 |
| 391 | Ga0307409_100365380 | 3300031995 | Bacteria | 1366 |
| 392 | Ga0307409_100468594 | 3300031995 | Bacteria | 1219 |
| 393 | Ga0307416_100005463 | 3300032002 | Bacteria | 7806 |
| 394 | Ga0307416_100031678 | 3300032002 | Bacteria | 3984 |
| 395 | Ga0307416_100103057 | 3300032002 | Bacteria | 2490 |
| 396 | Ga0307416_100103542 | 3300032002 | Bacteria | 2485 |
| 397 | Ga0307416_100127391 | 3300032002 | Bacteria | 2283 |
| 398 | Ga0307416_100423096 | 3300032002 | Bacteria | 1377 |
| 399 | Ga0307414_10003471 | 3300032004 | Bacteria | 8422 |
| 400 | Ga0307414_10012092 | 3300032004 | Bacteria | 5092 |
| 401 | Ga0307414_10022178 | 3300032004 | Bacteria | 4000 |
| 402 | Ga0307411_10009578 | 3300032005 | Bacteria | 5106 |
| 403 | Ga0307411_10011083 | 3300032005 | Bacteria | 4843 |
| 404 | Ga0307411_10213575 | 3300032005 | Bacteria | 1491 |
| 405 | Ga0307415_100003013 | 3300032126 | Bacteria | 8477 |
| 406 | Ga0307415_100056355 | 3300032126 | Bacteria | 2694 |
| 407 | Ga0307415_100063272 | 3300032126 | Bacteria | 2570 |
| 408 | Ga0307415_100130980 | 3300032126 | Bacteria | 1898 |
| 409 | Ga0307415_100288031 | 3300032126 | Bacteria | 1354 |
| 410 | Ga0373934_0000075 | 3300035086 | Bacteria | 34357 |
| 411 | Ga0373934_0002058 | 3300035086 | Bacteria | 7389 |
| 412 | Ga0373923_0007561 | 3300035111 | Bacteria | 3829 |
| 413 | Ga0373923_0007802 | 3300035111 | Bacteria | 3781 |
| 414 | Ga0373939_0095242 | 3300035114 | Bacteria | 1013 |
| 415 | Ga0373953_0009868 | 3300035117 | Bacteria | 3305 |
| 416 | Ga0373953_0011271 | 3300035117 | Bacteria | 3134 |
| 417 | Ga0373956_0000547 | 3300035119 | Bacteria | 15386 |
| 418 | Ga0373957_0004601 | 3300035120 | Bacteria | 4209 |
| 419 | Ga0373943_0011335 | 3300035170 | Bacteria | 4010 |
| 420 | Ga0373943_0061323 | 3300035170 | Bacteria | 1880 |
| 421 | Ga0373946_0075218 | 3300035171 | Bacteria | 1467 |
| 422 | Ga0373955_0000669 | 3300035172 | Bacteria | 14619 |
| 423 | Ga0373924_0001752 | 3300035410 | Bacteria | 7161 |
| 424 | Ga0373931_0092342 | 3300035691 | Bacteria | 1688 |
| 425 | Ga0373935_0042868 | 3300035692 | Bacteria | 2846 |
| 426 | Ga0373927_0004259 | 3300035695 | Bacteria | 10045 |
| 427 | Ga0373933_0000070 | 3300035724 | Bacteria | 62610 |
| 428 | Ga0373947_0000105 | 3300035725 | Bacteria | 41920 |
| 429 | Ga0373947_0066314 | 3300035725 | Bacteria | 2203 |
| 430 | Ga0373937_0000153 | 3300036401 | Bacteria | 66867 |
| 431 | Ga0373937_0046193 | 3300036401 | Bacteria | 3981 |
| 432 | Ga0373937_0070839 | 3300036401 | Bacteria | 3216 |
| 433 | Ga0373937_0166201 | 3300036401 | Bacteria | 2069 |
| 434 | Ga0373925_0004451 | 3300037068 | Bacteria | 10589 |
| 435 | Ga0373925_0017735 | 3300037068 | Bacteria | 5166 |
| 436 | Ga0395898_0087257 | 3300037466 | Bacteria | 3006 |
| 437 | Ga0395905_0026729 | 3300037471 | Bacteria | 5442 |
| 438 | Ga0436365_1447060 | 3300039437 | Bacteria | 2645 |
| 439 | Ga0436365_1476038 | 3300039437 | Unclassified | 2145 |
| 440 | Ga0436365_1566279 | 3300039437 | Bacteria | 9364 |
| 441 | Ga0451793_0510102 | 3300041452 | Bacteria | 3989 |
| 442 | Ga0451577_0000001 | 3300042876 | Bacteria | 2461803 |
| 443 | Ga0451577_0006931 | 3300042876 | Bacteria | 11200 |
| 444 | Ga0451577_0183988 | 3300042876 | Bacteria | 1884 |
| 445 | Ga0466982_0000012 | 3300044672 | Bacteria | 166823 |
| 446 | Ga0466961_0093273 | 3300044693 | Unclassified | 1900 |
| 447 | Ga0466964_0157256 | 3300044706 | Bacteria | 1059 |
| 448 | Ga0453684_0000294 | 3300044712 | Bacteria | 212051 |
| 449 | Ga0453684_0165009 | 3300044712 | Bacteria | 2616 |
| 450 | Ga0466958_0076987 | 3300045836 | Bacteria | 2048 |
| 451 | Ga0495592_0002999 | 3300046454 | Bacteria | 12010 |
| 452 | Ga0495590_0018935 | 3300046457 | Bacteria | 2458 |
| 453 | Ga0495629_0017108 | 3300046459 | Bacteria | 5200 |
| 454 | Ga0495629_0022218 | 3300046459 | Bacteria | 4524 |
| 455 | Ga0495638_0000106 | 3300046460 | Bacteria | 133921 |
| 456 | Ga0495651_0000116 | 3300046462 | Bacteria | 59001 |
| 457 | Ga0495653_0000160 | 3300046463 | Bacteria | 55860 |
| 458 | Ga0495653_0020548 | 3300046463 | Bacteria | 5352 |
| 459 | Ga0495580_0007476 | 3300046472 | Bacteria | 8780 |
| 460 | Ga0495580_0007638 | 3300046472 | Bacteria | 8673 |
| 461 | Ga0495580_0128236 | 3300046472 | Bacteria | 1760 |
| 462 | Ga0495582_0006709 | 3300046473 | Bacteria | 6396 |
| 463 | Ga0495639_0000274 | 3300046475 | Bacteria | 25461 |
| 464 | Ga0495585_0176088 | 3300046492 | Bacteria | 1102 |
| 465 | Ga0495594_0005911 | 3300046499 | Bacteria | 6288 |
| 466 | Ga0495608_0000141 | 3300046511 | Bacteria | 52164 |
| 467 | Ga0495608_0012711 | 3300046511 | Bacteria | 5841 |
| 468 | Ga0495608_0192428 | 3300046511 | Unclassified | 1287 |
| 469 | Ga0495618_0022042 | 3300046514 | Bacteria | 3931 |
| 470 | Ga0495618_0078577 | 3300046514 | Bacteria | 2103 |
| 471 | Ga0495628_0000113 | 3300046516 | Bacteria | 65741 |
| 472 | Ga0495630_0007174 | 3300046517 | Bacteria | 7945 |
| 473 | Ga0495630_0008764 | 3300046517 | Bacteria | 7265 |
| 474 | Ga0495630_0023200 | 3300046517 | Bacteria | 4586 |
| 475 | Ga0495666_0012944 | 3300046526 | Bacteria | 4157 |
| 476 | Ga0495652_0002191 | 3300046529 | Bacteria | 20522 |
| 477 | Ga0495652_0002828 | 3300046529 | Bacteria | 17476 |
| 478 | Ga0495665_0000167 | 3300046531 | Bacteria | 33230 |
| 479 | Ga0495665_0210652 | 3300046531 | Bacteria | 1006 |
| 480 | Ga0495586_0015045 | 3300046535 | Bacteria | 4114 |
| 481 | Ga0495587_0000193 | 3300046536 | Bacteria | 45053 |
| 482 | Ga0495587_0001170 | 3300046536 | Bacteria | 17292 |
| 483 | Ga0495645_0000547 | 3300046543 | Bacteria | 25829 |
| 484 | Ga0495645_0000653 | 3300046543 | Bacteria | 23880 |
| 485 | Ga0495645_0137036 | 3300046543 | Unclassified | 1711 |
| 486 | Ga0495645_0187764 | 3300046543 | Bacteria | 1411 |
| 487 | Ga0495622_0056461 | 3300046557 | Bacteria | 1821 |
| 488 | Ga0495667_0003688 | 3300046559 | Bacteria | 10302 |
| 489 | Ga0495667_0030412 | 3300046559 | Bacteria | 3628 |
| 490 | Ga0495635_0000064 | 3300046663 | Bacteria | 65195 |
| 491 | Ga0495588_0003715 | 3300046674 | Bacteria | 6683 |
| 492 | Ga0495657_0001394 | 3300046675 | Bacteria | 20946 |
| 493 | Ga0495599_0003528 | 3300046678 | Bacteria | 9157 |
| 494 | Ga0495599_0003800 | 3300046678 | Bacteria | 8865 |
| 495 | Ga0495623_0000017 | 3300046679 | Bacteria | 108556 |
| 496 | Ga0495623_0028000 | 3300046679 | Bacteria | 3627 |
| 497 | Ga0495646_0002392 | 3300046680 | Bacteria | 11510 |
| 498 | Ga0495658_0000575 | 3300046683 | Bacteria | 20030 |
| 499 | Ga0495600_0000063 | 3300046809 | Bacteria | 61349 |
| 500 | Ga0495581_0155030 | 3300047315 | Bacteria | 1339 |
| 501 | Ga0495604_0000017 | 3300047317 | Bacteria | 192029 |
| 502 | Ga0495604_0018743 | 3300047317 | Bacteria | 5540 |
| 503 | Ga0495636_0039180 | 3300047318 | Bacteria | 1962 |
| 504 | Ga0495674_0004424 | 3300047319 | Bacteria | 13514 |
| 505 | Ga0495672_0004112 | 3300047320 | Bacteria | 12116 |
| 506 | Ga0495680_0001679 | 3300047322 | Bacteria | 23534 |
| 507 | Ga0495675_0001138 | 3300047444 | Bacteria | 16160 |
| 508 | Ga0495675_0038535 | 3300047444 | Unclassified | 3043 |
| 509 | Ga0495675_0041056 | 3300047444 | Bacteria | 2948 |
| 510 | Ga0495675_0099853 | 3300047444 | Bacteria | 1817 |
| 511 | Ga0495684_0000095 | 3300047471 | Bacteria | 62460 |
| 512 | Ga0495593_0000143 | 3300047673 | Bacteria | 34902 |
| 513 | Ga0495602_0000688 | 3300048088 | Bacteria | 31774 |
| 514 | Ga0495602_0048060 | 3300048088 | Bacteria | 3839 |
| 515 | Ga0495602_0061120 | 3300048088 | Bacteria | 3278 |
| 516 | Ga0495614_0000161 | 3300048089 | Bacteria | 24540 |
