F469797

General Info

Members Datasets Scaffolds Average Seq Length
619 295 615 306

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100036922|Ga0070671_1000369224
Length 358
Sequence VQTDPVNHGVQAIVGPAYQSRYGVVRSTKLYGSALPDYSTLPLAFLSHSDCGLHDTGWGHPEHVGRLRAIPRALRNDFELFELVEHREARHASADEVAIAHDARYVEMVRQLAEAGGGRLDADTVVSEGSWAAATAGTGAVLDAVDLAFGDGPRRSFCAVRPPGHHALRSSGMGFCLFGNVAVGAHYARKTHGAERVLIVDWDVHHGNGTQALVQDTPDIRFVSMHQWPWYPGTGPATDRGPHGSVWNVPMAAGLPRDAYVTTFLSAVDSATVGFTPDLVLVSAGFDSLAGDPLGGFTLEMDDVDRLTREMVSRAEQWCGGRLVSSLEGGYAPERLGEACVVHMRGLTGAGRGVGGAG

Samples

Sample ID Description Type Environment
1 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
2 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
3 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
4 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
213 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.16
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.1
Nodule 0
Rhizoplane 2.42
Rhizosphere 94.18
Stem 0
Stem Tuber 0
Unclassified 1.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1003540 3300002737 Bacteria 4417
2 JGI25162J39368_1004704 3300002737 Bacteria 3039
3 JGI25164J39214_1001713 3300002772 Bacteria 4421
4 JGI25164J39214_1001717 3300002772 Bacteria 4417
5 JGI25165J46597_1003126 3300003214 Bacteria 4418
6 JGI25165J46597_1003610 3300003214 Bacteria 3741
7 Ga0070658_10002354 3300005327 Bacteria 15843
8 Ga0070658_10064669 3300005327 Bacteria 2984
9 Ga0070658_10146947 3300005327 Unclassified 1972
10 Ga0070658_10428545 3300005327 Bacteria 1138
11 Ga0070676_10040675 3300005328 Bacteria 2693
12 Ga0070683_100010567 3300005329 Bacteria 7937
13 Ga0070683_100021736 3300005329 Bacteria 5729
14 Ga0070683_100046459 3300005329 Bacteria 4011
15 Ga0070683_100125742 3300005329 Bacteria 2424
16 Ga0070683_100407893 3300005329 Unclassified 1296
17 Ga0070670_100008009 3300005331 Bacteria 8987
18 Ga0070670_100012711 3300005331 Bacteria 7204
19 Ga0070670_100032694 3300005331 Bacteria 4481
20 Ga0070670_100063617 3300005331 Bacteria 3167
21 Ga0068869_100022207 3300005334 Bacteria 4370
22 Ga0070680_100014934 3300005336 Bacteria 6078
23 Ga0070680_100025277 3300005336 Bacteria 4745
24 Ga0070680_100059214 3300005336 Bacteria 3133
25 Ga0070680_100066100 3300005336 Bacteria 2965
26 Ga0070660_100008136 3300005339 Bacteria 7328
27 Ga0070660_100012191 3300005339 Bacteria 6137
28 Ga0070660_100047855 3300005339 Bacteria 3283
29 Ga0070660_100050925 3300005339 Bacteria 3187
30 Ga0070660_100056719 3300005339 Bacteria 3031
31 Ga0070660_100064485 3300005339 Bacteria 2850
32 Ga0070660_100354535 3300005339 Bacteria 1209
33 Ga0070689_100279796 3300005340 Bacteria 1384
34 Ga0070687_100013515 3300005343 Bacteria 3640
35 Ga0070661_100001621 3300005344 Bacteria 15562
36 Ga0070661_100009120 3300005344 Bacteria 6857
37 Ga0070661_100039749 3300005344 Bacteria 3428
38 Ga0070661_100242216 3300005344 Bacteria 1389
39 Ga0070668_100023636 3300005347 Bacteria 4650
40 Ga0070668_100134395 3300005347 Bacteria 1988
41 Ga0070669_100018006 3300005353 Bacteria 5047
42 Ga0070669_100025846 3300005353 Bacteria 4220
43 Ga0070675_100001250 3300005354 Bacteria 18554
44 Ga0070675_100018662 3300005354 Bacteria 5521
45 Ga0070675_100387576 3300005354 Bacteria 1245
46 Ga0070671_100036922 3300005355 Bacteria 4051
47 Ga0070674_100021122 3300005356 Bacteria 4173
48 Ga0070673_100019055 3300005364 Bacteria 4921
49 Ga0070673_100117736 3300005364 Bacteria 2211
50 Ga0070673_100177518 3300005364 Bacteria 1821
51 Ga0070659_100049345 3300005366 Bacteria 3309
52 Ga0070659_100094830 3300005366 Bacteria 2397
53 Ga0070659_100098279 3300005366 Bacteria 2354
54 Ga0070659_100133951 3300005366 Bacteria 2014
55 Ga0070659_100154950 3300005366 Bacteria 1870
56 Ga0070667_100020670 3300005367 Bacteria 5466
57 Ga0070667_100060093 3300005367 Bacteria 3216
58 Ga0070667_100130057 3300005367 Bacteria 2196
59 Ga0070667_100136265 3300005367 Unclassified 2147
60 Ga0070709_10005361 3300005434 Bacteria 6948
61 Ga0070709_10005715 3300005434 Bacteria 6748
62 Ga0070714_100002900 3300005435 Bacteria 12692
63 Ga0070714_100047003 3300005435 Bacteria 3664
64 Ga0070713_100000157 3300005436 Bacteria 46028
65 Ga0070713_100006772 3300005436 Bacteria 7983
66 Ga0070710_10035114 3300005437 Bacteria 2732
67 Ga0070708_100078550 3300005445 Bacteria 2983
68 Ga0070663_100023831 3300005455 Bacteria 4109
69 Ga0070678_100004646 3300005456 Bacteria 7810
70 Ga0070678_100173786 3300005456 Bacteria 1757
71 Ga0070662_100153031 3300005457 Unclassified 1797
72 Ga0070681_10000838 3300005458 Bacteria 25763
73 Ga0070681_10000845 3300005458 Bacteria 25708
74 Ga0070681_10016973 3300005458 Bacteria 7273
75 Ga0070681_10017582 3300005458 Bacteria 7145
76 Ga0070681_10106087 3300005458 Bacteria 2751
77 Ga0070681_10117006 3300005458 Bacteria 2602
78 Ga0070681_10128564 3300005458 Bacteria 2466
79 Ga0070681_10145058 3300005458 Bacteria 2303
80 Ga0070681_10195600 3300005458 Bacteria 1941
81 Ga0070681_10440311 3300005458 Bacteria 1215
82 Ga0068867_100042096 3300005459 Bacteria 3339
83 Ga0070685_10020078 3300005466 Bacteria 3614
84 Ga0070685_10145916 3300005466 Bacteria 1495
85 Ga0070706_100252149 3300005467 Bacteria 1647
86 Ga0070707_100053878 3300005468 Bacteria 3856
87 Ga0070707_100084177 3300005468 Bacteria 3073
88 Ga0070698_100021816 3300005471 Bacteria 6707
89 Ga0070698_100041842 3300005471 Bacteria 4704
90 Ga0070699_100003804 3300005518 Bacteria 13341
91 Ga0070699_100025162 3300005518 Bacteria 5133
92 Ga0070699_100063536 3300005518 Bacteria 3201
93 Ga0070699_100064740 3300005518 Bacteria 3171
94 Ga0070679_100002461 3300005530 Bacteria 16770
95 Ga0070679_100010382 3300005530 Bacteria 8831
96 Ga0070679_100011557 3300005530 Bacteria 8414
97 Ga0070679_100016930 3300005530 Bacteria 7048
98 Ga0070679_100020200 3300005530 Bacteria 6493
99 Ga0070679_100031797 3300005530 Archaea 5218
100 Ga0070679_100054951 3300005530 Bacteria 3965
101 Ga0070679_100066673 3300005530 Bacteria 3588
102 Ga0070679_100198702 3300005530 Bacteria 1972
103 Ga0070679_100523171 3300005530 Bacteria 1130
104 Ga0070684_100034253 3300005535 Bacteria 4341
105 Ga0070684_100051342 3300005535 Bacteria 3582
106 Ga0070684_100082581 3300005535 Bacteria 2845
107 Ga0070684_100169308 3300005535 Bacteria 1984
108 Ga0068853_100040545 3300005539 Bacteria 3973
109 Ga0070672_100099536 3300005543 Unclassified 2356
110 Ga0070695_100012797 3300005545 Bacteria 5037
111 Ga0070696_100000464 3300005546 Bacteria 25407
112 Ga0070696_100028078 3300005546 Bacteria 3838
113 Ga0070696_100030306 3300005546 Bacteria 3703
114 Ga0070696_100034715 3300005546 Bacteria 3471
115 Ga0070693_100015117 3300005547 Bacteria 3969
116 Ga0070693_100032905 3300005547 Bacteria 2856
117 Ga0070693_100060264 3300005547 Unclassified 2202
118 Ga0070693_100236923 3300005547 Bacteria 1203
119 Ga0070665_100050932 3300005548 Bacteria 4155
120 Ga0070704_100066780 3300005549 Bacteria 2595
121 Ga0068855_100002422 3300005563 Bacteria 23029
122 Ga0068855_100017339 3300005563 Bacteria 8665
123 Ga0068855_100497731 3300005563 Unclassified 1325
124 Ga0070664_100001432 3300005564 Bacteria 19026
125 Ga0070664_100016011 3300005564 Bacteria 6143
126 Ga0070664_100051351 3300005564 Bacteria 3491
127 Ga0070664_100130188 3300005564 Bacteria 2210
128 Ga0070664_100134498 3300005564 Bacteria 2173
129 Ga0070664_100526060 3300005564 Bacteria 1092
130 Ga0068857_100000356 3300005577 Bacteria 31874
131 Ga0068857_100050020 3300005577 Bacteria 3708
132 Ga0068857_100076689 3300005577 Bacteria 2981
133 Ga0068854_100007214 3300005578 Bacteria 7097
134 Ga0068854_100086611 3300005578 Bacteria 2323
135 Ga0068856_100126498 3300005614 Bacteria 2559
136 Ga0068856_100296308 3300005614 Bacteria 1635
137 Ga0068856_100413995 3300005614 Bacteria 1368
138 Ga0068852_100005832 3300005616 Bacteria 8844
139 Ga0068852_100025667 3300005616 Bacteria 4777
140 Ga0068852_100030124 3300005616 Bacteria 4464
141 Ga0068852_100308835 3300005616 Bacteria 1533
142 Ga0068859_100006842 3300005617 Bacteria 11583
143 Ga0068859_100367748 3300005617 Bacteria 1533
144 Ga0068864_100105509 3300005618 Bacteria 2504
145 Ga0068864_100124045 3300005618 Bacteria 2312
146 Ga0068866_10000069 3300005718 Bacteria 40892
147 Ga0068866_10058572 3300005718 Bacteria 1990
148 Ga0068861_100022430 3300005719 Unclassified 4549
149 Ga0068851_10127024 3300005834 Bacteria 1376
150 Ga0068858_100126379 3300005842 Unclassified 2395
151 Ga0068862_100124231 3300005844 Bacteria 2277
152 Ga0070712_100020311 3300006175 Bacteria 4346
153 Ga0097621_100063602 3300006237 Bacteria 3033
154 Ga0075428_100091397 3300006844 Bacteria 3320
155 Ga0075430_100006281 3300006846 Bacteria 10023
156 Ga0075430_100035238 3300006846 Bacteria 4247
157 Ga0075431_100073370 3300006847 Bacteria 3530
158 Ga0075434_100017286 3300006871 Bacteria 6946
159 Ga0075434_100022791 3300006871 Bacteria 6098