| 517 | Ga0496101_0143272 | 3300048904 | Bacteria | 1823 |
| 518 | Ga0496101_0502356 | 3300048904 | Bacteria | 958 |
| 519 | Ga0496102_0798001 | 3300048905 | Unclassified | 866 |
| 520 | Ga0496104_0278796 | 3300048907 | Bacteria | 1585 |
| 521 | Ga0496104_0370405 | 3300048907 | Bacteria | 1345 |
| 522 | Ga0496108_0102276 | 3300048911 | Bacteria | 2445 |
| 523 | Ga0496109_0032090 | 3300048912 | Bacteria | 4718 |
| 524 | Ga0496109_0388215 | 3300048912 | Bacteria | 1319 |
| 525 | Ga0496112_0005678 | 3300048915 | Bacteria | 10839 |
| 526 | Ga0496112_0055567 | 3300048915 | Bacteria | 3893 |
| 527 | Ga0496113_0081087 | 3300048916 | Bacteria | 2486 |
| 528 | Ga0496114_0119024 | 3300048917 | Bacteria | 2270 |
| 529 | Ga0496115_0003739 | 3300048918 | Bacteria | 10943 |
| 530 | Ga0496115_0071828 | 3300048918 | Bacteria | 2807 |
| 531 | Ga0501031_0101932 | 3300049568 | Bacteria | 1873 |
| 532 | Ga0501031_0120791 | 3300049568 | Bacteria | 1711 |
| 533 | Ga0501031_0155984 | 3300049568 | Bacteria | 1492 |
| 534 | Ga0501032_0075454 | 3300049569 | Bacteria | 2246 |
| 535 | Ga0501033_0041493 | 3300049570 | Bacteria | 3433 |
| 536 | Ga0501033_0122675 | 3300049570 | Bacteria | 1885 |
| 537 | Ga0501034_0005074 | 3300049571 | Bacteria | 14463 |
| 538 | Ga0501034_0014900 | 3300049571 | Bacteria | 7995 |
| 539 | Ga0501034_0047216 | 3300049571 | Bacteria | 4350 |
| 540 | Ga0501034_0149448 | 3300049571 | Bacteria | 2312 |
| 541 | Ga0501034_0483728 | 3300049571 | Bacteria | 1153 |
| 542 | Ga0501037_0264796 | 3300049573 | Bacteria | 1201 |
| 543 | Ga0501038_0297272 | 3300049574 | Bacteria | 1268 |
| 544 | Ga0501038_0323138 | 3300049574 | Bacteria | 1207 |
| 545 | Ga0501039_0031298 | 3300049575 | Bacteria | 4101 |
| 546 | Ga0501040_0061264 | 3300049576 | Bacteria | 2587 |
| 547 | Ga0501040_0076455 | 3300049576 | Bacteria | 2315 |
| 548 | Ga0501041_0132068 | 3300049577 | Bacteria | 1555 |
| 549 | Ga0501043_0119960 | 3300049579 | Bacteria | 2062 |
| 550 | Ga0501043_0187678 | 3300049579 | Bacteria | 1609 |
| 551 | Ga0501046_0102966 | 3300049580 | Bacteria | 2189 |
| 552 | Ga0501046_0241602 | 3300049580 | Bacteria | 1332 |
| 553 | Ga0501047_0383632 | 3300049581 | Bacteria | 1239 |
| 554 | Ga0501067_0002954 | 3300049583 | Bacteria | 9379 |
| 555 | Ga0501067_0050810 | 3300049583 | Unclassified | 2298 |
| 556 | Ga0501068_0000074 | 3300049584 | Bacteria | 39863 |
| 557 | Ga0501068_0001594 | 3300049584 | Bacteria | 12075 |
| 558 | Ga0501068_0186584 | 3300049584 | Bacteria | 1312 |
| 559 | Ga0501070_0024348 | 3300049586 | Bacteria | 5078 |
| 560 | Ga0501070_0026407 | 3300049586 | Bacteria | 4870 |
| 561 | Ga0501070_0034008 | 3300049586 | Bacteria | 4264 |
| 562 | Ga0501070_0139753 | 3300049586 | Bacteria | 2000 |
| 563 | Ga0501070_0250891 | 3300049586 | Bacteria | 1447 |
| 564 | Ga0501071_0000681 | 3300049587 | Bacteria | 17772 |
| 565 | Ga0501071_0015162 | 3300049587 | Bacteria | 5286 |
| 566 | Ga0501072_0001150 | 3300049588 | Bacteria | 19668 |
| 567 | Ga0501072_0122008 | 3300049588 | Bacteria | 2076 |
| 568 | Ga0501073_0039337 | 3300049589 | Bacteria | 3350 |
| 569 | Ga0501073_0087885 | 3300049589 | Bacteria | 2161 |
| 570 | Ga0501074_0000195 | 3300049590 | Bacteria | 32910 |
| 571 | Ga0501074_0488565 | 3300049590 | Unclassified | 872 |
| 572 | Ga0501075_0121160 | 3300049591 | Bacteria | 1991 |
| 573 | Ga0501075_0170213 | 3300049591 | Bacteria | 1662 |
| 574 | Ga0501076_0084236 | 3300049592 | Bacteria | 2554 |
| 575 | Ga0501076_0433835 | 3300049592 | Bacteria | 1081 |
| 576 | Ga0501077_0084236 | 3300049593 | Bacteria | 2015 |
| 577 | Ga0501077_0202105 | 3300049593 | Bacteria | 1262 |
| 578 | Ga0501079_0024821 | 3300049741 | Bacteria | 4599 |
| 579 | Ga0501080_0016056 | 3300049742 | Bacteria | 6911 |
| 580 | Ga0501080_0112794 | 3300049742 | Bacteria | 2520 |
| 581 | Ga0501080_0151688 | 3300049742 | Bacteria | 2142 |
| 582 | Ga0501080_0207286 | 3300049742 | Bacteria | 1797 |
| 583 | Ga0501080_0463557 | 3300049742 | Bacteria | 1135 |
| 584 | Ga0501081_0032545 | 3300049743 | Bacteria | 3537 |
| 585 | Ga0501081_0193605 | 3300049743 | Bacteria | 1473 |
| 586 | Ga0501083_0003815 | 3300049744 | Bacteria | 10588 |
| 587 | Ga0501083_0004745 | 3300049744 | Bacteria | 9602 |
| 588 | Ga0501044_0027201 | 3300049823 | Bacteria | 6047 |
| 589 | Ga0501044_0315051 | 3300049823 | Bacteria | 1490 |
| 590 | Ga0501045_0094400 | 3300049824 | Bacteria | 2212 |
| 591 | Ga0501045_0293250 | 3300049824 | Bacteria | 1210 |
| 592 | nmdc:mga0qj67_12034_c1 | 3300050509 | Bacteria | 6503 |
| 593 | nmdc:mga0qj67_12394_c1 | 3300050509 | Bacteria | 6422 |
| 594 | nmdc:mga06r32_239985_c1 | 3300050510 | Bacteria | 1800 |
| 595 | nmdc:mga08y16_24786_c1 | 3300050511 | Bacteria | 6330 |
| 596 | nmdc:mga0n895_46894_c1 | 3300050512 | Bacteria | 4223 |
| 597 | nmdc:mga0n895_65262_c1 | 3300050512 | Bacteria | 3603 |
| 598 | nmdc:mga0rr50_417148_c1 | 3300050513 | Bacteria | 1135 |
| 599 | nmdc:mga08x19_263719_c1 | 3300050514 | Bacteria | 1191 |
| 600 | nmdc:mga08x19_61796_c1 | 3300050514 | Bacteria | 2428 |
| 601 | nmdc:mga0a205_119051_c1 | 3300050515 | Bacteria | 2539 |
| 602 | Ga0495601_0112050 | 3300053077 | Bacteria | 1767 |
| 603 | Ga0495612_0024619 | 3300053078 | Unclassified | 2416 |
| 604 | Ga0495612_0025707 | 3300053078 | Bacteria | 2364 |
| 605 | Ga0495595_0023999 | 3300053084 | Bacteria | 2690 |
| 606 | Ga0495619_0001382 | 3300053085 | Bacteria | 15960 |
| 607 | Ga0495619_0051986 | 3300053085 | Bacteria | 2708 |
| 608 | Ga0495619_0093492 | 3300053085 | Unclassified | 2038 |
| 609 | Ga0501084_0305159 | 3300054114 | Bacteria | 1344 |
| 610 | Ga0501084_0322691 | 3300054114 | Unclassified | 1304 |
| 611 | Ga0501082_0027373 | 3300060353 | Bacteria | 4907 |
| 612 | Ga0501082_0029763 | 3300060353 | Bacteria | 4704 |
| 613 | Ga0501082_0052797 | 3300060353 | Bacteria | 3504 |
| 614 | Ga0501082_0072225 | 3300060353 | Bacteria | 2972 |
| 615 | Ga0530510_0435586 | 3300061734 | Bacteria | 990 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049590 | Ga0501074_0488565 | Ga0501074_0488565_11_742 | 238 |
| 2 | 3300054114 | Ga0501084_0305159 | Ga0501084_0305159_58_798 | 241 |
| 3 | 3300049742 | Ga0501080_0016056 | Ga0501080_0016056_5167_6063 | 257 |
| 4 | 3300054114 | Ga0501084_0322691 | Ga0501084_0322691_11_907 | 257 |
| 5 | 3300047318 | Ga0495636_0039180 | Ga0495636_0039180_1120_1914 | 259 |
| 6 | 3300048905 | Ga0496102_0798001 | Ga0496102_0798001_40_834 | 259 |
| 7 | 3300049584 | Ga0501068_0000074 | Ga0501068_0000074_19134_19946 | 265 |
| 8 | 3300049587 | Ga0501071_0000681 | Ga0501071_0000681_12054_12866 | 265 |
| 9 | 3300049743 | Ga0501081_0193605 | Ga0501081_0193605_229_1041 | 265 |
| 10 | 3300060353 | Ga0501082_0029763 | Ga0501082_0029763_332_1144 | 265 |
| 11 | 3300046472 | Ga0495580_0128236 | Ga0495580_0128236_426_1322 | 274 |
| 12 | 3300045836 | Ga0466958_0076987 | Ga0466958_0076987_74_946 | 276 |
| 13 | 3300049568 | Ga0501031_0101932 | Ga0501031_0101932_206_1102 | 276 |
| 14 | 3300049570 | Ga0501033_0122675 | Ga0501033_0122675_791_1687 | 276 |
| 15 | 3300049574 | Ga0501038_0297272 | Ga0501038_0297272_158_1054 | 276 |
| 16 | 3300049576 | Ga0501040_0076455 | Ga0501040_0076455_852_1748 | 276 |
| 17 | 3300049579 | Ga0501043_0187678 | Ga0501043_0187678_576_1472 | 276 |
| 18 | 3300049592 | Ga0501076_0084236 | Ga0501076_0084236_797_1693 | 276 |
| 19 | 3300049593 | Ga0501077_0084236 | Ga0501077_0084236_690_1586 | 276 |
| 20 | 3300049741 | Ga0501079_0024821 | Ga0501079_0024821_3580_4476 | 276 |
| 21 | 3300049824 | Ga0501045_0293250 | Ga0501045_0293250_79_975 | 276 |
| 22 | 3300060353 | Ga0501082_0072225 | Ga0501082_0072225_1863_2759 | 276 |
| 23 | 3300061734 | Ga0530510_0435586 | Ga0530510_0435586_43_939 | 276 |
| 24 | 3300005458 | Ga0070681_10016973 | Ga0070681_100169736 | 278 |
| 25 | 3300005547 | Ga0070693_100015117 | Ga0070693_1000151174 | 278 |
| 26 | 3300025912 | Ga0207707_10079337 | Ga0207707_100793374 | 278 |
| 27 | 3300014326 | Ga0157380_10261827 | Ga0157380_102618273 | 279 |
| 28 | 3300005336 | Ga0070680_100014934 | Ga0070680_1000149346 | 282 |
| 29 | 3300005458 | Ga0070681_10106087 | Ga0070681_101060872 | 282 |
| 30 | 3300005530 | Ga0070679_100066673 | Ga0070679_1000666735 | 282 |
| 31 | 3300005547 | Ga0070693_100236923 | Ga0070693_1002369232 | 282 |
| 32 | 3300025912 | Ga0207707_10015396 | Ga0207707_100153967 | 282 |
| 33 | 3300025917 | Ga0207660_10012132 | Ga0207660_100121326 | 282 |
| 34 | 3300025921 | Ga0207652_10004128 | Ga0207652_100041288 | 282 |
| 35 | 3300049568 | Ga0501031_0120791 | Ga0501031_0120791_641_1537 | 282 |
| 36 | 3300049571 | Ga0501034_0005074 | Ga0501034_0005074_7441_8304 | 282 |
| 37 | 3300049577 | Ga0501041_0132068 | Ga0501041_0132068_466_1362 | 282 |
| 38 | 3300049583 | Ga0501067_0002954 | Ga0501067_0002954_7281_8144 | 282 |
| 39 | 3300049584 | Ga0501068_0001594 | Ga0501068_0001594_474_1337 | 282 |
| 40 | 3300049586 | Ga0501070_0250891 | Ga0501070_0250891_38_901 | 282 |
| 41 | 3300049587 | Ga0501071_0015162 | Ga0501071_0015162_4262_5125 | 282 |
| 42 | 3300049588 | Ga0501072_0001150 | Ga0501072_0001150_533_1396 | 282 |
| 43 | 3300049589 | Ga0501073_0039337 | Ga0501073_0039337_1362_2225 | 282 |
| 44 | 3300049591 | Ga0501075_0170213 | Ga0501075_0170213_465_1361 | 282 |
| 45 | 3300049592 | Ga0501076_0433835 | Ga0501076_0433835_36_932 | 282 |
| 46 | 3300049742 | Ga0501080_0207286 | Ga0501080_0207286_490_1353 | 282 |
| 47 | 3300049744 | Ga0501083_0004745 | Ga0501083_0004745_1740_2603 | 282 |
| 48 | 3300060353 | Ga0501082_0027373 | Ga0501082_0027373_2125_2988 | 282 |
| 49 | 3300005530 | Ga0070679_100523171 | Ga0070679_1005231711 | 284 |
| 50 | 3300025921 | Ga0207652_10373285 | Ga0207652_103732851 | 284 |
| 51 | 3300021384 | Ga0213876_10002895 | Ga0213876_100028953 | 285 |
| 52 | 3300039437 | Ga0436365_1566279 | Ga0436365_1566279_6553_7551 | 285 |
| 53 | 3300005518 | Ga0070699_100064740 | Ga0070699_1000647401 | 286 |
| 54 | 3300049742 | Ga0501080_0151688 | Ga0501080_0151688_936_1832 | 287 |
| 55 | 3300005548 | Ga0070665_100050932 | Ga0070665_1000509324 | 290 |
| 56 | 3300028379 | Ga0268266_10055399 | Ga0268266_100553993 | 290 |
| 57 | 3300005334 | Ga0068869_100022207 | Ga0068869_1000222071 | 291 |
| 58 | 3300005339 | Ga0070660_100064485 | Ga0070660_1000644855 | 291 |
| 59 | 3300005347 | Ga0070668_100134395 | Ga0070668_1001343951 | 291 |
| 60 | 3300005353 | Ga0070669_100025846 | Ga0070669_1000258464 | 291 |
| 61 | 3300005367 | Ga0070667_100020670 | Ga0070667_1000206706 | 291 |
| 62 | 3300005456 | Ga0070678_100004646 | Ga0070678_1000046461 | 291 |
| 63 | 3300005471 | Ga0070698_100041842 | Ga0070698_1000418426 | 291 |
| 64 | 3300005518 | Ga0070699_100003804 | Ga0070699_1000038042 | 291 |
| 65 | 3300005545 | Ga0070695_100012797 | Ga0070695_1000127977 | 291 |
| 66 | 3300005546 | Ga0070696_100028078 | Ga0070696_1000280786 | 291 |
| 67 | 3300005547 | Ga0070693_100060264 | Ga0070693_1000602641 | 291 |
| 68 | 3300005563 | Ga0068855_100497731 | Ga0068855_1004977311 | 291 |
| 69 | 3300005578 | Ga0068854_100007214 | Ga0068854_1000072145 | 291 |
| 70 | 3300005616 | Ga0068852_100308835 | Ga0068852_1003088351 | 291 |
| 71 | 3300005618 | Ga0068864_100124045 | Ga0068864_1001240453 | 291 |
| 72 | 3300005718 | Ga0068866_10000069 | Ga0068866_1000006925 | 291 |
| 73 | 3300005719 | Ga0068861_100022430 | Ga0068861_1000224307 | 291 |
| 74 | 3300005842 | Ga0068858_100126379 | Ga0068858_1001263792 | 291 |
| 75 | 3300005844 | Ga0068862_100124231 | Ga0068862_1001242312 | 291 |
| 76 | 3300006237 | Ga0097621_100063602 | Ga0097621_1000636024 | 291 |
| 77 | 3300006881 | Ga0068865_100047716 | Ga0068865_1000477162 | 291 |
| 78 | 3300009148 | Ga0105243_10102681 | Ga0105243_101026815 | 291 |
| 79 | 3300009174 | Ga0105241_10041960 | Ga0105241_100419603 | 291 |
| 80 | 3300009176 | Ga0105242_10002701 | Ga0105242_100027019 | 291 |
| 81 | 3300009177 | Ga0105248_10000553 | Ga0105248_1000055317 | 291 |
| 82 | 3300010375 | Ga0105239_10042753 | Ga0105239_100427532 | 291 |
| 83 | 3300013297 | Ga0157378_10024116 | Ga0157378_100241162 | 291 |
| 84 | 3300013306 | Ga0163162_10068549 | Ga0163162_100685494 | 291 |
| 85 | 3300013306 | Ga0163162_10088838 | Ga0163162_100888381 | 291 |
| 86 | 3300014326 | Ga0157380_10122824 | Ga0157380_101228244 | 291 |
| 87 | 3300025907 | Ga0207645_10003450 | Ga0207645_100034507 | 291 |
| 88 | 3300025908 | Ga0207643_10001798 | Ga0207643_100017989 | 291 |
| 89 | 3300025917 | Ga0207660_10382156 | Ga0207660_103821561 | 291 |
| 90 | 3300025922 | Ga0207646_10042279 | Ga0207646_100422796 | 291 |
| 91 | 3300025933 | Ga0207706_10000025 | Ga0207706_1000002534 | 291 |
| 92 | 3300025934 | Ga0207686_10000686 | Ga0207686_100006861 | 291 |
| 93 | 3300025937 | Ga0207669_10000317 | Ga0207669_1000031716 | 291 |
| 94 | 3300025938 | Ga0207704_10013066 | Ga0207704_100130666 | 291 |
| 95 | 3300025940 | Ga0207691_10053494 | Ga0207691_100534942 | 291 |
| 96 | 3300025941 | Ga0207711_10002951 | Ga0207711_100029511 | 291 |
| 97 | 3300025942 | Ga0207689_10547667 | Ga0207689_105476671 | 291 |
| 98 | 3300025961 | Ga0207712_10153227 | Ga0207712_101532271 | 291 |
| 99 | 3300025961 | Ga0207712_10489983 | Ga0207712_104899831 | 291 |
| 100 | 3300025972 | Ga0207668_10184636 | Ga0207668_101846363 | 291 |
| 101 | 3300026075 | Ga0207708_10027300 | Ga0207708_100273001 | 291 |
| 102 | 3300026075 | Ga0207708_10076639 | Ga0207708_100766394 | 291 |
| 103 | 3300026089 | Ga0207648_10000138 | Ga0207648_1000013830 | 291 |
| 104 | 3300026118 | Ga0207675_100044595 | Ga0207675_1000445952 | 291 |
| 105 | 3300026121 | Ga0207683_10008478 | Ga0207683_100084789 | 291 |
| 106 | 3300046492 | Ga0495585_0176088 | Ga0495585_0176088_26_919 | 291 |
| 107 | 3300048904 | Ga0496101_0502356 | Ga0496101_0502356_11_904 | 291 |
| 108 | 3300006844 | Ga0075428_100091397 | Ga0075428_1000913975 | 292 |
| 109 | 3300009147 | Ga0114129_10553021 | Ga0114129_105530211 | 292 |
| 110 | 3300031852 | Ga0307410_10033129 | Ga0307410_100331296 | 292 |
| 111 | 3300031995 | Ga0307409_100136003 | Ga0307409_1001360035 | 292 |
| 112 | 3300032005 | Ga0307411_10213575 | Ga0307411_102135753 | 292 |
| 113 | 3300044672 | Ga0466982_0000012 | Ga0466982_0000012_70097_71011 | 292 |
| 114 | 3300049571 | Ga0501034_0014900 | Ga0501034_0014900_2903_3835 | 292 |
| 115 | 3300049571 | Ga0501034_0149448 | Ga0501034_0149448_517_1413 | 292 |
| 116 | 3300049586 | Ga0501070_0026407 | Ga0501070_0026407_3428_4324 | 292 |
| 117 | 3300049586 | Ga0501070_0139753 | Ga0501070_0139753_567_1463 | 292 |
| 118 | 3300049588 | Ga0501072_0122008 | Ga0501072_0122008_1000_1896 | 292 |
| 119 | 3300049590 | Ga0501074_0000195 | Ga0501074_0000195_3803_4699 | 292 |
| 120 | 3300049744 | Ga0501083_0003815 | Ga0501083_0003815_3300_4196 | 292 |
| 121 | 3300005458 | Ga0070681_10117006 | Ga0070681_101170063 | 295 |
| 122 | 3300005546 | Ga0070696_100000464 | Ga0070696_10000046414 | 295 |
| 123 | 3300007076 | Ga0075435_100197035 | Ga0075435_1001970352 | 295 |
| 124 | 3300005340 | Ga0070689_100279796 | Ga0070689_1002797962 | 298 |
| 125 | 3300005364 | Ga0070673_100117736 | Ga0070673_1001177362 | 298 |
| 126 | 3300005367 | Ga0070667_100130057 | Ga0070667_1001300572 | 298 |
| 127 | 3300006871 | Ga0075434_100139367 | Ga0075434_1001393672 | 298 |