160 Ga0075434_100139367 3300006871 Bacteria 2445
161 Ga0075429_100051333 3300006880 Bacteria 3589
162 Ga0068865_100047716 3300006881 Bacteria 2944
163 Ga0097620_100006842 3300006931 Bacteria 11583
164 Ga0097620_100367739 3300006931 Bacteria 1533
165 Ga0075435_100197035 3300007076 Bacteria 1706
166 Ga0075435_100284069 3300007076 Bacteria 1413
167 Ga0075435_100459063 3300007076 Bacteria 1099
168 Ga0105240_10030293 3300009093 Bacteria 7032
169 Ga0111539_10079978 3300009094 Bacteria 3845
170 Ga0105245_10030649 3300009098 Bacteria 4757
171 Ga0105245_10056982 3300009098 Unclassified 3514
172 Ga0105245_10098428 3300009098 Bacteria 2702
173 Ga0114129_10109937 3300009147 Bacteria 3805
174 Ga0114129_10553021 3300009147 Bacteria 1496
175 Ga0114129_10688811 3300009147 Bacteria 1315
176 Ga0105243_10102681 3300009148 Bacteria 2376
177 Ga0105241_10041960 3300009174 Bacteria 3459
178 Ga0105242_10002701 3300009176 Bacteria 13877
179 Ga0105248_10000553 3300009177 Bacteria 42444
180 Ga0105248_10285525 3300009177 Unclassified 1858
181 Ga0105238_10022967 3300009551 Bacteria 6358
182 Ga0105238_10080977 3300009551 Bacteria 3236
183 Ga0105239_10042753 3300010375 Bacteria 4965
184 Ga0157373_10011898 3300013100 Bacteria 6392
185 Ga0157373_10035030 3300013100 Bacteria 3605
186 Ga0157371_10006820 3300013102 Bacteria 9332
187 Ga0157370_10046177 3300013104 Bacteria 4176
188 Ga0157369_10010539 3300013105 Bacteria 10519
189 Ga0157369_10012404 3300013105 Bacteria 9674
190 Ga0157369_10093706 3300013105 Bacteria 3205
191 Ga0157369_10205921 3300013105 Bacteria 2063
192 Ga0157374_10032888 3300013296 Bacteria 4727
193 Ga0157378_10024116 3300013297 Bacteria 5351
194 Ga0157378_10110395 3300013297 Bacteria 2521
195 Ga0163162_10068549 3300013306 Bacteria 3599
196 Ga0163162_10088838 3300013306 Bacteria 3170
197 Ga0157372_10013674 3300013307 Bacteria 8674
198 Ga0157372_10014644 3300013307 Bacteria 8390
199 Ga0157372_10027724 3300013307 Bacteria 6173
200 Ga0157372_10047288 3300013307 Bacteria 4780
201 Ga0157372_10068787 3300013307 Bacteria 3981
202 Ga0157372_10073978 3300013307 Bacteria 3841
203 Ga0157372_10133149 3300013307 Bacteria 2862
204 Ga0157372_10651514 3300013307 Bacteria 1226
205 Ga0157375_10036261 3300013308 Bacteria 4716
206 Ga0157375_10120780 3300013308 Bacteria 2729
207 Ga0157375_10142680 3300013308 Bacteria 2523
208 Ga0163163_10006004 3300014325 Bacteria 10566
209 Ga0157380_10019696 3300014326 Bacteria 5033
210 Ga0157380_10122824 3300014326 Unclassified 2202
211 Ga0157380_10261827 3300014326 Bacteria 1571
212 Ga0182008_10000770 3300014497 Bacteria 22485
213 Ga0157377_10079634 3300014745 Bacteria 1912
214 Ga0157379_10036860 3300014968 Bacteria 4360
215 Ga0182007_10010691 3300015262 Bacteria 3612
216 Ga0206353_11313939 3300020082 Bacteria 1906
217 Ga0213876_10002895 3300021384 Bacteria 9967
218 Ga0209674_101135 3300025226 Bacteria 7739
219 Ga0207427_100134 3300025231 Bacteria 91077
220 Ga0207427_100656 3300025231 Bacteria 16685
221 Ga0209437_100005 3300025233 Bacteria 1071596
222 Ga0209437_100200 3300025233 Bacteria 119306
223 Ga0209026_1000017 3300025250 Bacteria 385214
224 Ga0209233_1000011 3300025261 Bacteria 1071611
225 Ga0209233_1000193 3300025261 Bacteria 126812
226 Ga0207656_10133798 3300025321 Bacteria 1163
227 Ga0207699_10006412 3300025906 Bacteria 5695
228 Ga0207699_10017589 3300025906 Bacteria 3767
229 Ga0207645_10000122 3300025907 Bacteria 58946
230 Ga0207645_10003450 3300025907 Bacteria 12009
231 Ga0207645_10053606 3300025907 Bacteria 2577
232 Ga0207643_10001798 3300025908 Bacteria 11922
233 Ga0207643_10031666 3300025908 Bacteria 2950
234 Ga0207705_10076617 3300025909 Bacteria 2432
235 Ga0207705_10080073 3300025909 Bacteria 2380
236 Ga0207705_10095823 3300025909 Bacteria 2178
237 Ga0207705_10145629 3300025909 Bacteria 1772
238 Ga0207684_10081736 3300025910 Bacteria 2750
239 Ga0207707_10000583 3300025912 Bacteria 37074
240 Ga0207707_10001488 3300025912 Bacteria 21644
241 Ga0207707_10012238 3300025912 Bacteria 7459
242 Ga0207707_10012431 3300025912 Bacteria 7401
243 Ga0207707_10015396 3300025912 Bacteria 6662
244 Ga0207707_10016173 3300025912 Bacteria 6509
245 Ga0207707_10034668 3300025912 Bacteria 4415
246 Ga0207707_10079337 3300025912 Bacteria 2866
247 Ga0207707_10222341 3300025912 Bacteria 1644
248 Ga0207695_10207702 3300025913 Bacteria 1870
249 Ga0207671_10415162 3300025914 Bacteria 1071
250 Ga0207693_10008288 3300025915 Bacteria 8509
251 Ga0207693_10017450 3300025915 Bacteria 5725
252 Ga0207663_10070036 3300025916 Bacteria 2258
253 Ga0207660_10001988 3300025917 Bacteria 13621
254 Ga0207660_10011444 3300025917 Bacteria 5776
255 Ga0207660_10012132 3300025917 Bacteria 5631
256 Ga0207660_10046321 3300025917 Bacteria 3068
257 Ga0207660_10382156 3300025917 Bacteria 1132
258 Ga0207657_10017664 3300025919 Bacteria 6836
259 Ga0207657_10035171 3300025919 Bacteria 4495
260 Ga0207657_10237593 3300025919 Bacteria 1456
261 Ga0207649_10003595 3300025920 Bacteria 8470
262 Ga0207649_10004384 3300025920 Bacteria 7659
263 Ga0207649_10077084 3300025920 Bacteria 2147
264 Ga0207649_10229308 3300025920 Bacteria 1327
265 Ga0207652_10001470 3300025921 Bacteria 20851
266 Ga0207652_10004128 3300025921 Bacteria 11856
267 Ga0207652_10009917 3300025921 Bacteria 7666
268 Ga0207652_10014428 3300025921 Bacteria 6400
269 Ga0207652_10028743 3300025921 Bacteria 4641
270 Ga0207652_10041231 3300025921 Bacteria 3923
271 Ga0207652_10051125 3300025921 Bacteria 3542
272 Ga0207652_10129676 3300025921 Unclassified 2248
273 Ga0207652_10312725 3300025921 Unclassified 1418
274 Ga0207652_10373285 3300025921 Bacteria 1287
275 Ga0207646_10042279 3300025922 Bacteria 4094
276 Ga0207646_10125538 3300025922 Bacteria 2307
277 Ga0207681_10006238 3300025923 Bacteria 7312
278 Ga0207694_10031485 3300025924 Bacteria 4053
279 Ga0207650_10003064 3300025925 Bacteria 11518
280 Ga0207650_10297902 3300025925 Bacteria 1316
281 Ga0207659_10006807 3300025926 Bacteria 7026
282 Ga0207700_10000529 3300025928 Bacteria 22476
283 Ga0207700_10001431 3300025928 Bacteria 13532
284 Ga0207664_10009705 3300025929 Bacteria 6767
285 Ga0207664_10015952 3300025929 Bacteria 5471
286 Ga0207664_10089627 3300025929 Bacteria 2519
287 Ga0207690_10002250 3300025932 Bacteria 11770
288 Ga0207690_10009509 3300025932 Bacteria 5775
289 Ga0207690_10077845 3300025932 Bacteria 2306
290 Ga0207690_10146917 3300025932 Bacteria 1744
291 Ga0207706_10000025 3300025933 Bacteria 150958
292 Ga0207706_10330581 3300025933 Bacteria 1326
293 Ga0207686_10000686 3300025934 Bacteria 21009
294 Ga0207686_10036320 3300025934 Unclassified 2965
295 Ga0207669_10000317 3300025937 Bacteria 22016
296 Ga0207704_10013066 3300025938 Bacteria 4143
297 Ga0207665_10000337 3300025939 Bacteria 32435
298 Ga0207691_10002572 3300025940 Bacteria 17729
299 Ga0207691_10004930 3300025940 Bacteria 12882
300 Ga0207691_10030204 3300025940 Bacteria 5065
301 Ga0207691_10053494 3300025940 Bacteria 3686
302 Ga0207711_10002951 3300025941 Bacteria 14875
303 Ga0207711_10086900 3300025941 Bacteria 2742
304 Ga0207689_10547667 3300025942 Bacteria 972
305 Ga0207661_10002524 3300025944 Bacteria 12595
306 Ga0207661_10013320 3300025944 Bacteria 6006
307 Ga0207661_10027382 3300025944 Bacteria 4354
308 Ga0207661_10234176 3300025944 Bacteria 1627
309 Ga0207679_10002534 3300025945 Bacteria 11258
310 Ga0207679_10007502 3300025945 Bacteria 6923
311 Ga0207679_10010275 3300025945 Bacteria 6023
312 Ga0207679_10051669 3300025945 Bacteria 3010
313 Ga0207679_10112302 3300025945 Bacteria 2153
314 Ga0207679_10171019 3300025945 Bacteria 1789
315 Ga0207679_10328120 3300025945 Bacteria 1327
316 Ga0207667_10057724 3300025949 Bacteria 4073
317 Ga0207667_10059647 3300025949 Bacteria 3995
318 Ga0207667_10424681 3300025949 Bacteria 1352
319 Ga0207651_10024463 3300025960 Bacteria 3736
320 Ga0207712_10153227 3300025961 Bacteria 1783
321 Ga0207712_10489983 3300025961 Bacteria 1049
322 Ga0207668_10184636 3300025972 Bacteria 1648
323 Ga0207640_10010347 3300025981 Bacteria 5253
324 Ga0207658_10035149 3300025986 Bacteria 3588
325 Ga0207658_10140280 3300025986 Unclassified 1955
326 Ga0207677_10032481 3300026023 Bacteria 3356
327 Ga0207639_10050387 3300026041 Bacteria 3162
328 Ga0207639_10063874 3300026041 Bacteria 2852
329 Ga0207678_10020134 3300026067 Bacteria 5859
330 Ga0207678_10148420 3300026067 Bacteria 2001
331 Ga0207708_10027300 3300026075 Bacteria 4321
332 Ga0207708_10054179 3300026075 Bacteria 3058
333 Ga0207708_10076639 3300026075 Bacteria 2565
334 Ga0207702_10043357 3300026078 Bacteria 3777
335 Ga0207702_10525068 3300026078 Bacteria 1156
336 Ga0207641_10212229 3300026088 Bacteria 1791
337 Ga0207648_10000138 3300026089 Bacteria 72558
338 Ga0207648_10022381 3300026089 Bacteria 5677
339 Ga0207648_10089690 3300026089 Bacteria 2686
340 Ga0207648_10187247 3300026089 Bacteria 1833