| 128 | 3300007076 | Ga0075435_100459063 | Ga0075435_1004590631 | 298 |
| 129 | 3300013296 | Ga0157374_10032888 | Ga0157374_100328884 | 298 |
| 130 | 3300026089 | Ga0207648_10089690 | Ga0207648_100896902 | 298 |
| 131 | 3300050512 | nmdc:mga0n895_46894_c1 | nmdc:mga0n895_46894_c1_2848_3771 | 298 |
| 132 | 3300005327 | Ga0070658_10002354 | Ga0070658_100023547 | 299 |
| 133 | 3300005327 | Ga0070658_10146947 | Ga0070658_101469472 | 299 |
| 134 | 3300005329 | Ga0070683_100021736 | Ga0070683_1000217363 | 299 |
| 135 | 3300005336 | Ga0070680_100066100 | Ga0070680_1000661001 | 299 |
| 136 | 3300005458 | Ga0070681_10000838 | Ga0070681_100008389 | 299 |
| 137 | 3300005530 | Ga0070679_100002461 | Ga0070679_1000024616 | 299 |
| 138 | 3300005535 | Ga0070684_100051342 | Ga0070684_1000513421 | 299 |
| 139 | 3300005535 | Ga0070684_100169308 | Ga0070684_1001693081 | 299 |
| 140 | 3300005543 | Ga0070672_100099536 | Ga0070672_1000995363 | 299 |
| 141 | 3300005614 | Ga0068856_100126498 | Ga0068856_1001264981 | 299 |
| 142 | 3300005616 | Ga0068852_100005832 | Ga0068852_1000058324 | 299 |
| 143 | 3300009551 | Ga0105238_10022967 | Ga0105238_100229674 | 299 |
| 144 | 3300013105 | Ga0157369_10010539 | Ga0157369_100105398 | 299 |
| 145 | 3300013105 | Ga0157369_10012404 | Ga0157369_100124042 | 299 |
| 146 | 3300013105 | Ga0157369_10205921 | Ga0157369_102059212 | 299 |
| 147 | 3300013307 | Ga0157372_10014644 | Ga0157372_100146448 | 299 |
| 148 | 3300013307 | Ga0157372_10027724 | Ga0157372_100277244 | 299 |
| 149 | 3300013307 | Ga0157372_10068787 | Ga0157372_100687871 | 299 |
| 150 | 3300013307 | Ga0157372_10073978 | Ga0157372_100739784 | 299 |
| 151 | 3300013308 | Ga0157375_10142680 | Ga0157375_101426802 | 299 |
| 152 | 3300020082 | Ga0206353_11313939 | Ga0206353_113139392 | 299 |
| 153 | 3300025909 | Ga0207705_10145629 | Ga0207705_101456292 | 299 |
| 154 | 3300025912 | Ga0207707_10001488 | Ga0207707_1000148810 | 299 |
| 155 | 3300025916 | Ga0207663_10070036 | Ga0207663_100700363 | 299 |
| 156 | 3300025917 | Ga0207660_10001988 | Ga0207660_100019886 | 299 |
| 157 | 3300025921 | Ga0207652_10001470 | Ga0207652_1000147010 | 299 |
| 158 | 3300025940 | Ga0207691_10004930 | Ga0207691_1000493012 | 299 |
| 159 | 3300025944 | Ga0207661_10027382 | Ga0207661_100273822 | 299 |
| 160 | 3300026078 | Ga0207702_10043357 | Ga0207702_100433574 | 299 |
| 161 | 3300026142 | Ga0207698_10102856 | Ga0207698_101028562 | 299 |
| 162 | 3300031548 | Ga0307408_100092000 | Ga0307408_1000920002 | 299 |
| 163 | 3300031731 | Ga0307405_10247617 | Ga0307405_102476171 | 299 |
| 164 | 3300031852 | Ga0307410_10171805 | Ga0307410_101718052 | 299 |
| 165 | 3300031901 | Ga0307406_10280815 | Ga0307406_102808152 | 299 |
| 166 | 3300031903 | Ga0307407_10133188 | Ga0307407_101331881 | 299 |
| 167 | 3300031911 | Ga0307412_10055616 | Ga0307412_100556162 | 299 |
| 168 | 3300031995 | Ga0307409_100140988 | Ga0307409_1001409882 | 299 |
| 169 | 3300032002 | Ga0307416_100103057 | Ga0307416_1001030573 | 299 |
| 170 | 3300032126 | Ga0307415_100288031 | Ga0307415_1002880311 | 299 |
| 171 | 3300035086 | Ga0373934_0002058 | Ga0373934_0002058_273_1205 | 299 |
| 172 | 3300035111 | Ga0373923_0007802 | Ga0373923_0007802_70_1002 | 299 |
| 173 | 3300035117 | Ga0373953_0009868 | Ga0373953_0009868_562_1494 | 299 |
| 174 | 3300035691 | Ga0373931_0092342 | Ga0373931_0092342_682_1608 | 299 |
| 175 | 3300035725 | Ga0373947_0066314 | Ga0373947_0066314_576_1508 | 299 |
| 176 | 3300036401 | Ga0373937_0046193 | Ga0373937_0046193_745_1677 | 299 |
| 177 | 3300036401 | Ga0373937_0070839 | Ga0373937_0070839_1333_2265 | 299 |
| 178 | 3300037068 | Ga0373925_0017735 | Ga0373925_0017735_62_994 | 299 |
| 179 | 3300039437 | Ga0436365_1447060 | Ga0436365_1447060_49_975 | 299 |
| 180 | 3300039437 | Ga0436365_1476038 | Ga0436365_1476038_734_1660 | 299 |
| 181 | 3300042876 | Ga0451577_0006931 | Ga0451577_0006931_2918_3844 | 299 |
| 182 | 3300044712 | Ga0453684_0000294 | Ga0453684_0000294_191025_191951 | 299 |
| 183 | 3300044712 | Ga0453684_0165009 | Ga0453684_0165009_1197_2123 | 299 |
| 184 | 3300046459 | Ga0495629_0022218 | Ga0495629_0022218_2033_2965 | 299 |
| 185 | 3300046463 | Ga0495653_0020548 | Ga0495653_0020548_189_1121 | 299 |
| 186 | 3300046472 | Ga0495580_0007638 | Ga0495580_0007638_2074_3006 | 299 |
| 187 | 3300046499 | Ga0495594_0005911 | Ga0495594_0005911_360_1292 | 299 |
| 188 | 3300046511 | Ga0495608_0012711 | Ga0495608_0012711_3559_4491 | 299 |
| 189 | 3300046511 | Ga0495608_0192428 | Ga0495608_0192428_15_947 | 299 |
| 190 | 3300046514 | Ga0495618_0078577 | Ga0495618_0078577_560_1492 | 299 |
| 191 | 3300046517 | Ga0495630_0023200 | Ga0495630_0023200_259_1191 | 299 |
| 192 | 3300046526 | Ga0495666_0012944 | Ga0495666_0012944_1404_2336 | 299 |
| 193 | 3300046529 | Ga0495652_0002191 | Ga0495652_0002191_2155_3087 | 299 |
| 194 | 3300046535 | Ga0495586_0015045 | Ga0495586_0015045_2334_3266 | 299 |
| 195 | 3300046536 | Ga0495587_0001170 | Ga0495587_0001170_13270_14202 | 299 |
| 196 | 3300046543 | Ga0495645_0000547 | Ga0495645_0000547_14649_15581 | 299 |
| 197 | 3300046543 | Ga0495645_0137036 | Ga0495645_0137036_230_1156 | 299 |
| 198 | 3300046543 | Ga0495645_0187764 | Ga0495645_0187764_205_1131 | 299 |
| 199 | 3300046559 | Ga0495667_0030412 | Ga0495667_0030412_391_1323 | 299 |
| 200 | 3300046678 | Ga0495599_0003528 | Ga0495599_0003528_490_1422 | 299 |
| 201 | 3300046679 | Ga0495623_0028000 | Ga0495623_0028000_2306_3238 | 299 |
| 202 | 3300047317 | Ga0495604_0018743 | Ga0495604_0018743_2475_3407 | 299 |
| 203 | 3300047320 | Ga0495672_0004112 | Ga0495672_0004112_6729_7685 | 299 |
| 204 | 3300047444 | Ga0495675_0038535 | Ga0495675_0038535_105_1037 | 299 |
| 205 | 3300047444 | Ga0495675_0041056 | Ga0495675_0041056_1923_2855 | 299 |
| 206 | 3300048088 | Ga0495602_0048060 | Ga0495602_0048060_1830_2762 | 299 |
| 207 | 3300048088 | Ga0495602_0061120 | Ga0495602_0061120_2306_3238 | 299 |
| 208 | 3300048907 | Ga0496104_0370405 | Ga0496104_0370405_210_1136 | 299 |
| 209 | 3300048912 | Ga0496109_0032090 | Ga0496109_0032090_2367_3293 | 299 |
| 210 | 3300048915 | Ga0496112_0005678 | Ga0496112_0005678_6590_7516 | 299 |
| 211 | 3300048916 | Ga0496113_0081087 | Ga0496113_0081087_865_1791 | 299 |
| 212 | 3300049570 | Ga0501033_0041493 | Ga0501033_0041493_904_1830 | 299 |
| 213 | 3300049571 | Ga0501034_0047216 | Ga0501034_0047216_771_1697 | 299 |
| 214 | 3300049571 | Ga0501034_0483728 | Ga0501034_0483728_181_1137 | 299 |
| 215 | 3300049586 | Ga0501070_0034008 | Ga0501070_0034008_3171_4097 | 299 |
| 216 | 3300049589 | Ga0501073_0087885 | Ga0501073_0087885_826_1752 | 299 |
| 217 | 3300049823 | Ga0501044_0027201 | Ga0501044_0027201_208_1134 | 299 |
| 218 | 3300053078 | Ga0495612_0024619 | Ga0495612_0024619_437_1369 | 299 |
| 219 | 3300053085 | Ga0495619_0051986 | Ga0495619_0051986_204_1136 | 299 |
| 220 | 3300053085 | Ga0495619_0093492 | Ga0495619_0093492_1070_2002 | 299 |
| 221 | 3300005327 | Ga0070658_10064669 | Ga0070658_100646693 | 300 |
| 222 | 3300005327 | Ga0070658_10428545 | Ga0070658_104285452 | 300 |
| 223 | 3300005328 | Ga0070676_10040675 | Ga0070676_100406753 | 300 |
| 224 | 3300005329 | Ga0070683_100010567 | Ga0070683_1000105672 | 300 |
| 225 | 3300005329 | Ga0070683_100046459 | Ga0070683_1000464593 | 300 |
| 226 | 3300005329 | Ga0070683_100125742 | Ga0070683_1001257422 | 300 |
| 227 | 3300005329 | Ga0070683_100407893 | Ga0070683_1004078931 | 300 |
| 228 | 3300005331 | Ga0070670_100012711 | Ga0070670_1000127116 | 300 |
| 229 | 3300005336 | Ga0070680_100025277 | Ga0070680_1000252771 | 300 |