341 Ga0207674_10000477 3300026116 Bacteria 52707
342 Ga0207674_10000761 3300026116 Bacteria 42085
343 Ga0207674_10026085 3300026116 Bacteria 6217
344 Ga0207674_10027590 3300026116 Bacteria 6004
345 Ga0207675_100044595 3300026118 Bacteria 4144
346 Ga0207683_10008478 3300026121 Bacteria 8796
347 Ga0207683_10356181 3300026121 Bacteria 1344
348 Ga0207698_10102856 3300026142 Bacteria 2372
349 Ga0209969_1003052 3300027360 Unclassified 2315
350 Ga0209967_1003644 3300027364 Bacteria 2031
351 Ga0210000_1011034 3300027462 Bacteria 1337
352 Ga0209966_1003067 3300027695 Unclassified 2803
353 Ga0268266_10055399 3300028379 Bacteria 3409
354 Ga0265332_10013540 3300031238 Bacteria 3613
355 Ga0265327_10081599 3300031251 Bacteria 1596
356 Ga0307408_100008051 3300031548 Bacteria 6968
357 Ga0307408_100027190 3300031548 Bacteria 3940
358 Ga0307408_100092000 3300031548 Bacteria 2292
359 Ga0307408_100117829 3300031548 Bacteria 2052
360 Ga0265314_10023891 3300031711 Bacteria 4647
361 Ga0265314_10072218 3300031711 Bacteria 2306
362 Ga0265342_10191723 3300031712 Bacteria 1115
363 Ga0307405_10008799 3300031731 Bacteria 5140
364 Ga0307405_10009049 3300031731 Bacteria 5087
365 Ga0307405_10085742 3300031731 Bacteria 2071
366 Ga0307405_10137272 3300031731 Bacteria 1699
367 Ga0307405_10247617 3300031731 Bacteria 1324
368 Ga0307413_10000895 3300031824 Bacteria 10542
369 Ga0307413_10078198 3300031824 Bacteria 2110
370 Ga0307413_10136295 3300031824 Bacteria 1688
371 Ga0307410_10003621 3300031852 Bacteria 7788
372 Ga0307410_10033129 3300031852 Bacteria 3333
373 Ga0307410_10096474 3300031852 Bacteria 2110
374 Ga0307410_10140067 3300031852 Bacteria 1788
375 Ga0307410_10149064 3300031852 Bacteria 1739
376 Ga0307410_10171805 3300031852 Bacteria 1634
377 Ga0307406_10003655 3300031901 Bacteria 8379
378 Ga0307406_10004115 3300031901 Bacteria 7918
379 Ga0307406_10004952 3300031901 Bacteria 7258
380 Ga0307406_10280815 3300031901 Bacteria 1270
381 Ga0307407_10014966 3300031903 Bacteria 3815
382 Ga0307407_10020047 3300031903 Bacteria 3417
383 Ga0307407_10133188 3300031903 Bacteria 1593
384 Ga0307412_10014508 3300031911 Bacteria 4647
385 Ga0307412_10055616 3300031911 Bacteria 2633
386 Ga0307409_100115906 3300031995 Bacteria 2257
387 Ga0307409_100136003 3300031995 Bacteria 2109
388 Ga0307409_100140988 3300031995 Bacteria 2077
389 Ga0307409_100164568 3300031995 Bacteria 1944
390 Ga0307409_100235026 3300031995 Bacteria 1664
391 Ga0307409_100365380 3300031995 Bacteria 1366
392 Ga0307409_100468594 3300031995 Bacteria 1219
393 Ga0307416_100005463 3300032002 Bacteria 7806
394 Ga0307416_100031678 3300032002 Bacteria 3984
395 Ga0307416_100103057 3300032002 Bacteria 2490
396 Ga0307416_100103542 3300032002 Bacteria 2485
397 Ga0307416_100127391 3300032002 Bacteria 2283
398 Ga0307416_100423096 3300032002 Bacteria 1377
399 Ga0307414_10003471 3300032004 Bacteria 8422
400 Ga0307414_10012092 3300032004 Bacteria 5092
401 Ga0307414_10022178 3300032004 Bacteria 4000
402 Ga0307411_10009578 3300032005 Bacteria 5106
403 Ga0307411_10011083 3300032005 Bacteria 4843
404 Ga0307411_10213575 3300032005 Bacteria 1491
405 Ga0307415_100003013 3300032126 Bacteria 8477
406 Ga0307415_100056355 3300032126 Bacteria 2694
407 Ga0307415_100063272 3300032126 Bacteria 2570
408 Ga0307415_100130980 3300032126 Bacteria 1898
409 Ga0307415_100288031 3300032126 Bacteria 1354
410 Ga0373934_0000075 3300035086 Bacteria 34357
411 Ga0373934_0002058 3300035086 Bacteria 7389
412 Ga0373923_0007561 3300035111 Bacteria 3829
413 Ga0373923_0007802 3300035111 Bacteria 3781
414 Ga0373939_0095242 3300035114 Bacteria 1013
415 Ga0373953_0009868 3300035117 Bacteria 3305
416 Ga0373953_0011271 3300035117 Bacteria 3134
417 Ga0373956_0000547 3300035119 Bacteria 15386
418 Ga0373957_0004601 3300035120 Bacteria 4209
419 Ga0373943_0011335 3300035170 Bacteria 4010
420 Ga0373943_0061323 3300035170 Bacteria 1880
421 Ga0373946_0075218 3300035171 Bacteria 1467
422 Ga0373955_0000669 3300035172 Bacteria 14619
423 Ga0373924_0001752 3300035410 Bacteria 7161
424 Ga0373931_0092342 3300035691 Bacteria 1688
425 Ga0373935_0042868 3300035692 Bacteria 2846
426 Ga0373927_0004259 3300035695 Bacteria 10045
427 Ga0373933_0000070 3300035724 Bacteria 62610
428 Ga0373947_0000105 3300035725 Bacteria 41920
429 Ga0373947_0066314 3300035725 Bacteria 2203
430 Ga0373937_0000153 3300036401 Bacteria 66867
431 Ga0373937_0046193 3300036401 Bacteria 3981
432 Ga0373937_0070839 3300036401 Bacteria 3216
433 Ga0373937_0166201 3300036401 Bacteria 2069
434 Ga0373925_0004451 3300037068 Bacteria 10589
435 Ga0373925_0017735 3300037068 Bacteria 5166
436 Ga0395898_0087257 3300037466 Bacteria 3006
437 Ga0395905_0026729 3300037471 Bacteria 5442
438 Ga0436365_1447060 3300039437 Bacteria 2645
439 Ga0436365_1476038 3300039437 Unclassified 2145
440 Ga0436365_1566279 3300039437 Bacteria 9364
441 Ga0451793_0510102 3300041452 Bacteria 3989
442 Ga0451577_0000001 3300042876 Bacteria 2461803
443 Ga0451577_0006931 3300042876 Bacteria 11200
444 Ga0451577_0183988 3300042876 Bacteria 1884
445 Ga0466982_0000012 3300044672 Bacteria 166823
446 Ga0466961_0093273 3300044693 Unclassified 1900
447 Ga0466964_0157256 3300044706 Bacteria 1059
448 Ga0453684_0000294 3300044712 Bacteria 212051
449 Ga0453684_0165009 3300044712 Bacteria 2616
450 Ga0466958_0076987 3300045836 Bacteria 2048
451 Ga0495592_0002999 3300046454 Bacteria 12010
452 Ga0495590_0018935 3300046457 Bacteria 2458
453 Ga0495629_0017108 3300046459 Bacteria 5200
454 Ga0495629_0022218 3300046459 Bacteria 4524
455 Ga0495638_0000106 3300046460 Bacteria 133921
456 Ga0495651_0000116 3300046462 Bacteria 59001
457 Ga0495653_0000160 3300046463 Bacteria 55860
458 Ga0495653_0020548 3300046463 Bacteria 5352
459 Ga0495580_0007476 3300046472 Bacteria 8780
460 Ga0495580_0007638 3300046472 Bacteria 8673
461 Ga0495580_0128236 3300046472 Bacteria 1760
462 Ga0495582_0006709 3300046473 Bacteria 6396
463 Ga0495639_0000274 3300046475 Bacteria 25461
464 Ga0495585_0176088 3300046492 Bacteria 1102
465 Ga0495594_0005911 3300046499 Bacteria 6288
466 Ga0495608_0000141 3300046511 Bacteria 52164
467 Ga0495608_0012711 3300046511 Bacteria 5841
468 Ga0495608_0192428 3300046511 Unclassified 1287
469 Ga0495618_0022042 3300046514 Bacteria 3931
470 Ga0495618_0078577 3300046514 Bacteria 2103
471 Ga0495628_0000113 3300046516 Bacteria 65741
472 Ga0495630_0007174 3300046517 Bacteria 7945
473 Ga0495630_0008764 3300046517 Bacteria 7265
474 Ga0495630_0023200 3300046517 Bacteria 4586
475 Ga0495666_0012944 3300046526 Bacteria 4157
476 Ga0495652_0002191 3300046529 Bacteria 20522
477 Ga0495652_0002828 3300046529 Bacteria 17476
478 Ga0495665_0000167 3300046531 Bacteria 33230
479 Ga0495665_0210652 3300046531 Bacteria 1006
480 Ga0495586_0015045 3300046535 Bacteria 4114
481 Ga0495587_0000193 3300046536 Bacteria 45053
482 Ga0495587_0001170 3300046536 Bacteria 17292
483 Ga0495645_0000547 3300046543 Bacteria 25829
484 Ga0495645_0000653 3300046543 Bacteria 23880
485 Ga0495645_0137036 3300046543 Unclassified 1711
486 Ga0495645_0187764 3300046543 Bacteria 1411
487 Ga0495622_0056461 3300046557 Bacteria 1821
488 Ga0495667_0003688 3300046559 Bacteria 10302
489 Ga0495667_0030412 3300046559 Bacteria 3628
490 Ga0495635_0000064 3300046663 Bacteria 65195
491 Ga0495588_0003715 3300046674 Bacteria 6683
492 Ga0495657_0001394 3300046675 Bacteria 20946
493 Ga0495599_0003528 3300046678 Bacteria 9157
494 Ga0495599_0003800 3300046678 Bacteria 8865
495 Ga0495623_0000017 3300046679 Bacteria 108556
496 Ga0495623_0028000 3300046679 Bacteria 3627
497 Ga0495646_0002392 3300046680 Bacteria 11510
498 Ga0495658_0000575 3300046683 Bacteria 20030
499 Ga0495600_0000063 3300046809 Bacteria 61349
500 Ga0495581_0155030 3300047315 Bacteria 1339
501 Ga0495604_0000017 3300047317 Bacteria 192029
502 Ga0495604_0018743 3300047317 Bacteria 5540
503 Ga0495636_0039180 3300047318 Bacteria 1962
504 Ga0495674_0004424 3300047319 Bacteria 13514
505 Ga0495672_0004112 3300047320 Bacteria 12116
506 Ga0495680_0001679 3300047322 Bacteria 23534
507 Ga0495675_0001138 3300047444 Bacteria 16160
508 Ga0495675_0038535 3300047444 Unclassified 3043
509 Ga0495675_0041056 3300047444 Bacteria 2948
510 Ga0495675_0099853 3300047444 Bacteria 1817
511 Ga0495684_0000095 3300047471 Bacteria 62460
512 Ga0495593_0000143 3300047673 Bacteria 34902
513 Ga0495602_0000688 3300048088 Bacteria 31774
514 Ga0495602_0048060 3300048088 Bacteria 3839
515 Ga0495602_0061120 3300048088 Bacteria 3278
516 Ga0495614_0000161 3300048089 Bacteria 24540
517 Ga0496101_0143272 3300048904 Bacteria 1823
518 Ga0496101_0502356 3300048904 Bacteria 958
519 Ga0496102_0798001 3300048905 Unclassified 866
520 Ga0496104_0278796 3300048907 Bacteria 1585
521 Ga0496104_0370405 3300048907 Bacteria 1345
522 Ga0496108_0102276 3300048911 Bacteria 2445
523 Ga0496109_0032090 3300048912 Bacteria 4718