| 230 | 3300005339 | Ga0070660_100008136 | Ga0070660_1000081365 | 300 |
| 231 | 3300005339 | Ga0070660_100012191 | Ga0070660_1000121914 | 300 |
| 232 | 3300005339 | Ga0070660_100056719 | Ga0070660_1000567193 | 300 |
| 233 | 3300005344 | Ga0070661_100001621 | Ga0070661_1000016217 | 300 |
| 234 | 3300005344 | Ga0070661_100039749 | Ga0070661_1000397494 | 300 |
| 235 | 3300005347 | Ga0070668_100023636 | Ga0070668_1000236363 | 300 |
| 236 | 3300005353 | Ga0070669_100018006 | Ga0070669_1000180066 | 300 |
| 237 | 3300005354 | Ga0070675_100018662 | Ga0070675_1000186624 | 300 |
| 238 | 3300005354 | Ga0070675_100387576 | Ga0070675_1003875761 | 300 |
| 239 | 3300005355 | Ga0070671_100036922 | Ga0070671_1000369224 | 300 |
| 240 | 3300005356 | Ga0070674_100021122 | Ga0070674_1000211224 | 300 |
| 241 | 3300005364 | Ga0070673_100019055 | Ga0070673_1000190553 | 300 |
| 242 | 3300005364 | Ga0070673_100177518 | Ga0070673_1001775181 | 300 |
| 243 | 3300005366 | Ga0070659_100049345 | Ga0070659_1000493454 | 300 |
| 244 | 3300005366 | Ga0070659_100094830 | Ga0070659_1000948302 | 300 |
| 245 | 3300005366 | Ga0070659_100098279 | Ga0070659_1000982792 | 300 |
| 246 | 3300005366 | Ga0070659_100133951 | Ga0070659_1001339512 | 300 |
| 247 | 3300005367 | Ga0070667_100060093 | Ga0070667_1000600933 | 300 |
| 248 | 3300005367 | Ga0070667_100136265 | Ga0070667_1001362651 | 300 |
| 249 | 3300005435 | Ga0070714_100002900 | Ga0070714_1000029009 | 300 |
| 250 | 3300005455 | Ga0070663_100023831 | Ga0070663_1000238315 | 300 |
| 251 | 3300005458 | Ga0070681_10000845 | Ga0070681_100008452 | 300 |
| 252 | 3300005458 | Ga0070681_10145058 | Ga0070681_101450581 | 300 |
| 253 | 3300005459 | Ga0068867_100042096 | Ga0068867_1000420963 | 300 |
| 254 | 3300005466 | Ga0070685_10020078 | Ga0070685_100200784 | 300 |
| 255 | 3300005468 | Ga0070707_100084177 | Ga0070707_1000841773 | 300 |
| 256 | 3300005471 | Ga0070698_100021816 | Ga0070698_1000218165 | 300 |
| 257 | 3300005518 | Ga0070699_100063536 | Ga0070699_1000635364 | 300 |
| 258 | 3300005530 | Ga0070679_100020200 | Ga0070679_1000202006 | 300 |
| 259 | 3300005530 | Ga0070679_100031797 | Ga0070679_1000317972 | 300 |
| 260 | 3300005530 | Ga0070679_100054951 | Ga0070679_1000549514 | 300 |
| 261 | 3300005530 | Ga0070679_100198702 | Ga0070679_1001987021 | 300 |
| 262 | 3300005535 | Ga0070684_100034253 | Ga0070684_1000342534 | 300 |
| 263 | 3300005539 | Ga0068853_100040545 | Ga0068853_1000405455 | 300 |
| 264 | 3300005563 | Ga0068855_100017339 | Ga0068855_1000173396 | 300 |
| 265 | 3300005564 | Ga0070664_100001432 | Ga0070664_10000143210 | 300 |
| 266 | 3300005564 | Ga0070664_100051351 | Ga0070664_1000513514 | 300 |
| 267 | 3300005564 | Ga0070664_100130188 | Ga0070664_1001301883 | 300 |
| 268 | 3300005564 | Ga0070664_100134498 | Ga0070664_1001344984 | 300 |
| 269 | 3300005577 | Ga0068857_100000356 | Ga0068857_1000003566 | 300 |
| 270 | 3300005614 | Ga0068856_100413995 | Ga0068856_1004139952 | 300 |
| 271 | 3300005616 | Ga0068852_100025667 | Ga0068852_1000256675 | 300 |
| 272 | 3300005616 | Ga0068852_100030124 | Ga0068852_1000301241 | 300 |
| 273 | 3300005617 | Ga0068859_100006842 | Ga0068859_10000684210 | 300 |
| 274 | 3300005718 | Ga0068866_10058572 | Ga0068866_100585722 | 300 |
| 275 | 3300006846 | Ga0075430_100035238 | Ga0075430_1000352384 | 300 |
| 276 | 3300006847 | Ga0075431_100073370 | Ga0075431_1000733702 | 300 |
| 277 | 3300006871 | Ga0075434_100022791 | Ga0075434_1000227913 | 300 |
| 278 | 3300006931 | Ga0097620_100006842 | Ga0097620_10000684210 | 300 |
| 279 | 3300009093 | Ga0105240_10030293 | Ga0105240_100302934 | 300 |
| 280 | 3300009094 | Ga0111539_10079978 | Ga0111539_100799783 | 300 |
| 281 | 3300009147 | Ga0114129_10109937 | Ga0114129_101099374 | 300 |
| 282 | 3300009177 | Ga0105248_10285525 | Ga0105248_102855251 | 300 |
| 283 | 3300009551 | Ga0105238_10080977 | Ga0105238_100809773 | 300 |
| 284 | 3300013104 | Ga0157370_10046177 | Ga0157370_100461773 | 300 |
| 285 | 3300013105 | Ga0157369_10093706 | Ga0157369_100937063 | 300 |
| 286 | 3300013307 | Ga0157372_10047288 | Ga0157372_100472885 | 300 |
| 287 | 3300013307 | Ga0157372_10133149 | Ga0157372_101331492 | 300 |
| 288 | 3300013307 | Ga0157372_10651514 | Ga0157372_106515141 | 300 |
| 289 | 3300013308 | Ga0157375_10036261 | Ga0157375_100362614 | 300 |
| 290 | 3300014497 | Ga0182008_10000770 | Ga0182008_1000077013 | 300 |
| 291 | 3300025907 | Ga0207645_10053606 | Ga0207645_100536063 | 300 |
| 292 | 3300025908 | Ga0207643_10031666 | Ga0207643_100316662 | 300 |
| 293 | 3300025909 | Ga0207705_10076617 | Ga0207705_100766171 | 300 |
| 294 | 3300025909 | Ga0207705_10080073 | Ga0207705_100800734 | 300 |
| 295 | 3300025909 | Ga0207705_10095823 | Ga0207705_100958231 | 300 |
| 296 | 3300025912 | Ga0207707_10000583 | Ga0207707_1000058323 | 300 |
| 297 | 3300025912 | Ga0207707_10034668 | Ga0207707_100346682 | 300 |
| 298 | 3300025917 | Ga0207660_10011444 | Ga0207660_100114444 | 300 |
| 299 | 3300025919 | Ga0207657_10017664 | Ga0207657_100176646 | 300 |
| 300 | 3300025919 | Ga0207657_10035171 | Ga0207657_100351713 | 300 |
| 301 | 3300025920 | Ga0207649_10003595 | Ga0207649_100035952 | 300 |
| 302 | 3300025920 | Ga0207649_10077084 | Ga0207649_100770842 | 300 |
| 303 | 3300025921 | Ga0207652_10041231 | Ga0207652_100412312 | 300 |
| 304 | 3300025921 | Ga0207652_10051125 | Ga0207652_100511254 | 300 |
| 305 | 3300025921 | Ga0207652_10129676 | Ga0207652_101296762 | 300 |
| 306 | 3300025923 | Ga0207681_10006238 | Ga0207681_100062384 | 300 |
| 307 | 3300025924 | Ga0207694_10031485 | Ga0207694_100314852 | 300 |
| 308 | 3300025925 | Ga0207650_10003064 | Ga0207650_100030646 | 300 |
| 309 | 3300025926 | Ga0207659_10006807 | Ga0207659_100068074 | 300 |
| 310 | 3300025929 | Ga0207664_10009705 | Ga0207664_100097054 | 300 |
| 311 | 3300025932 | Ga0207690_10077845 | Ga0207690_100778453 | 300 |
| 312 | 3300025932 | Ga0207690_10146917 | Ga0207690_101469172 | 300 |
| 313 | 3300025933 | Ga0207706_10330581 | Ga0207706_103305812 | 300 |
| 314 | 3300025934 | Ga0207686_10036320 | Ga0207686_100363203 | 300 |
| 315 | 3300025940 | Ga0207691_10002572 | Ga0207691_100025724 | 300 |
| 316 | 3300025940 | Ga0207691_10030204 | Ga0207691_100302043 | 300 |
| 317 | 3300025941 | Ga0207711_10086900 | Ga0207711_100869003 | 300 |
| 318 | 3300025944 | Ga0207661_10013320 | Ga0207661_100133204 | 300 |
| 319 | 3300025945 | Ga0207679_10002534 | Ga0207679_100025345 | 300 |
| 320 | 3300025945 | Ga0207679_10051669 | Ga0207679_100516694 | 300 |
| 321 | 3300025945 | Ga0207679_10112302 | Ga0207679_101123023 | 300 |
| 322 | 3300025945 | Ga0207679_10171019 | Ga0207679_101710192 | 300 |
| 323 | 3300025949 | Ga0207667_10059647 | Ga0207667_100596472 | 300 |
| 324 | 3300025949 | Ga0207667_10424681 | Ga0207667_104246811 | 300 |
| 325 | 3300025960 | Ga0207651_10024463 | Ga0207651_100244631 | 300 |
| 326 | 3300025981 | Ga0207640_10010347 | Ga0207640_100103474 | 300 |
| 327 | 3300025986 | Ga0207658_10035149 | Ga0207658_100351494 | 300 |
| 328 | 3300025986 | Ga0207658_10140280 | Ga0207658_101402803 | 300 |
| 329 | 3300026067 | Ga0207678_10148420 | Ga0207678_101484203 | 300 |
| 330 | 3300026078 | Ga0207702_10525068 | Ga0207702_105250682 | 300 |
| 331 | 3300026089 | Ga0207648_10022381 | Ga0207648_100223814 | 300 |
| 332 | 3300026089 | Ga0207648_10187247 | Ga0207648_101872472 | 300 |
| 333 | 3300026116 | Ga0207674_10000761 | Ga0207674_1000076121 | 300 |
| 334 | 3300026116 | Ga0207674_10027590 | Ga0207674_100275907 | 300 |
| 335 | 3300026121 | Ga0207683_10356181 | Ga0207683_103561811 | 300 |
| 336 | 3300027360 | Ga0209969_1003052 | Ga0209969_10030524 | 300 |