524 Ga0496109_0388215 3300048912 Bacteria 1319
525 Ga0496112_0005678 3300048915 Bacteria 10839
526 Ga0496112_0055567 3300048915 Bacteria 3893
527 Ga0496113_0081087 3300048916 Bacteria 2486
528 Ga0496114_0119024 3300048917 Bacteria 2270
529 Ga0496115_0003739 3300048918 Bacteria 10943
530 Ga0496115_0071828 3300048918 Bacteria 2807
531 Ga0501031_0101932 3300049568 Bacteria 1873
532 Ga0501031_0120791 3300049568 Bacteria 1711
533 Ga0501031_0155984 3300049568 Bacteria 1492
534 Ga0501032_0075454 3300049569 Bacteria 2246
535 Ga0501033_0041493 3300049570 Bacteria 3433
536 Ga0501033_0122675 3300049570 Bacteria 1885
537 Ga0501034_0005074 3300049571 Bacteria 14463
538 Ga0501034_0014900 3300049571 Bacteria 7995
539 Ga0501034_0047216 3300049571 Bacteria 4350
540 Ga0501034_0149448 3300049571 Bacteria 2312
541 Ga0501034_0483728 3300049571 Bacteria 1153
542 Ga0501037_0264796 3300049573 Bacteria 1201
543 Ga0501038_0297272 3300049574 Bacteria 1268
544 Ga0501038_0323138 3300049574 Bacteria 1207
545 Ga0501039_0031298 3300049575 Bacteria 4101
546 Ga0501040_0061264 3300049576 Bacteria 2587
547 Ga0501040_0076455 3300049576 Bacteria 2315
548 Ga0501041_0132068 3300049577 Bacteria 1555
549 Ga0501043_0119960 3300049579 Bacteria 2062
550 Ga0501043_0187678 3300049579 Bacteria 1609
551 Ga0501046_0102966 3300049580 Bacteria 2189
552 Ga0501046_0241602 3300049580 Bacteria 1332
553 Ga0501047_0383632 3300049581 Bacteria 1239
554 Ga0501067_0002954 3300049583 Bacteria 9379
555 Ga0501067_0050810 3300049583 Unclassified 2298
556 Ga0501068_0000074 3300049584 Bacteria 39863
557 Ga0501068_0001594 3300049584 Bacteria 12075
558 Ga0501068_0186584 3300049584 Bacteria 1312
559 Ga0501070_0024348 3300049586 Bacteria 5078
560 Ga0501070_0026407 3300049586 Bacteria 4870
561 Ga0501070_0034008 3300049586 Bacteria 4264
562 Ga0501070_0139753 3300049586 Bacteria 2000
563 Ga0501070_0250891 3300049586 Bacteria 1447
564 Ga0501071_0000681 3300049587 Bacteria 17772
565 Ga0501071_0015162 3300049587 Bacteria 5286
566 Ga0501072_0001150 3300049588 Bacteria 19668
567 Ga0501072_0122008 3300049588 Bacteria 2076
568 Ga0501073_0039337 3300049589 Bacteria 3350
569 Ga0501073_0087885 3300049589 Bacteria 2161
570 Ga0501074_0000195 3300049590 Bacteria 32910
571 Ga0501074_0488565 3300049590 Unclassified 872
572 Ga0501075_0121160 3300049591 Bacteria 1991
573 Ga0501075_0170213 3300049591 Bacteria 1662
574 Ga0501076_0084236 3300049592 Bacteria 2554
575 Ga0501076_0433835 3300049592 Bacteria 1081
576 Ga0501077_0084236 3300049593 Bacteria 2015
577 Ga0501077_0202105 3300049593 Bacteria 1262
578 Ga0501079_0024821 3300049741 Bacteria 4599
579 Ga0501080_0016056 3300049742 Bacteria 6911
580 Ga0501080_0112794 3300049742 Bacteria 2520
581 Ga0501080_0151688 3300049742 Bacteria 2142
582 Ga0501080_0207286 3300049742 Bacteria 1797
583 Ga0501080_0463557 3300049742 Bacteria 1135
584 Ga0501081_0032545 3300049743 Bacteria 3537
585 Ga0501081_0193605 3300049743 Bacteria 1473
586 Ga0501083_0003815 3300049744 Bacteria 10588
587 Ga0501083_0004745 3300049744 Bacteria 9602
588 Ga0501044_0027201 3300049823 Bacteria 6047
589 Ga0501044_0315051 3300049823 Bacteria 1490
590 Ga0501045_0094400 3300049824 Bacteria 2212
591 Ga0501045_0293250 3300049824 Bacteria 1210
592 nmdc:mga0qj67_12034_c1 3300050509 Bacteria 6503
593 nmdc:mga0qj67_12394_c1 3300050509 Bacteria 6422
594 nmdc:mga06r32_239985_c1 3300050510 Bacteria 1800
595 nmdc:mga08y16_24786_c1 3300050511 Bacteria 6330
596 nmdc:mga0n895_46894_c1 3300050512 Bacteria 4223
597 nmdc:mga0n895_65262_c1 3300050512 Bacteria 3603
598 nmdc:mga0rr50_417148_c1 3300050513 Bacteria 1135
599 nmdc:mga08x19_263719_c1 3300050514 Bacteria 1191
600 nmdc:mga08x19_61796_c1 3300050514 Bacteria 2428
601 nmdc:mga0a205_119051_c1 3300050515 Bacteria 2539
602 Ga0495601_0112050 3300053077 Bacteria 1767
603 Ga0495612_0024619 3300053078 Unclassified 2416
604 Ga0495612_0025707 3300053078 Bacteria 2364
605 Ga0495595_0023999 3300053084 Bacteria 2690
606 Ga0495619_0001382 3300053085 Bacteria 15960
607 Ga0495619_0051986 3300053085 Bacteria 2708
608 Ga0495619_0093492 3300053085 Unclassified 2038
609 Ga0501084_0305159 3300054114 Bacteria 1344
610 Ga0501084_0322691 3300054114 Unclassified 1304
611 Ga0501082_0027373 3300060353 Bacteria 4907
612 Ga0501082_0029763 3300060353 Bacteria 4704
613 Ga0501082_0052797 3300060353 Bacteria 3504
614 Ga0501082_0072225 3300060353 Bacteria 2972
615 Ga0530510_0435586 3300061734 Bacteria 990

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049590 Ga0501074_0488565 Ga0501074_0488565_11_742 238
2 3300054114 Ga0501084_0305159 Ga0501084_0305159_58_798 241
3 3300049742 Ga0501080_0016056 Ga0501080_0016056_5167_6063 257
4 3300054114 Ga0501084_0322691 Ga0501084_0322691_11_907 257
5 3300047318 Ga0495636_0039180 Ga0495636_0039180_1120_1914 259
6 3300048905 Ga0496102_0798001 Ga0496102_0798001_40_834 259
7 3300049584 Ga0501068_0000074 Ga0501068_0000074_19134_19946 265
8 3300049587 Ga0501071_0000681 Ga0501071_0000681_12054_12866 265
9 3300049743 Ga0501081_0193605 Ga0501081_0193605_229_1041 265
10 3300060353 Ga0501082_0029763 Ga0501082_0029763_332_1144 265
11 3300046472 Ga0495580_0128236 Ga0495580_0128236_426_1322 274
12 3300045836 Ga0466958_0076987 Ga0466958_0076987_74_946 276
13 3300049568 Ga0501031_0101932 Ga0501031_0101932_206_1102 276
14 3300049570 Ga0501033_0122675 Ga0501033_0122675_791_1687 276
15 3300049574 Ga0501038_0297272 Ga0501038_0297272_158_1054 276
16 3300049576 Ga0501040_0076455 Ga0501040_0076455_852_1748 276
17 3300049579 Ga0501043_0187678 Ga0501043_0187678_576_1472 276
18 3300049592 Ga0501076_0084236 Ga0501076_0084236_797_1693 276
19 3300049593 Ga0501077_0084236 Ga0501077_0084236_690_1586 276
20 3300049741 Ga0501079_0024821 Ga0501079_0024821_3580_4476 276
21 3300049824 Ga0501045_0293250 Ga0501045_0293250_79_975 276
22 3300060353 Ga0501082_0072225 Ga0501082_0072225_1863_2759 276
23 3300061734 Ga0530510_0435586 Ga0530510_0435586_43_939 276
24 3300005458 Ga0070681_10016973 Ga0070681_100169736 278
25 3300005547 Ga0070693_100015117 Ga0070693_1000151174 278
26 3300025912 Ga0207707_10079337 Ga0207707_100793374 278
27 3300014326 Ga0157380_10261827 Ga0157380_102618273 279
28 3300005336 Ga0070680_100014934 Ga0070680_1000149346 282
29 3300005458 Ga0070681_10106087 Ga0070681_101060872 282
30 3300005530 Ga0070679_100066673 Ga0070679_1000666735 282
31 3300005547 Ga0070693_100236923 Ga0070693_1002369232 282
32 3300025912 Ga0207707_10015396 Ga0207707_100153967 282
33 3300025917 Ga0207660_10012132 Ga0207660_100121326 282
34 3300025921 Ga0207652_10004128 Ga0207652_100041288 282
35 3300049568 Ga0501031_0120791 Ga0501031_0120791_641_1537 282
36 3300049571 Ga0501034_0005074 Ga0501034_0005074_7441_8304 282
37 3300049577 Ga0501041_0132068 Ga0501041_0132068_466_1362 282
38 3300049583 Ga0501067_0002954 Ga0501067_0002954_7281_8144 282
39 3300049584 Ga0501068_0001594 Ga0501068_0001594_474_1337 282
40 3300049586 Ga0501070_0250891 Ga0501070_0250891_38_901 282
41 3300049587 Ga0501071_0015162 Ga0501071_0015162_4262_5125 282
42 3300049588 Ga0501072_0001150 Ga0501072_0001150_533_1396 282
43 3300049589 Ga0501073_0039337 Ga0501073_0039337_1362_2225 282
44 3300049591 Ga0501075_0170213 Ga0501075_0170213_465_1361 282
45 3300049592 Ga0501076_0433835 Ga0501076_0433835_36_932 282
46 3300049742 Ga0501080_0207286 Ga0501080_0207286_490_1353 282
47 3300049744 Ga0501083_0004745 Ga0501083_0004745_1740_2603 282
48 3300060353 Ga0501082_0027373 Ga0501082_0027373_2125_2988 282
49 3300005530 Ga0070679_100523171 Ga0070679_1005231711 284
50 3300025921 Ga0207652_10373285 Ga0207652_103732851 284
51 3300021384 Ga0213876_10002895 Ga0213876_100028953 285
52 3300039437 Ga0436365_1566279 Ga0436365_1566279_6553_7551 285
53 3300005518 Ga0070699_100064740 Ga0070699_1000647401 286
54 3300049742 Ga0501080_0151688 Ga0501080_0151688_936_1832 287
55 3300005548 Ga0070665_100050932 Ga0070665_1000509324 290
56 3300028379 Ga0268266_10055399 Ga0268266_100553993 290
57 3300005334 Ga0068869_100022207 Ga0068869_1000222071 291
58 3300005339 Ga0070660_100064485 Ga0070660_1000644855 291
59 3300005347 Ga0070668_100134395 Ga0070668_1001343951 291
60 3300005353 Ga0070669_100025846 Ga0070669_1000258464 291
61 3300005367 Ga0070667_100020670 Ga0070667_1000206706 291
62 3300005456 Ga0070678_100004646 Ga0070678_1000046461 291
63 3300005471 Ga0070698_100041842 Ga0070698_1000418426 291
64 3300005518 Ga0070699_100003804 Ga0070699_1000038042 291
65 3300005545 Ga0070695_100012797 Ga0070695_1000127977 291
66 3300005546 Ga0070696_100028078 Ga0070696_1000280786 291
67 3300005547 Ga0070693_100060264 Ga0070693_1000602641 291
68 3300005563 Ga0068855_100497731 Ga0068855_1004977311 291
69 3300005578 Ga0068854_100007214 Ga0068854_1000072145 291
70 3300005616 Ga0068852_100308835 Ga0068852_1003088351 291
71 3300005618 Ga0068864_100124045 Ga0068864_1001240453 291
72 3300005718 Ga0068866_10000069 Ga0068866_1000006925 291
73 3300005719 Ga0068861_100022430 Ga0068861_1000224307 291
74 3300005842 Ga0068858_100126379 Ga0068858_1001263792 291
75 3300005844 Ga0068862_100124231 Ga0068862_1001242312 291
76 3300006237 Ga0097621_100063602 Ga0097621_1000636024 291
77 3300006881 Ga0068865_100047716 Ga0068865_1000477162 291
78 3300009148 Ga0105243_10102681 Ga0105243_101026815 291
79 3300009174 Ga0105241_10041960 Ga0105241_100419603 291
80 3300009176 Ga0105242_10002701 Ga0105242_100027019 291
81 3300009177 Ga0105248_10000553 Ga0105248_1000055317 291
82 3300010375 Ga0105239_10042753 Ga0105239_100427532 291
83 3300013297 Ga0157378_10024116 Ga0157378_100241162 291
84 3300013306 Ga0163162_10068549 Ga0163162_100685494 291
85 3300013306 Ga0163162_10088838 Ga0163162_100888381 291
86 3300014326 Ga0157380_10122824 Ga0157380_101228244 291
87 3300025907 Ga0207645_10003450 Ga0207645_100034507 291
88 3300025908 Ga0207643_10001798 Ga0207643_100017989 291
89 3300025917 Ga0207660_10382156 Ga0207660_103821561 291
90 3300025922 Ga0207646_10042279 Ga0207646_100422796 291
91 3300025933 Ga0207706_10000025 Ga0207706_1000002534 291
92 3300025934 Ga0207686_10000686 Ga0207686_100006861 291
93 3300025937 Ga0207669_10000317 Ga0207669_1000031716 291
94 3300025938 Ga0207704_10013066 Ga0207704_100130666 291
95 3300025940 Ga0207691_10053494 Ga0207691_100534942 291
96 3300025941 Ga0207711_10002951 Ga0207711_100029511 291
97 3300025942 Ga0207689_10547667 Ga0207689_105476671 291
98 3300025961 Ga0207712_10153227 Ga0207712_101532271 291
99 3300025961 Ga0207712_10489983 Ga0207712_104899831 291
100 3300025972 Ga0207668_10184636 Ga0207668_101846363 291
101 3300026075 Ga0207708_10027300 Ga0207708_100273001 291
102 3300026075 Ga0207708_10076639 Ga0207708_100766394 291
103 3300026089 Ga0207648_10000138 Ga0207648_1000013830 291
104 3300026118 Ga0207675_100044595 Ga0207675_1000445952 291
105 3300026121 Ga0207683_10008478 Ga0207683_100084789 291
106 3300046492 Ga0495585_0176088 Ga0495585_0176088_26_919 291
107 3300048904 Ga0496101_0502356 Ga0496101_0502356_11_904 291
108 3300006844 Ga0075428_100091397 Ga0075428_1000913975 292
109 3300009147 Ga0114129_10553021 Ga0114129_105530211 292
110 3300031852 Ga0307410_10033129 Ga0307410_100331296 292
111 3300031995 Ga0307409_100136003 Ga0307409_1001360035 292
112 3300032005 Ga0307411_10213575 Ga0307411_102135753 292
113 3300044672 Ga0466982_0000012 Ga0466982_0000012_70097_71011 292
114 3300049571 Ga0501034_0014900 Ga0501034_0014900_2903_3835 292
115 3300049571 Ga0501034_0149448 Ga0501034_0149448_517_1413 292
116 3300049586 Ga0501070_0026407 Ga0501070_0026407_3428_4324 292
117 3300049586 Ga0501070_0139753 Ga0501070_0139753_567_1463 292
118 3300049588 Ga0501072_0122008 Ga0501072_0122008_1000_1896 292
119 3300049590 Ga0501074_0000195 Ga0501074_0000195_3803_4699 292
120 3300049744 Ga0501083_0003815 Ga0501083_0003815_3300_4196 292
121 3300005458 Ga0070681_10117006 Ga0070681_101170063 295
122 3300005546 Ga0070696_100000464 Ga0070696_10000046414 295
123 3300007076 Ga0075435_100197035 Ga0075435_1001970352 295
124 3300005340 Ga0070689_100279796 Ga0070689_1002797962 298
125 3300005364 Ga0070673_100117736 Ga0070673_1001177362 298
126 3300005367 Ga0070667_100130057 Ga0070667_1001300572 298
127 3300006871 Ga0075434_100139367 Ga0075434_1001393672 298
128 3300007076 Ga0075435_100459063 Ga0075435_1004590631 298
129 3300013296 Ga0157374_10032888 Ga0157374_100328884 298
130 3300026089 Ga0207648_10089690 Ga0207648_100896902 298
131 3300050512 nmdc:mga0n895_46894_c1 nmdc:mga0n895_46894_c1_2848_3771 298
132 3300005327 Ga0070658_10002354 Ga0070658_100023547 299
133 3300005327 Ga0070658_10146947 Ga0070658_101469472 299
134 3300005329 Ga0070683_100021736 Ga0070683_1000217363 299
135 3300005336 Ga0070680_100066100 Ga0070680_1000661001 299
136 3300005458 Ga0070681_10000838 Ga0070681_100008389 299
137 3300005530 Ga0070679_100002461 Ga0070679_1000024616 299
138 3300005535 Ga0070684_100051342 Ga0070684_1000513421 299
139 3300005535 Ga0070684_100169308 Ga0070684_1001693081 299
140 3300005543 Ga0070672_100099536 Ga0070672_1000995363 299
141 3300005614 Ga0068856_100126498 Ga0068856_1001264981 299
142 3300005616 Ga0068852_100005832 Ga0068852_1000058324 299
143 3300009551 Ga0105238_10022967 Ga0105238_100229674 299
144 3300013105 Ga0157369_10010539 Ga0157369_100105398 299
145 3300013105 Ga0157369_10012404 Ga0157369_100124042 299
146 3300013105 Ga0157369_10205921 Ga0157369_102059212 299
147 3300013307 Ga0157372_10014644 Ga0157372_100146448 299
148 3300013307 Ga0157372_10027724 Ga0157372_100277244 299
149 3300013307 Ga0157372_10068787 Ga0157372_100687871 299
150 3300013307 Ga0157372_10073978 Ga0157372_100739784 299
151 3300013308 Ga0157375_10142680 Ga0157375_101426802 299
152 3300020082 Ga0206353_11313939 Ga0206353_113139392 299
153 3300025909 Ga0207705_10145629 Ga0207705_101456292 299
154 3300025912 Ga0207707_10001488 Ga0207707_1000148810 299
155 3300025916 Ga0207663_10070036 Ga0207663_100700363 299
156 3300025917 Ga0207660_10001988 Ga0207660_100019886 299
157 3300025921 Ga0207652_10001470 Ga0207652_1000147010 299
158 3300025940 Ga0207691_10004930 Ga0207691_1000493012 299
159 3300025944 Ga0207661_10027382 Ga0207661_100273822 299
160 3300026078 Ga0207702_10043357 Ga0207702_100433574 299
161 3300026142 Ga0207698_10102856 Ga0207698_101028562 299
162 3300031548 Ga0307408_100092000 Ga0307408_1000920002 299
163 3300031731 Ga0307405_10247617 Ga0307405_102476171 299
164 3300031852 Ga0307410_10171805 Ga0307410_101718052 299
165 3300031901 Ga0307406_10280815 Ga0307406_102808152 299
166 3300031903 Ga0307407_10133188 Ga0307407_101331881 299
167 3300031911 Ga0307412_10055616 Ga0307412_100556162 299
168 3300031995 Ga0307409_100140988 Ga0307409_1001409882 299
169 3300032002 Ga0307416_100103057 Ga0307416_1001030573 299
170 3300032126 Ga0307415_100288031 Ga0307415_1002880311 299
171 3300035086 Ga0373934_0002058 Ga0373934_0002058_273_1205 299
172 3300035111 Ga0373923_0007802 Ga0373923_0007802_70_1002 299
173 3300035117 Ga0373953_0009868 Ga0373953_0009868_562_1494 299
174 3300035691 Ga0373931_0092342 Ga0373931_0092342_682_1608 299
175 3300035725 Ga0373947_0066314 Ga0373947_0066314_576_1508 299
176 3300036401 Ga0373937_0046193 Ga0373937_0046193_745_1677 299
177 3300036401 Ga0373937_0070839 Ga0373937_0070839_1333_2265 299
178 3300037068 Ga0373925_0017735 Ga0373925_0017735_62_994 299
179 3300039437 Ga0436365_1447060 Ga0436365_1447060_49_975 299
180 3300039437 Ga0436365_1476038 Ga0436365_1476038_734_1660 299
181 3300042876 Ga0451577_0006931 Ga0451577_0006931_2918_3844 299
182 3300044712 Ga0453684_0000294 Ga0453684_0000294_191025_191951 299
183 3300044712 Ga0453684_0165009 Ga0453684_0165009_1197_2123 299
184 3300046459 Ga0495629_0022218 Ga0495629_0022218_2033_2965 299
185 3300046463 Ga0495653_0020548 Ga0495653_0020548_189_1121 299
186 3300046472 Ga0495580_0007638 Ga0495580_0007638_2074_3006 299
187 3300046499 Ga0495594_0005911 Ga0495594_0005911_360_1292 299
188 3300046511 Ga0495608_0012711 Ga0495608_0012711_3559_4491 299
189 3300046511 Ga0495608_0192428 Ga0495608_0192428_15_947 299
190 3300046514 Ga0495618_0078577 Ga0495618_0078577_560_1492 299
191 3300046517 Ga0495630_0023200 Ga0495630_0023200_259_1191 299
192 3300046526 Ga0495666_0012944 Ga0495666_0012944_1404_2336 299
193 3300046529 Ga0495652_0002191 Ga0495652_0002191_2155_3087 299
194 3300046535 Ga0495586_0015045 Ga0495586_0015045_2334_3266 299
195 3300046536 Ga0495587_0001170 Ga0495587_0001170_13270_14202 299
196 3300046543 Ga0495645_0000547 Ga0495645_0000547_14649_15581 299
197 3300046543 Ga0495645_0137036 Ga0495645_0137036_230_1156 299
198 3300046543 Ga0495645_0187764 Ga0495645_0187764_205_1131 299
199 3300046559 Ga0495667_0030412 Ga0495667_0030412_391_1323 299
200 3300046678 Ga0495599_0003528 Ga0495599_0003528_490_1422 299
201 3300046679 Ga0495623_0028000 Ga0495623_0028000_2306_3238 299
202 3300047317 Ga0495604_0018743 Ga0495604_0018743_2475_3407 299
203 3300047320 Ga0495672_0004112 Ga0495672_0004112_6729_7685 299
204 3300047444 Ga0495675_0038535 Ga0495675_0038535_105_1037 299
205 3300047444 Ga0495675_0041056 Ga0495675_0041056_1923_2855 299
206 3300048088 Ga0495602_0048060 Ga0495602_0048060_1830_2762 299
207 3300048088 Ga0495602_0061120 Ga0495602_0061120_2306_3238 299
208 3300048907 Ga0496104_0370405 Ga0496104_0370405_210_1136 299
209 3300048912 Ga0496109_0032090 Ga0496109_0032090_2367_3293 299
210 3300048915 Ga0496112_0005678 Ga0496112_0005678_6590_7516 299
211 3300048916 Ga0496113_0081087 Ga0496113_0081087_865_1791 299
212 3300049570 Ga0501033_0041493 Ga0501033_0041493_904_1830 299
213 3300049571 Ga0501034_0047216 Ga0501034_0047216_771_1697 299
214 3300049571 Ga0501034_0483728 Ga0501034_0483728_181_1137 299
215 3300049586 Ga0501070_0034008 Ga0501070_0034008_3171_4097 299