| 337 | 3300027695 | Ga0209966_1003067 | Ga0209966_10030674 | 300 |
| 338 | 3300031548 | Ga0307408_100008051 | Ga0307408_1000080511 | 300 |
| 339 | 3300031548 | Ga0307408_100027190 | Ga0307408_1000271903 | 300 |
| 340 | 3300031548 | Ga0307408_100117829 | Ga0307408_1001178292 | 300 |
| 341 | 3300031731 | Ga0307405_10008799 | Ga0307405_100087995 | 300 |
| 342 | 3300031731 | Ga0307405_10009049 | Ga0307405_100090493 | 300 |
| 343 | 3300031731 | Ga0307405_10085742 | Ga0307405_100857422 | 300 |
| 344 | 3300031731 | Ga0307405_10137272 | Ga0307405_101372722 | 300 |
| 345 | 3300031824 | Ga0307413_10000895 | Ga0307413_100008955 | 300 |
| 346 | 3300031824 | Ga0307413_10078198 | Ga0307413_100781982 | 300 |
| 347 | 3300031824 | Ga0307413_10136295 | Ga0307413_101362952 | 300 |
| 348 | 3300031852 | Ga0307410_10003621 | Ga0307410_100036213 | 300 |
| 349 | 3300031852 | Ga0307410_10096474 | Ga0307410_100964742 | 300 |
| 350 | 3300031852 | Ga0307410_10140067 | Ga0307410_101400672 | 300 |
| 351 | 3300031852 | Ga0307410_10149064 | Ga0307410_101490642 | 300 |
| 352 | 3300031901 | Ga0307406_10003655 | Ga0307406_100036553 | 300 |
| 353 | 3300031901 | Ga0307406_10004115 | Ga0307406_100041156 | 300 |
| 354 | 3300031901 | Ga0307406_10004952 | Ga0307406_100049525 | 300 |
| 355 | 3300031903 | Ga0307407_10014966 | Ga0307407_100149664 | 300 |
| 356 | 3300031903 | Ga0307407_10020047 | Ga0307407_100200474 | 300 |
| 357 | 3300031911 | Ga0307412_10014508 | Ga0307412_100145083 | 300 |
| 358 | 3300031995 | Ga0307409_100115906 | Ga0307409_1001159062 | 300 |
| 359 | 3300031995 | Ga0307409_100164568 | Ga0307409_1001645682 | 300 |
| 360 | 3300031995 | Ga0307409_100235026 | Ga0307409_1002350262 | 300 |
| 361 | 3300031995 | Ga0307409_100365380 | Ga0307409_1003653801 | 300 |
| 362 | 3300031995 | Ga0307409_100468594 | Ga0307409_1004685942 | 300 |
| 363 | 3300032002 | Ga0307416_100005463 | Ga0307416_1000054633 | 300 |
| 364 | 3300032002 | Ga0307416_100031678 | Ga0307416_1000316783 | 300 |
| 365 | 3300032002 | Ga0307416_100103542 | Ga0307416_1001035422 | 300 |
| 366 | 3300032002 | Ga0307416_100127391 | Ga0307416_1001273911 | 300 |
| 367 | 3300032002 | Ga0307416_100423096 | Ga0307416_1004230962 | 300 |
| 368 | 3300032004 | Ga0307414_10012092 | Ga0307414_100120923 | 300 |
| 369 | 3300032004 | Ga0307414_10022178 | Ga0307414_100221782 | 300 |
| 370 | 3300032005 | Ga0307411_10009578 | Ga0307411_100095782 | 300 |
| 371 | 3300032005 | Ga0307411_10011083 | Ga0307411_100110834 | 300 |
| 372 | 3300032126 | Ga0307415_100003013 | Ga0307415_1000030135 | 300 |
| 373 | 3300032126 | Ga0307415_100056355 | Ga0307415_1000563552 | 300 |
| 374 | 3300032126 | Ga0307415_100063272 | Ga0307415_1000632722 | 300 |
| 375 | 3300032126 | Ga0307415_100130980 | Ga0307415_1001309802 | 300 |
| 376 | 3300036401 | Ga0373937_0166201 | Ga0373937_0166201_161_1096 | 300 |
| 377 | 3300042876 | Ga0451577_0000001 | Ga0451577_0000001_647665_648591 | 300 |
| 378 | 3300042876 | Ga0451577_0183988 | Ga0451577_0183988_237_1169 | 300 |
| 379 | 3300044693 | Ga0466961_0093273 | Ga0466961_0093273_852_1781 | 300 |
| 380 | 3300044706 | Ga0466964_0157256 | Ga0466964_0157256_106_1032 | 300 |
| 381 | 3300046531 | Ga0495665_0210652 | Ga0495665_0210652_34_960 | 300 |
| 382 | 3300047444 | Ga0495675_0099853 | Ga0495675_0099853_241_1176 | 300 |
| 383 | 3300048907 | Ga0496104_0278796 | Ga0496104_0278796_247_1182 | 300 |
| 384 | 3300049569 | Ga0501032_0075454 | Ga0501032_0075454_1114_2046 | 300 |
| 385 | 3300049579 | Ga0501043_0119960 | Ga0501043_0119960_108_1043 | 300 |
| 386 | 3300049580 | Ga0501046_0102966 | Ga0501046_0102966_212_1147 | 300 |
| 387 | 3300049581 | Ga0501047_0383632 | Ga0501047_0383632_227_1162 | 300 |
| 388 | 3300049583 | Ga0501067_0050810 | Ga0501067_0050810_814_1740 | 300 |
| 389 | 3300049586 | Ga0501070_0024348 | Ga0501070_0024348_3948_4883 | 300 |
| 390 | 3300049742 | Ga0501080_0112794 | Ga0501080_0112794_51_977 | 300 |
| 391 | 3300049742 | Ga0501080_0463557 | Ga0501080_0463557_96_1022 | 300 |
| 392 | 3300049823 | Ga0501044_0315051 | Ga0501044_0315051_122_1057 | 300 |
| 393 | 3300050509 | nmdc:mga0qj67_12034_c1 | nmdc:mga0qj67_12034_c1_1058_1984 | 300 |
| 394 | 3300050510 | nmdc:mga06r32_239985_c1 | nmdc:mga06r32_239985_c1_567_1493 | 300 |
| 395 | 3300050511 | nmdc:mga08y16_24786_c1 | nmdc:mga08y16_24786_c1_5160_6086 | 300 |
| 396 | 3300005331 | Ga0070670_100032694 | Ga0070670_1000326945 | 301 |
| 397 | 3300005331 | Ga0070670_100063617 | Ga0070670_1000636171 | 301 |
| 398 | 3300005336 | Ga0070680_100059214 | Ga0070680_1000592142 | 301 |
| 399 | 3300005339 | Ga0070660_100047855 | Ga0070660_1000478554 | 301 |
| 400 | 3300005343 | Ga0070687_100013515 | Ga0070687_1000135154 | 301 |
| 401 | 3300005344 | Ga0070661_100009120 | Ga0070661_1000091205 | 301 |
| 402 | 3300005344 | Ga0070661_100242216 | Ga0070661_1002422162 | 301 |
| 403 | 3300005354 | Ga0070675_100001250 | Ga0070675_10000125010 | 301 |
| 404 | 3300005434 | Ga0070709_10005361 | Ga0070709_100053615 | 301 |
| 405 | 3300005434 | Ga0070709_10005715 | Ga0070709_100057156 | 301 |
| 406 | 3300005435 | Ga0070714_100047003 | Ga0070714_1000470033 | 301 |
| 407 | 3300005436 | Ga0070713_100000157 | Ga0070713_10000015715 | 301 |
| 408 | 3300005437 | Ga0070710_10035114 | Ga0070710_100351142 | 301 |
| 409 | 3300005445 | Ga0070708_100078550 | Ga0070708_1000785503 | 301 |
| 410 | 3300005456 | Ga0070678_100173786 | Ga0070678_1001737861 | 301 |
| 411 | 3300005457 | Ga0070662_100153031 | Ga0070662_1001530312 | 301 |
| 412 | 3300005458 | Ga0070681_10017582 | Ga0070681_100175826 | 301 |
| 413 | 3300005458 | Ga0070681_10195600 | Ga0070681_101956002 | 301 |
| 414 | 3300005458 | Ga0070681_10440311 | Ga0070681_104403111 | 301 |
| 415 | 3300005466 | Ga0070685_10145916 | Ga0070685_101459162 | 301 |
| 416 | 3300005467 | Ga0070706_100252149 | Ga0070706_1002521491 | 301 |
| 417 | 3300005468 | Ga0070707_100053878 | Ga0070707_1000538781 | 301 |
| 418 | 3300005518 | Ga0070699_100025162 | Ga0070699_1000251623 | 301 |
| 419 | 3300005530 | Ga0070679_100011557 | Ga0070679_1000115575 | 301 |
| 420 | 3300005530 | Ga0070679_100016930 | Ga0070679_1000169305 | 301 |
| 421 | 3300005535 | Ga0070684_100082581 | Ga0070684_1000825814 | 301 |
| 422 | 3300005546 | Ga0070696_100034715 | Ga0070696_1000347153 | 301 |
| 423 | 3300005547 | Ga0070693_100032905 | Ga0070693_1000329052 | 301 |
| 424 | 3300005549 | Ga0070704_100066780 | Ga0070704_1000667803 | 301 |
| 425 | 3300005563 | Ga0068855_100002422 | Ga0068855_10000242223 | 301 |
| 426 | 3300005564 | Ga0070664_100016011 | Ga0070664_1000160114 | 301 |
| 427 | 3300005564 | Ga0070664_100526060 | Ga0070664_1005260601 | 301 |
| 428 | 3300005577 | Ga0068857_100050020 | Ga0068857_1000500204 | 301 |
| 429 | 3300005578 | Ga0068854_100086611 | Ga0068854_1000866112 | 301 |
| 430 | 3300005614 | Ga0068856_100296308 | Ga0068856_1002963081 | 301 |
| 431 | 3300005617 | Ga0068859_100367748 | Ga0068859_1003677482 | 301 |
| 432 | 3300005618 | Ga0068864_100105509 | Ga0068864_1001055091 | 301 |
| 433 | 3300005834 | Ga0068851_10127024 | Ga0068851_101270242 | 301 |
| 434 | 3300006175 | Ga0070712_100020311 | Ga0070712_1000203114 | 301 |
| 435 | 3300006846 | Ga0075430_100006281 | Ga0075430_1000062817 | 301 |
| 436 | 3300006871 | Ga0075434_100017286 | Ga0075434_1000172863 | 301 |
| 437 | 3300006880 | Ga0075429_100051333 | Ga0075429_1000513332 | 301 |
| 438 | 3300006931 | Ga0097620_100367739 | Ga0097620_1003677392 | 301 |
| 439 | 3300007076 | Ga0075435_100284069 | Ga0075435_1002840691 | 301 |
| 440 | 3300009098 | Ga0105245_10030649 | Ga0105245_100306492 | 301 |
| 441 | 3300009098 | Ga0105245_10056982 | Ga0105245_100569824 | 301 |
| 442 | 3300009098 | Ga0105245_10098428 | Ga0105245_100984283 | 301 |
| 443 | 3300009147 | Ga0114129_10688811 | Ga0114129_106888111 | 301 |
| 444 | 3300013297 | Ga0157378_10110395 | Ga0157378_101103953 | 301 |
| 445 | 3300013308 | Ga0157375_10120780 | Ga0157375_101207803 | 301 |
| 446 | 3300014325 | Ga0163163_10006004 | Ga0163163_100060042 | 301 |
| 447 | 3300014326 | Ga0157380_10019696 | Ga0157380_100196964 | 301 |
| 448 | 3300014745 | Ga0157377_10079634 | Ga0157377_100796341 | 301 |
| 449 | 3300014968 | Ga0157379_10036860 | Ga0157379_100368604 | 301 |
| 450 | 3300025321 | Ga0207656_10133798 | Ga0207656_101337981 | 301 |
| 451 | 3300025906 | Ga0207699_10006412 | Ga0207699_100064126 | 301 |
| 452 | 3300025906 | Ga0207699_10017589 | Ga0207699_100175895 | 301 |
| 453 | 3300025907 | Ga0207645_10000122 | Ga0207645_1000012217 | 301 |
| 454 | 3300025910 | Ga0207684_10081736 | Ga0207684_100817363 | 301 |
| 455 | 3300025912 | Ga0207707_10012431 | Ga0207707_100124312 | 301 |
| 456 | 3300025912 | Ga0207707_10016173 | Ga0207707_100161734 | 301 |
| 457 | 3300025912 | Ga0207707_10222341 | Ga0207707_102223412 | 301 |
| 458 | 3300025913 | Ga0207695_10207702 | Ga0207695_102077022 | 301 |
| 459 | 3300025915 | Ga0207693_10008288 | Ga0207693_100082886 | 301 |
| 460 | 3300025915 | Ga0207693_10017450 | Ga0207693_100174505 | 301 |
| 461 | 3300025917 | Ga0207660_10046321 | Ga0207660_100463214 | 301 |
| 462 | 3300025920 | Ga0207649_10004384 | Ga0207649_100043844 | 301 |
| 463 | 3300025920 | Ga0207649_10229308 | Ga0207649_102293081 | 301 |
| 464 | 3300025921 | Ga0207652_10014428 | Ga0207652_100144286 | 301 |
| 465 | 3300025921 | Ga0207652_10028743 | Ga0207652_100287434 | 301 |
| 466 | 3300025921 | Ga0207652_10312725 | Ga0207652_103127252 | 301 |
| 467 | 3300025922 | Ga0207646_10125538 | Ga0207646_101255382 | 301 |
| 468 | 3300025925 | Ga0207650_10297902 | Ga0207650_102979021 | 301 |
| 469 | 3300025928 | Ga0207700_10001431 | Ga0207700_100014317 | 301 |
| 470 | 3300025929 | Ga0207664_10015952 | Ga0207664_100159523 | 301 |
| 471 | 3300025929 | Ga0207664_10089627 | Ga0207664_100896274 | 301 |
| 472 | 3300025939 | Ga0207665_10000337 | Ga0207665_100003374 | 301 |
| 473 | 3300025944 | Ga0207661_10002524 | Ga0207661_100025244 | 301 |
| 474 | 3300025944 | Ga0207661_10234176 | Ga0207661_102341762 | 301 |
| 475 | 3300025945 | Ga0207679_10007502 | Ga0207679_100075025 | 301 |
| 476 | 3300025945 | Ga0207679_10010275 | Ga0207679_100102752 | 301 |
| 477 | 3300025945 | Ga0207679_10328120 | Ga0207679_103281202 | 301 |
| 478 | 3300025949 | Ga0207667_10057724 | Ga0207667_100577244 | 301 |
| 479 | 3300026023 | Ga0207677_10032481 | Ga0207677_100324814 | 301 |
| 480 | 3300026041 | Ga0207639_10050387 | Ga0207639_100503874 | 301 |
| 481 | 3300026041 | Ga0207639_10063874 | Ga0207639_100638742 | 301 |
| 482 | 3300026067 | Ga0207678_10020134 | Ga0207678_100201343 | 301 |
| 483 | 3300026075 | Ga0207708_10054179 | Ga0207708_100541794 | 301 |
| 484 | 3300026088 | Ga0207641_10212229 | Ga0207641_102122292 | 301 |
| 485 | 3300026116 | Ga0207674_10000477 | Ga0207674_1000047718 | 301 |
| 486 | 3300026116 | Ga0207674_10026085 | Ga0207674_100260854 | 301 |
| 487 | 3300027364 | Ga0209967_1003644 | Ga0209967_10036442 | 301 |
| 488 | 3300027462 | Ga0210000_1011034 | Ga0210000_10110342 | 301 |
| 489 | 3300031238 | Ga0265332_10013540 | Ga0265332_100135404 | 301 |
| 490 | 3300031251 | Ga0265327_10081599 | Ga0265327_100815992 | 301 |
| 491 | 3300031711 | Ga0265314_10023891 | Ga0265314_100238913 | 301 |
| 492 | 3300031711 | Ga0265314_10072218 | Ga0265314_100722182 | 301 |
| 493 | 3300031712 | Ga0265342_10191723 | Ga0265342_101917231 | 301 |
| 494 | 3300035086 | Ga0373934_0000075 | Ga0373934_0000075_32976_33911 | 301 |
| 495 | 3300035111 | Ga0373923_0007561 | Ga0373923_0007561_1727_2662 | 301 |
| 496 | 3300035114 | Ga0373939_0095242 | Ga0373939_0095242_48_974 | 301 |
| 497 | 3300035117 | Ga0373953_0011271 | Ga0373953_0011271_2032_2967 | 301 |
| 498 | 3300035119 | Ga0373956_0000547 | Ga0373956_0000547_9456_10391 | 301 |
| 499 | 3300035120 | Ga0373957_0004601 | Ga0373957_0004601_2012_2947 | 301 |
| 500 | 3300035170 | Ga0373943_0011335 | Ga0373943_0011335_1956_2891 | 301 |
| 501 | 3300035170 | Ga0373943_0061323 | Ga0373943_0061323_921_1850 | 301 |
| 502 | 3300035171 | Ga0373946_0075218 | Ga0373946_0075218_130_1065 | 301 |
| 503 | 3300035172 | Ga0373955_0000669 | Ga0373955_0000669_10681_11616 | 301 |
| 504 | 3300035410 | Ga0373924_0001752 | Ga0373924_0001752_3999_4934 | 301 |
| 505 | 3300035692 | Ga0373935_0042868 | Ga0373935_0042868_193_1128 | 301 |
| 506 | 3300035695 | Ga0373927_0004259 | Ga0373927_0004259_1019_1954 | 301 |
| 507 | 3300035724 | Ga0373933_0000070 | Ga0373933_0000070_51218_52153 | 301 |
| 508 | 3300035725 | Ga0373947_0000105 | Ga0373947_0000105_9267_10202 | 301 |
| 509 | 3300036401 | Ga0373937_0000153 | Ga0373937_0000153_50284_51219 | 301 |
| 510 | 3300037068 | Ga0373925_0004451 | Ga0373925_0004451_4042_4977 | 301 |
| 511 | 3300037466 | Ga0395898_0087257 | Ga0395898_0087257_1955_2923 | 301 |
| 512 | 3300037471 | Ga0395905_0026729 | Ga0395905_0026729_1661_2629 | 301 |
| 513 | 3300046454 | Ga0495592_0002999 | Ga0495592_0002999_1405_2340 | 301 |
| 514 | 3300046457 | Ga0495590_0018935 | Ga0495590_0018935_568_1497 | 301 |
| 515 | 3300046459 | Ga0495629_0017108 | Ga0495629_0017108_304_1239 | 301 |
| 516 | 3300046462 | Ga0495651_0000116 | Ga0495651_0000116_13818_14753 | 301 |
| 517 | 3300046463 | Ga0495653_0000160 | Ga0495653_0000160_12265_13200 | 301 |
| 518 | 3300046472 | Ga0495580_0007476 | Ga0495580_0007476_66_1001 | 301 |
| 519 | 3300046473 | Ga0495582_0006709 | Ga0495582_0006709_2052_2987 | 301 |
| 520 | 3300046475 | Ga0495639_0000274 | Ga0495639_0000274_10384_11319 | 301 |
| 521 | 3300046511 | Ga0495608_0000141 | Ga0495608_0000141_17204_18139 | 301 |
| 522 | 3300046514 | Ga0495618_0022042 | Ga0495618_0022042_2011_2946 | 301 |
| 523 | 3300046516 | Ga0495628_0000113 | Ga0495628_0000113_28315_29250 | 301 |
| 524 | 3300046517 | Ga0495630_0007174 | Ga0495630_0007174_3442_4377 | 301 |
| 525 | 3300046517 | Ga0495630_0008764 | Ga0495630_0008764_25_960 | 301 |
| 526 | 3300046529 | Ga0495652_0002828 | Ga0495652_0002828_2431_3366 | 301 |
| 527 | 3300046531 | Ga0495665_0000167 | Ga0495665_0000167_11056_11991 | 301 |
| 528 | 3300046536 | Ga0495587_0000193 | Ga0495587_0000193_41416_42351 | 301 |
| 529 | 3300046543 | Ga0495645_0000653 | Ga0495645_0000653_16385_17320 | 301 |
| 530 | 3300046557 | Ga0495622_0056461 | Ga0495622_0056461_800_1735 | 301 |
| 531 | 3300046559 | Ga0495667_0003688 | Ga0495667_0003688_2531_3466 | 301 |
| 532 | 3300046663 | Ga0495635_0000064 | Ga0495635_0000064_15681_16616 | 301 |
| 533 | 3300046674 | Ga0495588_0003715 | Ga0495588_0003715_881_1816 | 301 |
| 534 | 3300046675 | Ga0495657_0001394 | Ga0495657_0001394_18468_19403 | 301 |
| 535 | 3300046678 | Ga0495599_0003800 | Ga0495599_0003800_6320_7255 | 301 |
| 536 | 3300046679 | Ga0495623_0000017 | Ga0495623_0000017_56186_57121 | 301 |
| 537 | 3300046680 | Ga0495646_0002392 | Ga0495646_0002392_6456_7391 | 301 |
| 538 | 3300046683 | Ga0495658_0000575 | Ga0495658_0000575_7874_8809 | 301 |
| 539 | 3300046809 | Ga0495600_0000063 | Ga0495600_0000063_35182_36117 | 301 |
| 540 | 3300047315 | Ga0495581_0155030 | Ga0495581_0155030_111_1046 | 301 |
| 541 | 3300047317 | Ga0495604_0000017 | Ga0495604_0000017_143894_144829 | 301 |
| 542 | 3300047319 | Ga0495674_0004424 | Ga0495674_0004424_11063_11998 | 301 |