216 3300049589 Ga0501073_0087885 Ga0501073_0087885_826_1752 299
217 3300049823 Ga0501044_0027201 Ga0501044_0027201_208_1134 299
218 3300053078 Ga0495612_0024619 Ga0495612_0024619_437_1369 299
219 3300053085 Ga0495619_0051986 Ga0495619_0051986_204_1136 299
220 3300053085 Ga0495619_0093492 Ga0495619_0093492_1070_2002 299
221 3300005327 Ga0070658_10064669 Ga0070658_100646693 300
222 3300005327 Ga0070658_10428545 Ga0070658_104285452 300
223 3300005328 Ga0070676_10040675 Ga0070676_100406753 300
224 3300005329 Ga0070683_100010567 Ga0070683_1000105672 300
225 3300005329 Ga0070683_100046459 Ga0070683_1000464593 300
226 3300005329 Ga0070683_100125742 Ga0070683_1001257422 300
227 3300005329 Ga0070683_100407893 Ga0070683_1004078931 300
228 3300005331 Ga0070670_100012711 Ga0070670_1000127116 300
229 3300005336 Ga0070680_100025277 Ga0070680_1000252771 300
230 3300005339 Ga0070660_100008136 Ga0070660_1000081365 300
231 3300005339 Ga0070660_100012191 Ga0070660_1000121914 300
232 3300005339 Ga0070660_100056719 Ga0070660_1000567193 300
233 3300005344 Ga0070661_100001621 Ga0070661_1000016217 300
234 3300005344 Ga0070661_100039749 Ga0070661_1000397494 300
235 3300005347 Ga0070668_100023636 Ga0070668_1000236363 300
236 3300005353 Ga0070669_100018006 Ga0070669_1000180066 300
237 3300005354 Ga0070675_100018662 Ga0070675_1000186624 300
238 3300005354 Ga0070675_100387576 Ga0070675_1003875761 300
239 3300005355 Ga0070671_100036922 Ga0070671_1000369224 300
240 3300005356 Ga0070674_100021122 Ga0070674_1000211224 300
241 3300005364 Ga0070673_100019055 Ga0070673_1000190553 300
242 3300005364 Ga0070673_100177518 Ga0070673_1001775181 300
243 3300005366 Ga0070659_100049345 Ga0070659_1000493454 300
244 3300005366 Ga0070659_100094830 Ga0070659_1000948302 300
245 3300005366 Ga0070659_100098279 Ga0070659_1000982792 300
246 3300005366 Ga0070659_100133951 Ga0070659_1001339512 300
247 3300005367 Ga0070667_100060093 Ga0070667_1000600933 300
248 3300005367 Ga0070667_100136265 Ga0070667_1001362651 300
249 3300005435 Ga0070714_100002900 Ga0070714_1000029009 300
250 3300005455 Ga0070663_100023831 Ga0070663_1000238315 300
251 3300005458 Ga0070681_10000845 Ga0070681_100008452 300
252 3300005458 Ga0070681_10145058 Ga0070681_101450581 300
253 3300005459 Ga0068867_100042096 Ga0068867_1000420963 300
254 3300005466 Ga0070685_10020078 Ga0070685_100200784 300
255 3300005468 Ga0070707_100084177 Ga0070707_1000841773 300
256 3300005471 Ga0070698_100021816 Ga0070698_1000218165 300
257 3300005518 Ga0070699_100063536 Ga0070699_1000635364 300
258 3300005530 Ga0070679_100020200 Ga0070679_1000202006 300
259 3300005530 Ga0070679_100031797 Ga0070679_1000317972 300
260 3300005530 Ga0070679_100054951 Ga0070679_1000549514 300
261 3300005530 Ga0070679_100198702 Ga0070679_1001987021 300
262 3300005535 Ga0070684_100034253 Ga0070684_1000342534 300
263 3300005539 Ga0068853_100040545 Ga0068853_1000405455 300
264 3300005563 Ga0068855_100017339 Ga0068855_1000173396 300
265 3300005564 Ga0070664_100001432 Ga0070664_10000143210 300
266 3300005564 Ga0070664_100051351 Ga0070664_1000513514 300
267 3300005564 Ga0070664_100130188 Ga0070664_1001301883 300
268 3300005564 Ga0070664_100134498 Ga0070664_1001344984 300
269 3300005577 Ga0068857_100000356 Ga0068857_1000003566 300
270 3300005614 Ga0068856_100413995 Ga0068856_1004139952 300
271 3300005616 Ga0068852_100025667 Ga0068852_1000256675 300
272 3300005616 Ga0068852_100030124 Ga0068852_1000301241 300
273 3300005617 Ga0068859_100006842 Ga0068859_10000684210 300
274 3300005718 Ga0068866_10058572 Ga0068866_100585722 300
275 3300006846 Ga0075430_100035238 Ga0075430_1000352384 300
276 3300006847 Ga0075431_100073370 Ga0075431_1000733702 300
277 3300006871 Ga0075434_100022791 Ga0075434_1000227913 300
278 3300006931 Ga0097620_100006842 Ga0097620_10000684210 300
279 3300009093 Ga0105240_10030293 Ga0105240_100302934 300
280 3300009094 Ga0111539_10079978 Ga0111539_100799783 300
281 3300009147 Ga0114129_10109937 Ga0114129_101099374 300
282 3300009177 Ga0105248_10285525 Ga0105248_102855251 300
283 3300009551 Ga0105238_10080977 Ga0105238_100809773 300
284 3300013104 Ga0157370_10046177 Ga0157370_100461773 300
285 3300013105 Ga0157369_10093706 Ga0157369_100937063 300
286 3300013307 Ga0157372_10047288 Ga0157372_100472885 300
287 3300013307 Ga0157372_10133149 Ga0157372_101331492 300
288 3300013307 Ga0157372_10651514 Ga0157372_106515141 300
289 3300013308 Ga0157375_10036261 Ga0157375_100362614 300
290 3300014497 Ga0182008_10000770 Ga0182008_1000077013 300
291 3300025907 Ga0207645_10053606 Ga0207645_100536063 300
292 3300025908 Ga0207643_10031666 Ga0207643_100316662 300
293 3300025909 Ga0207705_10076617 Ga0207705_100766171 300
294 3300025909 Ga0207705_10080073 Ga0207705_100800734 300
295 3300025909 Ga0207705_10095823 Ga0207705_100958231 300
296 3300025912 Ga0207707_10000583 Ga0207707_1000058323 300
297 3300025912 Ga0207707_10034668 Ga0207707_100346682 300
298 3300025917 Ga0207660_10011444 Ga0207660_100114444 300
299 3300025919 Ga0207657_10017664 Ga0207657_100176646 300
300 3300025919 Ga0207657_10035171 Ga0207657_100351713 300
301 3300025920 Ga0207649_10003595 Ga0207649_100035952 300
302 3300025920 Ga0207649_10077084 Ga0207649_100770842 300
303 3300025921 Ga0207652_10041231 Ga0207652_100412312 300
304 3300025921 Ga0207652_10051125 Ga0207652_100511254 300
305 3300025921 Ga0207652_10129676 Ga0207652_101296762 300
306 3300025923 Ga0207681_10006238 Ga0207681_100062384 300
307 3300025924 Ga0207694_10031485 Ga0207694_100314852 300
308 3300025925 Ga0207650_10003064 Ga0207650_100030646 300
309 3300025926 Ga0207659_10006807 Ga0207659_100068074 300
310 3300025929 Ga0207664_10009705 Ga0207664_100097054 300
311 3300025932 Ga0207690_10077845 Ga0207690_100778453 300
312 3300025932 Ga0207690_10146917 Ga0207690_101469172 300
313 3300025933 Ga0207706_10330581 Ga0207706_103305812 300
314 3300025934 Ga0207686_10036320 Ga0207686_100363203 300
315 3300025940 Ga0207691_10002572 Ga0207691_100025724 300
316 3300025940 Ga0207691_10030204 Ga0207691_100302043 300
317 3300025941 Ga0207711_10086900 Ga0207711_100869003 300
318 3300025944 Ga0207661_10013320 Ga0207661_100133204 300
319 3300025945 Ga0207679_10002534 Ga0207679_100025345 300
320 3300025945 Ga0207679_10051669 Ga0207679_100516694 300
321 3300025945 Ga0207679_10112302 Ga0207679_101123023 300
322 3300025945 Ga0207679_10171019 Ga0207679_101710192 300
323 3300025949 Ga0207667_10059647 Ga0207667_100596472 300
324 3300025949 Ga0207667_10424681 Ga0207667_104246811 300
325 3300025960 Ga0207651_10024463 Ga0207651_100244631 300
326 3300025981 Ga0207640_10010347 Ga0207640_100103474 300
327 3300025986 Ga0207658_10035149 Ga0207658_100351494 300
328 3300025986 Ga0207658_10140280 Ga0207658_101402803 300
329 3300026067 Ga0207678_10148420 Ga0207678_101484203 300
330 3300026078 Ga0207702_10525068 Ga0207702_105250682 300
331 3300026089 Ga0207648_10022381 Ga0207648_100223814 300
332 3300026089 Ga0207648_10187247 Ga0207648_101872472 300
333 3300026116 Ga0207674_10000761 Ga0207674_1000076121 300
334 3300026116 Ga0207674_10027590 Ga0207674_100275907 300
335 3300026121 Ga0207683_10356181 Ga0207683_103561811 300
336 3300027360 Ga0209969_1003052 Ga0209969_10030524 300
337 3300027695 Ga0209966_1003067 Ga0209966_10030674 300
338 3300031548 Ga0307408_100008051 Ga0307408_1000080511 300
339 3300031548 Ga0307408_100027190 Ga0307408_1000271903 300
340 3300031548 Ga0307408_100117829 Ga0307408_1001178292 300
341 3300031731 Ga0307405_10008799 Ga0307405_100087995 300
342 3300031731 Ga0307405_10009049 Ga0307405_100090493 300
343 3300031731 Ga0307405_10085742 Ga0307405_100857422 300
344 3300031731 Ga0307405_10137272 Ga0307405_101372722 300
345 3300031824 Ga0307413_10000895 Ga0307413_100008955 300
346 3300031824 Ga0307413_10078198 Ga0307413_100781982 300
347 3300031824 Ga0307413_10136295 Ga0307413_101362952 300
348 3300031852 Ga0307410_10003621 Ga0307410_100036213 300
349 3300031852 Ga0307410_10096474 Ga0307410_100964742 300
350 3300031852 Ga0307410_10140067 Ga0307410_101400672 300
351 3300031852 Ga0307410_10149064 Ga0307410_101490642 300
352 3300031901 Ga0307406_10003655 Ga0307406_100036553 300
353 3300031901 Ga0307406_10004115 Ga0307406_100041156 300
354 3300031901 Ga0307406_10004952 Ga0307406_100049525 300
355 3300031903 Ga0307407_10014966 Ga0307407_100149664 300
356 3300031903 Ga0307407_10020047 Ga0307407_100200474 300
357 3300031911 Ga0307412_10014508 Ga0307412_100145083 300
358 3300031995 Ga0307409_100115906 Ga0307409_1001159062 300
359 3300031995 Ga0307409_100164568 Ga0307409_1001645682 300
360 3300031995 Ga0307409_100235026 Ga0307409_1002350262 300
361 3300031995 Ga0307409_100365380 Ga0307409_1003653801 300
362 3300031995 Ga0307409_100468594 Ga0307409_1004685942 300
363 3300032002 Ga0307416_100005463 Ga0307416_1000054633 300
364 3300032002 Ga0307416_100031678 Ga0307416_1000316783 300
365 3300032002 Ga0307416_100103542 Ga0307416_1001035422 300
366 3300032002 Ga0307416_100127391 Ga0307416_1001273911 300
367 3300032002 Ga0307416_100423096 Ga0307416_1004230962 300
368 3300032004 Ga0307414_10012092 Ga0307414_100120923 300
369 3300032004 Ga0307414_10022178 Ga0307414_100221782 300
370 3300032005 Ga0307411_10009578 Ga0307411_100095782 300
371 3300032005 Ga0307411_10011083 Ga0307411_100110834 300
372 3300032126 Ga0307415_100003013 Ga0307415_1000030135 300
373 3300032126 Ga0307415_100056355 Ga0307415_1000563552 300
374 3300032126 Ga0307415_100063272 Ga0307415_1000632722 300
375 3300032126 Ga0307415_100130980 Ga0307415_1001309802 300
376 3300036401 Ga0373937_0166201 Ga0373937_0166201_161_1096 300
377 3300042876 Ga0451577_0000001 Ga0451577_0000001_647665_648591 300
378 3300042876 Ga0451577_0183988 Ga0451577_0183988_237_1169 300
379 3300044693 Ga0466961_0093273 Ga0466961_0093273_852_1781 300
380 3300044706 Ga0466964_0157256 Ga0466964_0157256_106_1032 300
381 3300046531 Ga0495665_0210652 Ga0495665_0210652_34_960 300
382 3300047444 Ga0495675_0099853 Ga0495675_0099853_241_1176 300
383 3300048907 Ga0496104_0278796 Ga0496104_0278796_247_1182 300
384 3300049569 Ga0501032_0075454 Ga0501032_0075454_1114_2046 300
385 3300049579 Ga0501043_0119960 Ga0501043_0119960_108_1043 300
386 3300049580 Ga0501046_0102966 Ga0501046_0102966_212_1147 300
387 3300049581 Ga0501047_0383632 Ga0501047_0383632_227_1162 300
388 3300049583 Ga0501067_0050810 Ga0501067_0050810_814_1740 300
389 3300049586 Ga0501070_0024348 Ga0501070_0024348_3948_4883 300
390 3300049742 Ga0501080_0112794 Ga0501080_0112794_51_977 300
391 3300049742 Ga0501080_0463557 Ga0501080_0463557_96_1022 300
392 3300049823 Ga0501044_0315051 Ga0501044_0315051_122_1057 300
393 3300050509 nmdc:mga0qj67_12034_c1 nmdc:mga0qj67_12034_c1_1058_1984 300
394 3300050510 nmdc:mga06r32_239985_c1 nmdc:mga06r32_239985_c1_567_1493 300
395 3300050511 nmdc:mga08y16_24786_c1 nmdc:mga08y16_24786_c1_5160_6086 300
396 3300005331 Ga0070670_100032694 Ga0070670_1000326945 301
397 3300005331 Ga0070670_100063617 Ga0070670_1000636171 301
398 3300005336 Ga0070680_100059214 Ga0070680_1000592142 301
399 3300005339 Ga0070660_100047855 Ga0070660_1000478554 301
400 3300005343 Ga0070687_100013515 Ga0070687_1000135154 301
401 3300005344 Ga0070661_100009120 Ga0070661_1000091205 301
402 3300005344 Ga0070661_100242216 Ga0070661_1002422162 301
403 3300005354 Ga0070675_100001250 Ga0070675_10000125010 301
404 3300005434 Ga0070709_10005361 Ga0070709_100053615 301
405 3300005434 Ga0070709_10005715 Ga0070709_100057156 301
406 3300005435 Ga0070714_100047003 Ga0070714_1000470033 301
407 3300005436 Ga0070713_100000157 Ga0070713_10000015715 301
408 3300005437 Ga0070710_10035114 Ga0070710_100351142 301
409 3300005445 Ga0070708_100078550 Ga0070708_1000785503 301
410 3300005456 Ga0070678_100173786 Ga0070678_1001737861 301
411 3300005457 Ga0070662_100153031 Ga0070662_1001530312 301
412 3300005458 Ga0070681_10017582 Ga0070681_100175826 301
413 3300005458 Ga0070681_10195600 Ga0070681_101956002 301
414 3300005458 Ga0070681_10440311 Ga0070681_104403111 301
415 3300005466 Ga0070685_10145916 Ga0070685_101459162 301
416 3300005467 Ga0070706_100252149 Ga0070706_1002521491 301
417 3300005468 Ga0070707_100053878 Ga0070707_1000538781 301
418 3300005518 Ga0070699_100025162 Ga0070699_1000251623 301
419 3300005530 Ga0070679_100011557 Ga0070679_1000115575 301
420 3300005530 Ga0070679_100016930 Ga0070679_1000169305 301
421 3300005535 Ga0070684_100082581 Ga0070684_1000825814 301
422 3300005546 Ga0070696_100034715 Ga0070696_1000347153 301
423 3300005547 Ga0070693_100032905 Ga0070693_1000329052 301
424 3300005549 Ga0070704_100066780 Ga0070704_1000667803 301
425 3300005563 Ga0068855_100002422 Ga0068855_10000242223 301
426 3300005564 Ga0070664_100016011 Ga0070664_1000160114 301
427 3300005564 Ga0070664_100526060 Ga0070664_1005260601 301
428 3300005577 Ga0068857_100050020 Ga0068857_1000500204 301
429 3300005578 Ga0068854_100086611 Ga0068854_1000866112 301
430 3300005614 Ga0068856_100296308 Ga0068856_1002963081 301
431 3300005617 Ga0068859_100367748 Ga0068859_1003677482 301
432 3300005618 Ga0068864_100105509 Ga0068864_1001055091 301
433 3300005834 Ga0068851_10127024 Ga0068851_101270242 301
434 3300006175 Ga0070712_100020311 Ga0070712_1000203114 301
435 3300006846 Ga0075430_100006281 Ga0075430_1000062817 301
436 3300006871 Ga0075434_100017286 Ga0075434_1000172863 301
437 3300006880 Ga0075429_100051333 Ga0075429_1000513332 301
438 3300006931 Ga0097620_100367739 Ga0097620_1003677392 301
439 3300007076 Ga0075435_100284069 Ga0075435_1002840691 301
440 3300009098 Ga0105245_10030649 Ga0105245_100306492 301
441 3300009098 Ga0105245_10056982 Ga0105245_100569824 301
442 3300009098 Ga0105245_10098428 Ga0105245_100984283 301
443 3300009147 Ga0114129_10688811 Ga0114129_106888111 301
444 3300013297 Ga0157378_10110395 Ga0157378_101103953 301
445 3300013308 Ga0157375_10120780 Ga0157375_101207803 301
446 3300014325 Ga0163163_10006004 Ga0163163_100060042 301
447 3300014326 Ga0157380_10019696 Ga0157380_100196964 301
448 3300014745 Ga0157377_10079634 Ga0157377_100796341 301
449 3300014968 Ga0157379_10036860 Ga0157379_100368604 301
450 3300025321 Ga0207656_10133798 Ga0207656_101337981 301
451 3300025906 Ga0207699_10006412 Ga0207699_100064126 301
452 3300025906 Ga0207699_10017589 Ga0207699_100175895 301
453 3300025907 Ga0207645_10000122 Ga0207645_1000012217 301
454 3300025910 Ga0207684_10081736 Ga0207684_100817363 301
455 3300025912 Ga0207707_10012431 Ga0207707_100124312 301
456 3300025912 Ga0207707_10016173 Ga0207707_100161734 301
457 3300025912 Ga0207707_10222341 Ga0207707_102223412 301
458 3300025913 Ga0207695_10207702 Ga0207695_102077022 301
459 3300025915 Ga0207693_10008288 Ga0207693_100082886 301
460 3300025915 Ga0207693_10017450 Ga0207693_100174505 301
461 3300025917 Ga0207660_10046321 Ga0207660_100463214 301
462 3300025920 Ga0207649_10004384 Ga0207649_100043844 301
463 3300025920 Ga0207649_10229308 Ga0207649_102293081 301
464 3300025921 Ga0207652_10014428 Ga0207652_100144286 301
465 3300025921 Ga0207652_10028743 Ga0207652_100287434 301
466 3300025921 Ga0207652_10312725 Ga0207652_103127252 301
467 3300025922 Ga0207646_10125538 Ga0207646_101255382 301
468 3300025925 Ga0207650_10297902 Ga0207650_102979021 301
469 3300025928 Ga0207700_10001431 Ga0207700_100014317 301
470 3300025929 Ga0207664_10015952 Ga0207664_100159523 301
471 3300025929 Ga0207664_10089627 Ga0207664_100896274 301
472 3300025939 Ga0207665_10000337 Ga0207665_100003374 301
473 3300025944 Ga0207661_10002524 Ga0207661_100025244 301
474 3300025944 Ga0207661_10234176 Ga0207661_102341762 301
475 3300025945 Ga0207679_10007502 Ga0207679_100075025 301
476 3300025945 Ga0207679_10010275 Ga0207679_100102752 301
477 3300025945 Ga0207679_10328120 Ga0207679_103281202 301
478 3300025949 Ga0207667_10057724 Ga0207667_100577244 301
479 3300026023 Ga0207677_10032481 Ga0207677_100324814 301
480 3300026041 Ga0207639_10050387 Ga0207639_100503874 301
481 3300026041 Ga0207639_10063874 Ga0207639_100638742 301
482 3300026067 Ga0207678_10020134 Ga0207678_100201343 301
483 3300026075 Ga0207708_10054179 Ga0207708_100541794 301
484 3300026088 Ga0207641_10212229 Ga0207641_102122292 301
485 3300026116 Ga0207674_10000477 Ga0207674_1000047718 301
486 3300026116 Ga0207674_10026085 Ga0207674_100260854 301
487 3300027364 Ga0209967_1003644 Ga0209967_10036442 301
488 3300027462 Ga0210000_1011034 Ga0210000_10110342 301
489 3300031238 Ga0265332_10013540 Ga0265332_100135404 301
490 3300031251 Ga0265327_10081599 Ga0265327_100815992 301
491 3300031711 Ga0265314_10023891 Ga0265314_100238913 301
492 3300031711 Ga0265314_10072218 Ga0265314_100722182 301
493 3300031712 Ga0265342_10191723 Ga0265342_101917231 301
494 3300035086 Ga0373934_0000075 Ga0373934_0000075_32976_33911 301
495 3300035111 Ga0373923_0007561 Ga0373923_0007561_1727_2662 301
496 3300035114 Ga0373939_0095242 Ga0373939_0095242_48_974 301
497 3300035117 Ga0373953_0011271 Ga0373953_0011271_2032_2967 301
498 3300035119 Ga0373956_0000547 Ga0373956_0000547_9456_10391 301
499 3300035120 Ga0373957_0004601 Ga0373957_0004601_2012_2947 301
500 3300035170 Ga0373943_0011335 Ga0373943_0011335_1956_2891 301
501 3300035170 Ga0373943_0061323 Ga0373943_0061323_921_1850 301
502 3300035171 Ga0373946_0075218 Ga0373946_0075218_130_1065 301
503 3300035172 Ga0373955_0000669 Ga0373955_0000669_10681_11616 301
504 3300035410 Ga0373924_0001752 Ga0373924_0001752_3999_4934 301
505 3300035692 Ga0373935_0042868 Ga0373935_0042868_193_1128 301
506 3300035695 Ga0373927_0004259 Ga0373927_0004259_1019_1954 301
507 3300035724 Ga0373933_0000070 Ga0373933_0000070_51218_52153 301
508 3300035725 Ga0373947_0000105 Ga0373947_0000105_9267_10202 301
509 3300036401 Ga0373937_0000153 Ga0373937_0000153_50284_51219 301
510 3300037068 Ga0373925_0004451 Ga0373925_0004451_4042_4977 301
511 3300037466 Ga0395898_0087257 Ga0395898_0087257_1955_2923 301
512 3300037471 Ga0395905_0026729 Ga0395905_0026729_1661_2629 301
513 3300046454 Ga0495592_0002999 Ga0495592_0002999_1405_2340 301
514 3300046457 Ga0495590_0018935 Ga0495590_0018935_568_1497 301
515 3300046459 Ga0495629_0017108 Ga0495629_0017108_304_1239 301
516 3300046462 Ga0495651_0000116 Ga0495651_0000116_13818_14753 301
517 3300046463 Ga0495653_0000160 Ga0495653_0000160_12265_13200 301
518 3300046472 Ga0495580_0007476 Ga0495580_0007476_66_1001 301
519 3300046473 Ga0495582_0006709 Ga0495582_0006709_2052_2987 301
520 3300046475 Ga0495639_0000274 Ga0495639_0000274_10384_11319 301
521 3300046511 Ga0495608_0000141 Ga0495608_0000141_17204_18139 301
522 3300046514 Ga0495618_0022042 Ga0495618_0022042_2011_2946 301
523 3300046516 Ga0495628_0000113 Ga0495628_0000113_28315_29250 301
524 3300046517 Ga0495630_0007174 Ga0495630_0007174_3442_4377 301
525 3300046517 Ga0495630_0008764 Ga0495630_0008764_25_960 301
526 3300046529 Ga0495652_0002828 Ga0495652_0002828_2431_3366 301
527 3300046531 Ga0495665_0000167 Ga0495665_0000167_11056_11991 301
528 3300046536 Ga0495587_0000193 Ga0495587_0000193_41416_42351 301
529 3300046543 Ga0495645_0000653 Ga0495645_0000653_16385_17320 301
530 3300046557 Ga0495622_0056461 Ga0495622_0056461_800_1735 301
531 3300046559 Ga0495667_0003688 Ga0495667_0003688_2531_3466 301
532 3300046663 Ga0495635_0000064 Ga0495635_0000064_15681_16616 301
533 3300046674 Ga0495588_0003715 Ga0495588_0003715_881_1816 301
534 3300046675 Ga0495657_0001394 Ga0495657_0001394_18468_19403 301
535 3300046678 Ga0495599_0003800 Ga0495599_0003800_6320_7255 301
536 3300046679 Ga0495623_0000017 Ga0495623_0000017_56186_57121 301
537 3300046680 Ga0495646_0002392 Ga0495646_0002392_6456_7391 301
538 3300046683 Ga0495658_0000575 Ga0495658_0000575_7874_8809 301
539 3300046809 Ga0495600_0000063 Ga0495600_0000063_35182_36117 301
540 3300047315 Ga0495581_0155030 Ga0495581_0155030_111_1046 301
541 3300047317 Ga0495604_0000017 Ga0495604_0000017_143894_144829 301
542 3300047319 Ga0495674_0004424 Ga0495674_0004424_11063_11998 301
543 3300047322 Ga0495680_0001679 Ga0495680_0001679_4908_5843 301
544 3300047444 Ga0495675_0001138 Ga0495675_0001138_7681_8616 301
545 3300047471 Ga0495684_0000095 Ga0495684_0000095_56164_57099 301
546 3300047673 Ga0495593_0000143 Ga0495593_0000143_4435_5370 301
547 3300048088 Ga0495602_0000688 Ga0495602_0000688_2522_3457 301
548 3300048089 Ga0495614_0000161 Ga0495614_0000161_4817_5752 301
549 3300048904 Ga0496101_0143272 Ga0496101_0143272_260_1192 301
550 3300048911 Ga0496108_0102276 Ga0496108_0102276_1120_2052 301
551 3300048912 Ga0496109_0388215 Ga0496109_0388215_310_1242 301
552 3300048915 Ga0496112_0055567 Ga0496112_0055567_1645_2580 301
553 3300048917 Ga0496114_0119024 Ga0496114_0119024_1212_2144 301
554 3300048918 Ga0496115_0003739 Ga0496115_0003739_4369_5301 301
555 3300048918 Ga0496115_0071828 Ga0496115_0071828_818_1750 301
556 3300050509 nmdc:mga0qj67_12394_c1 nmdc:mga0qj67_12394_c1_2431_3360 301
557 3300050512 nmdc:mga0n895_65262_c1 nmdc:mga0n895_65262_c1_2626_3558 301
558 3300050513 nmdc:mga0rr50_417148_c1 nmdc:mga0rr50_417148_c1_142_1074 301
559 3300050514 nmdc:mga08x19_263719_c1 nmdc:mga08x19_263719_c1_137_1072 301
560 3300050514 nmdc:mga08x19_61796_c1 nmdc:mga08x19_61796_c1_1039_1968 301
561 3300050515 nmdc:mga0a205_119051_c1 nmdc:mga0a205_119051_c1_275_1207 301
562 3300053077 Ga0495601_0112050 Ga0495601_0112050_121_1056 301
563 3300053078 Ga0495612_0025707 Ga0495612_0025707_55_990 301
564 3300053084 Ga0495595_0023999 Ga0495595_0023999_1358_2293 301
565 3300053085 Ga0495619_0001382 Ga0495619_0001382_3600_4535 301
566 iso_pu_bacteria 2643221685 2644477890 302
567 3300032004 Ga0307414_10003471 Ga0307414_100034713 303
568 iso_pu_bacteria 2883291878 2883295862 303
569 iso_pu_bacteria 2895395659 2895398872 303
570 iso_pu_bacteria 3000405567 3000408058 304
571 3300005331 Ga0070670_100008009 Ga0070670_1000080093 306
572 3300005339 Ga0070660_100050925 Ga0070660_1000509251 306
573 3300005339 Ga0070660_100354535 Ga0070660_1003545351 306
574 3300005366 Ga0070659_100154950 Ga0070659_1001549502 306
575 3300005458 Ga0070681_10128564 Ga0070681_101285642 306
576 3300005530 Ga0070679_100010382 Ga0070679_1000103824 306
577 3300005546 Ga0070696_100030306 Ga0070696_1000303062 306
578 3300005577 Ga0068857_100076689 Ga0068857_1000766892 306
579 3300013100 Ga0157373_10035030 Ga0157373_100350303 306
580 3300013307 Ga0157372_10013674 Ga0157372_100136742 306
581 3300025912 Ga0207707_10012238 Ga0207707_100122386 306
582 3300025914 Ga0207671_10415162 Ga0207671_104151622 306
583 3300025919 Ga0207657_10237593 Ga0207657_102375931 306
584 3300025921 Ga0207652_10009917 Ga0207652_100099177 306
585 3300025932 Ga0207690_10002250 Ga0207690_100022508 306
586 3300025932 Ga0207690_10009509 Ga0207690_100095092 306
587 3300041452 Ga0451793_0510102 Ga0451793_0510102_2420_3343 306
588 3300046460 Ga0495638_0000106 Ga0495638_0000106_83291_84214 306
589 3300049568 Ga0501031_0155984 Ga0501031_0155984_252_1184 306
590 3300049573 Ga0501037_0264796 Ga0501037_0264796_98_1030 306
591 3300049574 Ga0501038_0323138 Ga0501038_0323138_163_1095 306
592 3300049575 Ga0501039_0031298 Ga0501039_0031298_351_1283 306
593 3300049576 Ga0501040_0061264 Ga0501040_0061264_225_1157 306
594 3300049580 Ga0501046_0241602 Ga0501046_0241602_195_1127 306
595 3300049584 Ga0501068_0186584 Ga0501068_0186584_193_1125 306
596 3300049591 Ga0501075_0121160 Ga0501075_0121160_929_1855 306
597 3300049593 Ga0501077_0202105 Ga0501077_0202105_82_1014 306
598 3300049743 Ga0501081_0032545 Ga0501081_0032545_229_1161 306
599 3300049824 Ga0501045_0094400 Ga0501045_0094400_1036_1968 306
600 3300060353 Ga0501082_0052797 Ga0501082_0052797_1718_2650 306
601 3300002737 JGI25162J39368_1003540 JGI25162J39368_10035403 307
602 3300002737 JGI25162J39368_1004704 JGI25162J39368_10047042 307
603 3300002772 JGI25164J39214_1001713 JGI25164J39214_10017133 307
604 3300002772 JGI25164J39214_1001717 JGI25164J39214_10017173 307
605 3300003214 JGI25165J46597_1003126 JGI25165J46597_10031262 307
606 3300003214 JGI25165J46597_1003610 JGI25165J46597_10036102 307
607 3300005436 Ga0070713_100006772 Ga0070713_1000067724 307
608 3300013100 Ga0157373_10011898 Ga0157373_100118984 307
609 3300013102 Ga0157371_10006820 Ga0157371_100068204 307
610 3300015262 Ga0182007_10010691 Ga0182007_100106912 307
611 3300025226 Ga0209674_101135 Ga0209674_1011357 307
612 3300025231 Ga0207427_100134 Ga0207427_10013467 307
613 3300025231 Ga0207427_100656 Ga0207427_1006566 307
614 3300025233 Ga0209437_100005 Ga0209437_100005675 307
615 3300025233 Ga0209437_100200 Ga0209437_10020075 307
616 3300025250 Ga0209026_1000017 Ga0209026_1000017241 307
617 3300025261 Ga0209233_1000011 Ga0209233_1000011267 307
618 3300025261 Ga0209233_1000193 Ga0209233_100019375 307
619 3300025928 Ga0207700_10000529 Ga0207700_1000052918 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00850

Hist_deacetyl

Histone deacetylase domain

60

347

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ji5-assembly1.cif.gz_A crystal structure of a histone deacetylase superfamily protein from burkholderia phymatumphymatum 0.9742 1 307
5ji5-assembly1.cif.gz_A crystal structure of a histone deacetylase superfamily protein from burkholderia phymatumphymatum 0.9711 1 307
8szt-assembly1.cif.gz_D-2 structure of kdac1 from acinetobacter baumannii 0.9597 1 305
8szt-assembly1.cif.gz_A structure of kdac1 from acinetobacter baumannii 0.9576 1 305
5g0y-assembly1.cif.gz_B pseudomonas aeruginosa hdah unliganded. 0.9553 2 305
ID Description Score Start End Superfamily
5ji5A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9742 1 307 3.40.800.20
af_A0A1D6N7T5_1_214_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9714 132 306 3.40.800.20
5ji5A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9711 1 307 3.40.800.20
5li3A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.947 2 305 3.40.800.20
5g1cA00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9442 2 305 3.40.800.20
ID Description Score Start End GO Terms
AF-A0A1V3Q8T6-F1-model_v4 Acetoin utilization protein 0.9941 1 307 GO:0004407
GO:0040029
AF-A0A502CDR9-F1-model_v4 Histone deacetylase family protein 0.9936 1 307 GO:0004407
GO:0040029
AF-A0A502CDR9-F1-model_v4 Histone deacetylase family protein 0.9904 1 307 GO:0004407
GO:0040029
AF-A0A257Q2U6-F1-model_v4 Acetoin utilization protein 0.9881 2 306 GO:0004407
GO:0040029
AF-A0A812JLV3-F1-model_v4 Dxs protein 0.9872 2 307 GO:0004659
GO:0005737
GO:0006308
GO:0008661
GO:0008855
GO:0009318
GO:0016114
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.74 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map