| 543 | 3300047322 | Ga0495680_0001679 | Ga0495680_0001679_4908_5843 | 301 |
| 544 | 3300047444 | Ga0495675_0001138 | Ga0495675_0001138_7681_8616 | 301 |
| 545 | 3300047471 | Ga0495684_0000095 | Ga0495684_0000095_56164_57099 | 301 |
| 546 | 3300047673 | Ga0495593_0000143 | Ga0495593_0000143_4435_5370 | 301 |
| 547 | 3300048088 | Ga0495602_0000688 | Ga0495602_0000688_2522_3457 | 301 |
| 548 | 3300048089 | Ga0495614_0000161 | Ga0495614_0000161_4817_5752 | 301 |
| 549 | 3300048904 | Ga0496101_0143272 | Ga0496101_0143272_260_1192 | 301 |
| 550 | 3300048911 | Ga0496108_0102276 | Ga0496108_0102276_1120_2052 | 301 |
| 551 | 3300048912 | Ga0496109_0388215 | Ga0496109_0388215_310_1242 | 301 |
| 552 | 3300048915 | Ga0496112_0055567 | Ga0496112_0055567_1645_2580 | 301 |
| 553 | 3300048917 | Ga0496114_0119024 | Ga0496114_0119024_1212_2144 | 301 |
| 554 | 3300048918 | Ga0496115_0003739 | Ga0496115_0003739_4369_5301 | 301 |
| 555 | 3300048918 | Ga0496115_0071828 | Ga0496115_0071828_818_1750 | 301 |
| 556 | 3300050509 | nmdc:mga0qj67_12394_c1 | nmdc:mga0qj67_12394_c1_2431_3360 | 301 |
| 557 | 3300050512 | nmdc:mga0n895_65262_c1 | nmdc:mga0n895_65262_c1_2626_3558 | 301 |
| 558 | 3300050513 | nmdc:mga0rr50_417148_c1 | nmdc:mga0rr50_417148_c1_142_1074 | 301 |
| 559 | 3300050514 | nmdc:mga08x19_263719_c1 | nmdc:mga08x19_263719_c1_137_1072 | 301 |
| 560 | 3300050514 | nmdc:mga08x19_61796_c1 | nmdc:mga08x19_61796_c1_1039_1968 | 301 |
| 561 | 3300050515 | nmdc:mga0a205_119051_c1 | nmdc:mga0a205_119051_c1_275_1207 | 301 |
| 562 | 3300053077 | Ga0495601_0112050 | Ga0495601_0112050_121_1056 | 301 |
| 563 | 3300053078 | Ga0495612_0025707 | Ga0495612_0025707_55_990 | 301 |
| 564 | 3300053084 | Ga0495595_0023999 | Ga0495595_0023999_1358_2293 | 301 |
| 565 | 3300053085 | Ga0495619_0001382 | Ga0495619_0001382_3600_4535 | 301 |
| 566 | iso_pu_bacteria | 2643221685 | 2644477890 | 302 |
| 567 | 3300032004 | Ga0307414_10003471 | Ga0307414_100034713 | 303 |
| 568 | iso_pu_bacteria | 2883291878 | 2883295862 | 303 |
| 569 | iso_pu_bacteria | 2895395659 | 2895398872 | 303 |
| 570 | iso_pu_bacteria | 3000405567 | 3000408058 | 304 |
| 571 | 3300005331 | Ga0070670_100008009 | Ga0070670_1000080093 | 306 |
| 572 | 3300005339 | Ga0070660_100050925 | Ga0070660_1000509251 | 306 |
| 573 | 3300005339 | Ga0070660_100354535 | Ga0070660_1003545351 | 306 |
| 574 | 3300005366 | Ga0070659_100154950 | Ga0070659_1001549502 | 306 |
| 575 | 3300005458 | Ga0070681_10128564 | Ga0070681_101285642 | 306 |
| 576 | 3300005530 | Ga0070679_100010382 | Ga0070679_1000103824 | 306 |
| 577 | 3300005546 | Ga0070696_100030306 | Ga0070696_1000303062 | 306 |
| 578 | 3300005577 | Ga0068857_100076689 | Ga0068857_1000766892 | 306 |
| 579 | 3300013100 | Ga0157373_10035030 | Ga0157373_100350303 | 306 |
| 580 | 3300013307 | Ga0157372_10013674 | Ga0157372_100136742 | 306 |
| 581 | 3300025912 | Ga0207707_10012238 | Ga0207707_100122386 | 306 |
| 582 | 3300025914 | Ga0207671_10415162 | Ga0207671_104151622 | 306 |
| 583 | 3300025919 | Ga0207657_10237593 | Ga0207657_102375931 | 306 |
| 584 | 3300025921 | Ga0207652_10009917 | Ga0207652_100099177 | 306 |
| 585 | 3300025932 | Ga0207690_10002250 | Ga0207690_100022508 | 306 |
| 586 | 3300025932 | Ga0207690_10009509 | Ga0207690_100095092 | 306 |
| 587 | 3300041452 | Ga0451793_0510102 | Ga0451793_0510102_2420_3343 | 306 |
| 588 | 3300046460 | Ga0495638_0000106 | Ga0495638_0000106_83291_84214 | 306 |
| 589 | 3300049568 | Ga0501031_0155984 | Ga0501031_0155984_252_1184 | 306 |
| 590 | 3300049573 | Ga0501037_0264796 | Ga0501037_0264796_98_1030 | 306 |
| 591 | 3300049574 | Ga0501038_0323138 | Ga0501038_0323138_163_1095 | 306 |
| 592 | 3300049575 | Ga0501039_0031298 | Ga0501039_0031298_351_1283 | 306 |
| 593 | 3300049576 | Ga0501040_0061264 | Ga0501040_0061264_225_1157 | 306 |
| 594 | 3300049580 | Ga0501046_0241602 | Ga0501046_0241602_195_1127 | 306 |
| 595 | 3300049584 | Ga0501068_0186584 | Ga0501068_0186584_193_1125 | 306 |
| 596 | 3300049591 | Ga0501075_0121160 | Ga0501075_0121160_929_1855 | 306 |
| 597 | 3300049593 | Ga0501077_0202105 | Ga0501077_0202105_82_1014 | 306 |
| 598 | 3300049743 | Ga0501081_0032545 | Ga0501081_0032545_229_1161 | 306 |
| 599 | 3300049824 | Ga0501045_0094400 | Ga0501045_0094400_1036_1968 | 306 |
| 600 | 3300060353 | Ga0501082_0052797 | Ga0501082_0052797_1718_2650 | 306 |
| 601 | 3300002737 | JGI25162J39368_1003540 | JGI25162J39368_10035403 | 307 |
| 602 | 3300002737 | JGI25162J39368_1004704 | JGI25162J39368_10047042 | 307 |
| 603 | 3300002772 | JGI25164J39214_1001713 | JGI25164J39214_10017133 | 307 |
| 604 | 3300002772 | JGI25164J39214_1001717 | JGI25164J39214_10017173 | 307 |
| 605 | 3300003214 | JGI25165J46597_1003126 | JGI25165J46597_10031262 | 307 |
| 606 | 3300003214 | JGI25165J46597_1003610 | JGI25165J46597_10036102 | 307 |
| 607 | 3300005436 | Ga0070713_100006772 | Ga0070713_1000067724 | 307 |
| 608 | 3300013100 | Ga0157373_10011898 | Ga0157373_100118984 | 307 |
| 609 | 3300013102 | Ga0157371_10006820 | Ga0157371_100068204 | 307 |
| 610 | 3300015262 | Ga0182007_10010691 | Ga0182007_100106912 | 307 |
| 611 | 3300025226 | Ga0209674_101135 | Ga0209674_1011357 | 307 |
| 612 | 3300025231 | Ga0207427_100134 | Ga0207427_10013467 | 307 |
| 613 | 3300025231 | Ga0207427_100656 | Ga0207427_1006566 | 307 |
| 614 | 3300025233 | Ga0209437_100005 | Ga0209437_100005675 | 307 |
| 615 | 3300025233 | Ga0209437_100200 | Ga0209437_10020075 | 307 |
| 616 | 3300025250 | Ga0209026_1000017 | Ga0209026_1000017241 | 307 |
| 617 | 3300025261 | Ga0209233_1000011 | Ga0209233_1000011267 | 307 |
| 618 | 3300025261 | Ga0209233_1000193 | Ga0209233_100019375 | 307 |
| 619 | 3300025928 | Ga0207700_10000529 | Ga0207700_1000052918 | 307 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ji5-assembly1.cif.gz_A | crystal structure of a histone deacetylase superfamily protein from burkholderia phymatumphymatum | 0.9742 | 1 | 307 |
| 5ji5-assembly1.cif.gz_A | crystal structure of a histone deacetylase superfamily protein from burkholderia phymatumphymatum | 0.9711 | 1 | 307 |
| 8szt-assembly1.cif.gz_D-2 | structure of kdac1 from acinetobacter baumannii | 0.9597 | 1 | 305 |
| 8szt-assembly1.cif.gz_A | structure of kdac1 from acinetobacter baumannii | 0.9576 | 1 | 305 |
| 5g0y-assembly1.cif.gz_B | pseudomonas aeruginosa hdah unliganded. | 0.9553 | 2 | 305 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ji5A00 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain | 0.9742 | 1 | 307 | 3.40.800.20 |
| af_A0A1D6N7T5_1_214_3.40.800.20 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain | 0.9714 | 132 | 306 | 3.40.800.20 |
| 5ji5A00 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain | 0.9711 | 1 | 307 | 3.40.800.20 |
| 5li3A00 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain | 0.947 | 2 | 305 | 3.40.800.20 |
| 5g1cA00 | Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain | 0.9442 | 2 | 305 | 3.40.800.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V3Q8T6-F1-model_v4 | Acetoin utilization protein | 0.9941 | 1 | 307 |
GO:0004407
GO:0040029 |
| AF-A0A502CDR9-F1-model_v4 | Histone deacetylase family protein | 0.9936 | 1 | 307 |
GO:0004407
GO:0040029 |
| AF-A0A502CDR9-F1-model_v4 | Histone deacetylase family protein | 0.9904 | 1 | 307 |
GO:0004407
GO:0040029 |
| AF-A0A257Q2U6-F1-model_v4 | Acetoin utilization protein | 0.9881 | 2 | 306 |
GO:0004407
GO:0040029 |
| AF-A0A812JLV3-F1-model_v4 | Dxs protein | 0.9872 | 2 | 307 |
GO:0004659
GO:0005737 GO:0006308 GO:0008661 GO:0008855 GO:0009318 GO:0016114 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar