F469831
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 619 | 296 | 1238 | 350 |
Family's Representative Sequence
| Representative Sequence | 3300029282|Ga0311003_166887|Ga0311003_1668871 |
| Length | 416 |
| Sequence | MAFTTLGGGCGAASVRLVPQNRILGSNSKPFTGIILKKPQQVGPLPLHVRGSIASSPQKLFSPKAAAPKSGDSIRIAVLGASGYTGAEIVRFLANHPQFHIKVMTADRKAGEQFGSVFPHLRTLDLPKLVAIKDADFSDIDAVFCCLPHGTTQEIIKSLPRHLKIVDLSADFRLRDINEYAEWYGHSHRAPELQEEAVYGLTELQRDDIRNARLVANPGCYPTSIQLPLVPLVKAKLIKLTNIIIDAKSGVSGAGRGAKEANLYTEIAEGIHAYGITSHRHVPEIEQGLTDAAESKVTISFTPHLMCMKRGMQSTIYVELASGVTPRDLYEHLKYTYEDEEFVKLLHGSSAPHTSHVVGSNYCFMNVYEDRIPGRAIIISVIDNLVKGASGQALQNLNLMMGLPENMGLQYLPLFP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300029282 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 | Metatranscriptome | Rhizosphere |
| 2 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 51 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 86 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 87 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 88 | 3300023556 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 89 | 3300023557 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 90 | 3300023558 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 91 | 3300023559 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 92 | 3300023560 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 93 | 3300023561 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 94 | 3300023562 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 95 | 3300023563 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 96 | 3300023564 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 97 | 3300023666 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 98 | 3300023668 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 99 | 3300023680 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 100 | 3300023682 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 101 | 3300023684 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 102 | 3300023686 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 103 | 3300023688 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 104 | 3300023689 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 105 | 3300023690 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 149 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 150 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 151 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 154 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 157 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 158 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 159 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 160 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 161 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 164 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300031591 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 166 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 167 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 169 | 3300031615 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 170 | 3300031633 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 171 | 3300031635 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 172 | 3300031636 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 173 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 174 | 3300031666 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 175 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 176 | 3300031678 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 177 | 3300031686 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 178 | 3300031690 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 179 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 183 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 184 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 185 | 3300031810 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 186 | 3300031815 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 187 | 3300031816 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031828 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 193 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 194 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 204 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 211 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 212 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 213 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 214 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 219 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 220 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 223 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 224 | 3300041464 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT | Metatranscriptome | Rhizoplane |
| 225 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 226 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 243 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 244 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 245 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 246 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 247 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 248 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 249 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 250 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 251 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 252 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 284 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 285 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 286 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 287 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 288 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 289 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 290 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 294 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 295 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 296 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.91 |
| Metatranscriptomes | 12.44 |
| Isolates | 0.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.97 |
| Nodule | 0 |
| Rhizoplane | 0.81 |
| Rhizosphere | 85.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0311003_166887 | 3300029282 | Bacteria | 1553 |
| 2 | Ga0006556J51387_1011473 | 3300003479 | Eukaryota | 1672 |
| 3 | Ga0070658_10000031 | 3300005327 | Bacteria | 153171 |
| 4 | Ga0070658_10046994 | 3300005327 | Bacteria | 3493 |
| 5 | Ga0070658_10172234 | 3300005327 | Bacteria | 1819 |
| 6 | Ga0070683_100017049 | 3300005329 | Bacteria | 6410 |
| 7 | Ga0070683_100084079 | 3300005329 | Bacteria | 2982 |
| 8 | Ga0070683_100122865 | 3300005329 | Bacteria | 2453 |
| 9 | Ga0070670_100000150 | 3300005331 | Bacteria | 64102 |
| 10 | Ga0068869_100032869 | 3300005334 | Bacteria | 3659 |
| 11 | Ga0068869_100043285 | 3300005334 | Unclassified | 3233 |
| 12 | Ga0070666_10003473 | 3300005335 | Bacteria | 9549 |
| 13 | Ga0070666_10181348 | 3300005335 | Bacteria | 1477 |
| 14 | Ga0070680_100043532 | 3300005336 | Bacteria | 3647 |
| 15 | Ga0068868_100000028 | 3300005338 | Bacteria | 78800 |
| 16 | Ga0068868_100013770 | 3300005338 | Bacteria | 5943 |
| 17 | Ga0068868_100265865 | 3300005338 | Bacteria | 1448 |
| 18 | Ga0070669_100004094 | 3300005353 | Bacteria | 10564 |
| 19 | Ga0070669_100083407 | 3300005353 | Bacteria | 2383 |
| 20 | Ga0070674_100011652 | 3300005356 | Bacteria | 5360 |
| 21 | Ga0070667_100026186 | 3300005367 | Bacteria | 4851 |
| 22 | Ga0070709_10016682 | 3300005434 | Bacteria | 4198 |
| 23 | Ga0070709_10023748 | 3300005434 | Bacteria | 3605 |
| 24 | Ga0070709_10057517 | 3300005434 | Bacteria | 2463 |
| 25 | Ga0070709_10058667 | 3300005434 | Bacteria | 2442 |
| 26 | Ga0070713_100010196 | 3300005436 | Bacteria | 6779 |
| 27 | Ga0070713_100065385 | 3300005436 | Bacteria | 3055 |
| 28 | Ga0070713_100127647 | 3300005436 | Bacteria | 2239 |
| 29 | Ga0070700_100001476 | 3300005441 | Bacteria | 11702 |
| 30 | Ga0070694_100002182 | 3300005444 | Bacteria | 11593 |
| 31 | Ga0070708_100001314 | 3300005445 | Bacteria | 19051 |
| 32 | Ga0070708_100022493 | 3300005445 | Bacteria | 5348 |
| 33 | Ga0070708_100052716 | 3300005445 | Bacteria | 3608 |
| 34 | Ga0070708_100095262 | 3300005445 | Bacteria | 2717 |
| 35 | Ga0070678_100355853 | 3300005456 | Bacteria | 1260 |
| 36 | Ga0070681_10025507 | 3300005458 | Bacteria | 5945 |
| 37 | Ga0070681_10059776 | 3300005458 | Bacteria | 3791 |
| 38 | Ga0070681_10121591 | 3300005458 | Bacteria | 2545 |
| 39 | Ga0070681_10412664 | 3300005458 | Bacteria | 1262 |
| 40 | Ga0068867_100305274 | 3300005459 | Bacteria | 1313 |
| 41 | Ga0070706_100023926 | 3300005467 | Bacteria | 5624 |
| 42 | Ga0070707_100000212 | 3300005468 | Bacteria | 58073 |
| 43 | Ga0070707_100008812 | 3300005468 | Bacteria | 9360 |
| 44 | Ga0070707_100017858 | 3300005468 | Bacteria | 6670 |
| 45 | Ga0070707_100059473 | 3300005468 | Bacteria | 3666 |
| 46 | Ga0070707_100299199 | 3300005468 | Bacteria | 1563 |
| 47 | Ga0070698_100013553 | 3300005471 | Bacteria | 8632 |
| 48 | Ga0070699_100205394 | 3300005518 | Bacteria | 1752 |
| 49 | Ga0070679_100035527 | 3300005530 | Bacteria | 4944 |
| 50 | Ga0070679_100120828 | 3300005530 | Bacteria | 2604 |
| 51 | Ga0070684_100073268 | 3300005535 | Bacteria | 3018 |
| 52 | Ga0070697_100027109 | 3300005536 | Bacteria | 4582 |
| 53 | Ga0070697_100048957 | 3300005536 | Bacteria | 3428 |
| 54 | Ga0068853_100008821 | 3300005539 | Bacteria | 8111 |
| 55 | Ga0070686_100037862 | 3300005544 | Bacteria | 2995 |
| 56 | Ga0070665_100005701 | 3300005548 | Bacteria | 12783 |
| 57 | Ga0070665_100032461 | 3300005548 | Bacteria | 5255 |
| 58 | Ga0070704_100022666 | 3300005549 | Bacteria | 4089 |
| 59 | Ga0070704_100084877 | 3300005549 | Bacteria | 2342 |
| 60 | Ga0070704_100100026 | 3300005549 | Bacteria | 2182 |
| 61 | Ga0070704_100160408 | 3300005549 | Bacteria | 1778 |
| 62 | Ga0068855_100010762 | 3300005563 | Bacteria | 11042 |
| 63 | Ga0068855_100082385 | 3300005563 | Bacteria | 3729 |
| 64 | Ga0068855_100159601 | 3300005563 | Bacteria | 2560 |
| 65 | Ga0068855_100192597 | 3300005563 | Bacteria | 2299 |
| 66 | Ga0070664_100069911 | 3300005564 | Bacteria | 3005 |
| 67 | Ga0070664_100174068 | 3300005564 | Bacteria | 1910 |
| 68 | Ga0068857_100050661 | 3300005577 | Bacteria | 3683 |
| 69 | Ga0068857_100095725 | 3300005577 | Bacteria | 2661 |
| 70 | Ga0068854_100008184 | 3300005578 | Bacteria | 6707 |
| 71 | Ga0068854_100009584 | 3300005578 | Bacteria | 6251 |
| 72 | Ga0068854_100017695 | 3300005578 | Bacteria | 4773 |
| 73 | Ga0068854_100309491 | 3300005578 | Bacteria | 1281 |
| 74 | Ga0068856_100024922 | 3300005614 | Bacteria | 5829 |
| 75 | Ga0068859_100000020 | 3300005617 | Bacteria | 247060 |
| 76 | Ga0068859_100074968 | 3300005617 | Bacteria | 3423 |
| 77 | Ga0068859_100435552 | 3300005617 | Bacteria | 1407 |
| 78 | Ga0068866_10143341 | 3300005718 | Bacteria | 1374 |
| 79 | Ga0068866_10175749 | 3300005718 | Bacteria | 1261 |
| 80 | Ga0068863_100004416 | 3300005841 | Bacteria | 13868 |
| 81 | Ga0068858_100017600 | 3300005842 | Bacteria | 6700 |
| 82 | Ga0068862_100003559 | 3300005844 | Bacteria | 13333 |
| 83 | Ga0081455_10195861 | 3300005937 | Bacteria | 1517 |
| 84 | Ga0081455_10215603 | 3300005937 | Bacteria | 1427 |
| 85 | Ga0081538_10029223 | 3300005981 | Bacteria | 3772 |
| 86 | Ga0081539_10002036 | 3300005985 | Bacteria | 30449 |
| 87 | Ga0070715_10056253 | 3300006163 | Bacteria | 1711 |
| 88 | Ga0070716_100053321 | 3300006173 | Bacteria | 2306 |
| 89 | Ga0097621_100000311 | 3300006237 | Bacteria | 32935 |
| 90 | Ga0097621_100013066 | 3300006237 | Bacteria | 6175 |
| 91 | Ga0097621_100021142 | 3300006237 | Bacteria | 5026 |
| 92 | Ga0097621_100091017 | 3300006237 | Bacteria | 2553 |
| 93 | Ga0097621_100105192 | 3300006237 | Bacteria | 2379 |
| 94 | Ga0068871_100000337 | 3300006358 | Bacteria | 32470 |
| 95 | Ga0068871_100020930 | 3300006358 | Bacteria | 5018 |
| 96 | Ga0068871_100034122 | 3300006358 | Bacteria | 4035 |
| 97 | Ga0068871_100108356 | 3300006358 | Bacteria | 2334 |
| 98 | Ga0075428_100009648 | 3300006844 | Bacteria | 10719 |
| 99 | Ga0075428_100160572 | 3300006844 | Bacteria | 2440 |
| 100 | Ga0075430_100006967 | 3300006846 | Bacteria | 9530 |
| 101 | Ga0075430_100307845 | 3300006846 | Bacteria | 1310 |
| 102 | Ga0075431_100043392 | 3300006847 | Bacteria | 4641 |
| 103 | Ga0075433_10050783 | 3300006852 | Bacteria | 3610 |
| 104 | Ga0075429_100360010 | 3300006880 | Bacteria | 1274 |
| 105 | Ga0068865_100108607 | 3300006881 | Bacteria | 2042 |
| 106 | Ga0075436_100000019 | 3300006914 | Bacteria | 130535 |
| 107 | Ga0075436_100005231 | 3300006914 | Bacteria | 8931 |
| 108 | Ga0075436_100088435 | 3300006914 | Bacteria | 2152 |
| 109 | Ga0097620_100000020 | 3300006931 | Bacteria | 247060 |
| 110 | Ga0097620_100074969 | 3300006931 | Bacteria | 3423 |
| 111 | Ga0075435_100027225 | 3300007076 | Bacteria | 4469 |
| 112 | Ga0075435_100036063 | 3300007076 | Bacteria | 3928 |
| 113 | Ga0099794_10124541 | 3300007265 | Bacteria | 1299 |
| 114 | Ga0105240_10000709 | 3300009093 | Bacteria | 61057 |
| 115 | Ga0105240_10001828 | 3300009093 | Bacteria | 35666 |
| 116 | Ga0105240_10002450 | 3300009093 | Bacteria | 29855 |
| 117 | Ga0105240_10024692 | 3300009093 | Bacteria | 7917 |
| 118 | Ga0105240_10271050 | 3300009093 | Bacteria | 1954 |
| 119 | Ga0105240_10286117 | 3300009093 | Bacteria | 1892 |
| 120 | Ga0105240_10372065 | 3300009093 | Bacteria | 1615 |
| 121 | Ga0105240_10816088 | 3300009093 | Bacteria | 1009 |
| 122 | Ga0111539_10023461 | 3300009094 | Bacteria | 7581 |
| 123 | Ga0111539_10585367 | 3300009094 | Unclassified | 1300 |
| 124 | Ga0105245_10000006 | 3300009098 | Bacteria | 330960 |
| 125 | Ga0105245_10041058 | 3300009098 | Bacteria | 4123 |
| 126 | Ga0105245_10055670 | 3300009098 | Bacteria | 3553 |
| 127 | Ga0114129_10009063 | 3300009147 | Bacteria | 14183 |
| 128 | Ga0114129_10009389 | 3300009147 | Bacteria | 13944 |
| 129 | Ga0114129_10121730 | 3300009147 | Bacteria | 3590 |
| 130 | Ga0114129_10244860 | 3300009147 | Bacteria | 2409 |
| 131 | Ga0105243_10019800 | 3300009148 | Bacteria | 5103 |
| 132 | Ga0105243_10080782 | 3300009148 | Bacteria | 2653 |
| 133 | Ga0105241_10017922 | 3300009174 | Bacteria | 5207 |
| 134 | Ga0105242_10035151 | 3300009176 | Bacteria | 4018 |
| 135 | Ga0105242_10046504 | 3300009176 | Bacteria | 3521 |
| 136 | Ga0105242_10054735 | 3300009176 | Bacteria | 3262 |
| 137 | Ga0105242_10055158 | 3300009176 | Bacteria | 3251 |
| 138 | Ga0105242_10129387 | 3300009176 | Bacteria | 2177 |
| 139 | Ga0105242_10235811 | 3300009176 | Bacteria | 1642 |
| 140 | Ga0105242_10340141 | 3300009176 | Bacteria | 1383 |
| 141 | Ga0105242_10399517 | 3300009176 | Bacteria | 1282 |
| 142 | Ga0105248_10043934 | 3300009177 | Bacteria | 5012 |
| 143 | Ga0105248_10284402 | 3300009177 | Bacteria | 1862 |
| 144 | Ga0105248_10289128 | 3300009177 | Bacteria | 1846 |
| 145 | Ga0105248_10349316 | 3300009177 | Bacteria | 1665 |
| 146 | Ga0105248_10350601 | 3300009177 | Bacteria | 1662 |
| 147 | Ga0105237_10016005 | 3300009545 | Bacteria | 7799 |
| 148 | Ga0105237_10077379 | 3300009545 | Bacteria | 3316 |
| 149 | Ga0105237_10344895 | 3300009545 | Bacteria | 1494 |
| 150 | Ga0105238_10000005 | 3300009551 | Bacteria | 372840 |
| 151 | Ga0105238_10000280 | 3300009551 | Bacteria | 56545 |
| 152 | Ga0105238_10028945 | 3300009551 | Bacteria | 5642 |
| 153 | Ga0105238_10046516 | 3300009551 | Bacteria | 4378 |
| 154 | Ga0105249_10298886 | 3300009553 | Bacteria | 1614 |
| 155 | Ga0099796_10042197 | 3300010159 | Bacteria | 1548 |
| 156 | Ga0105239_10030322 | 3300010375 | Bacteria | 5945 |
| 157 | Ga0105239_10319108 | 3300010375 | Bacteria | 1752 |
| 158 | Ga0105246_10310124 | 3300011119 | Unclassified | 1278 |
| 159 | Ga0157370_10011961 | 3300013104 | Bacteria | 9046 |
| 160 | Ga0157370_10230790 | 3300013104 | Bacteria | 1713 |
| 161 | Ga0157369_10013806 | 3300013105 | Bacteria | 9130 |
| 162 | Ga0157374_10000006 | 3300013296 | Bacteria | 640284 |
| 163 | Ga0157374_10024485 | 3300013296 | Bacteria | 5413 |
| 164 | Ga0157374_10076596 | 3300013296 | Bacteria | 3163 |
| 165 | Ga0157374_10417890 | 3300013296 | Bacteria | 1339 |
| 166 | Ga0157378_10000392 | 3300013297 | Bacteria | 43135 |
| 167 | Ga0157378_10000546 | 3300013297 | Bacteria | 35772 |
| 168 | Ga0157378_10044854 | 3300013297 | Bacteria | 3927 |
| 169 | Ga0157378_10130147 | 3300013297 | Bacteria | 2329 |
| 170 | Ga0157378_10622048 | 3300013297 | Bacteria | 1093 |
| 171 | Ga0163162_10712382 | 3300013306 | Bacteria | 1125 |
| 172 | Ga0157375_10000020 | 3300013308 | Bacteria | 251840 |
| 173 | Ga0157375_10001825 | 3300013308 | Bacteria | 18277 |
| 174 | Ga0157375_10029787 | 3300013308 | Bacteria | 5138 |
| 175 | Ga0163163_10004027 | 3300014325 | Bacteria | 12532 |
| 176 | Ga0163163_10013311 | 3300014325 | Bacteria | 7528 |
| 177 | Ga0163163_10300986 | 3300014325 | Unclassified | 1656 |
| 178 | Ga0163163_10646770 | 3300014325 | Bacteria | 1121 |
| 179 | Ga0157380_10010219 | 3300014326 | Bacteria | 6745 |
| 180 | Ga0157380_10036868 | 3300014326 | Bacteria | 3786 |
| 181 | Ga0157380_10041149 | 3300014326 | Bacteria | 3604 |
| 182 | Ga0157377_10000003 | 3300014745 | Bacteria | 435133 |
| 183 | Ga0157377_10000058 | 3300014745 | Bacteria | 86728 |
| 184 | Ga0157379_10020283 | 3300014968 | Bacteria | 5877 |
| 185 | Ga0157379_10235498 | 3300014968 | Bacteria | 1660 |
| 186 | Ga0157376_10000003 | 3300014969 | Bacteria | 568634 |
| 187 | Ga0157376_10046466 | 3300014969 | Bacteria | 3580 |
| 188 | Ga0157376_10084219 | 3300014969 | Bacteria | 2737 |
| 189 | Ga0206350_11627179 | 3300020080 | Bacteria | 1937 |
| 190 | Ga0213872_10006403 | 3300021361 | Bacteria | 5918 |
| 191 | Ga0213876_10000066 | 3300021384 | Bacteria | 126862 |
| 192 | Ga0213875_10000007 | 3300021388 | Bacteria | 562717 |
| 193 | Ga0213875_10000106 | 3300021388 | Bacteria | 95400 |
| 194 | Ga0247519_103124 | 3300023556 | Eukaryota | 1679 |
| 195 | Ga0247521_102742 | 3300023557 | Eukaryota | 1735 |
| 196 | Ga0247526_102872 | 3300023558 | Eukaryota | 1663 |
| 197 | Ga0247529_102722 | 3300023559 | Eukaryota | 1712 |
| 198 | Ga0247514_104156 | 3300023560 | Eukaryota | 1729 |
| 199 | Ga0247518_104073 | 3300023561 | Eukaryota | 1725 |
| 200 | Ga0247516_103221 | 3300023562 | Eukaryota | 1847 |
| 201 | Ga0247530_102387 | 3300023563 | Eukaryota | 1662 |
| 202 | Ga0247515_103435 | 3300023564 | Eukaryota | 1774 |
| 203 | Ga0247531_102643 | 3300023666 | Eukaryota | 1673 |
| 204 | Ga0247525_102936 | 3300023668 | Eukaryota | 1722 |
| 205 | Ga0247528_101855 | 3300023680 | Eukaryota | 1711 |
| 206 | Ga0247513_102936 | 3300023682 | Eukaryota | 1724 |
| 207 | Ga0247523_103185 | 3300023684 | Eukaryota | 1649 |
| 208 | Ga0247520_102551 | 3300023686 | Eukaryota | 1770 |
| 209 | Ga0247522_103035 | 3300023688 | Eukaryota | 1718 |
| 210 | Ga0247517_102647 | 3300023689 | Eukaryota | 1856 |
| 211 | Ga0247512_103865 | 3300023690 | Eukaryota | 1734 |
| 212 | Ga0207680_10002204 | 3300025903 | Bacteria | 9099 |
| 213 | Ga0207680_10046049 | 3300025903 | Bacteria | 2577 |
| 214 | Ga0207685_10002870 | 3300025905 | Bacteria | 4061 |
| 215 | Ga0207685_10028005 | 3300025905 | Bacteria | 1979 |
| 216 | Ga0207699_10013707 | 3300025906 | Bacteria | 4158 |
| 217 | Ga0207699_10271570 | 3300025906 | Bacteria | 1175 |
| 218 | Ga0207684_10045746 | 3300025910 | Bacteria | 3712 |
| 219 | Ga0207684_10082937 | 3300025910 | Bacteria | 2730 |
| 220 | Ga0207654_10048879 | 3300025911 | Bacteria | 2423 |
| 221 | Ga0207707_10042755 | 3300025912 | Bacteria | 3953 |
| 222 | Ga0207707_10215493 | 3300025912 | Bacteria | 1672 |
| 223 | Ga0207707_10228133 | 3300025912 | Bacteria | 1620 |
| 224 | Ga0207695_10001011 | 3300025913 | Bacteria | 49697 |
| 225 | Ga0207695_10006315 | 3300025913 | Bacteria | 15418 |
| 226 | Ga0207695_10030423 | 3300025913 | Bacteria | 5942 |
| 227 | Ga0207695_10169614 | 3300025913 | Unclassified | 2109 |
| 228 | Ga0207671_10008147 | 3300025914 | Bacteria | 8941 |
| 229 | Ga0207646_10000400 | 3300025922 | Bacteria | 58084 |
| 230 | Ga0207646_10052648 | 3300025922 | Bacteria | 3643 |
| 231 | Ga0207646_10084605 | 3300025922 | Bacteria | 2838 |
| 232 | Ga0207646_10088820 | 3300025922 | Bacteria | 2766 |
| 233 | Ga0207681_10011441 | 3300025923 | Bacteria | 5453 |
| 234 | Ga0207681_10025476 | 3300025923 | Bacteria | 3805 |
| 235 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 236 | Ga0207694_10001089 | 3300025924 | Bacteria | 23548 |
| 237 | Ga0207694_10009910 | 3300025924 | Bacteria | 7189 |
| 238 | Ga0207650_10000115 | 3300025925 | Bacteria | 105044 |
| 239 | Ga0207659_10090601 | 3300025926 | Bacteria | 2283 |
| 240 | Ga0207687_10000006 | 3300025927 | Bacteria | 641680 |
| 241 | Ga0207687_10152484 | 3300025927 | Bacteria | 1765 |
| 242 | Ga0207687_10192973 | 3300025927 | Bacteria | 1586 |
| 243 | Ga0207700_10005799 | 3300025928 | Bacteria | 7418 |
| 244 | Ga0207700_10031518 | 3300025928 | Bacteria | 3767 |
| 245 | Ga0207700_10133268 | 3300025928 | Bacteria | 2032 |
| 246 | Ga0207700_10133874 | 3300025928 | Bacteria | 2028 |
| 247 | Ga0207700_10430126 | 3300025928 | Unclassified | 1161 |
| 248 | Ga0207644_10238397 | 3300025931 | Unclassified | 1447 |
| 249 | Ga0207686_10025778 | 3300025934 | Bacteria | 3424 |
| 250 | Ga0207686_10068741 | 3300025934 | Bacteria | 2270 |
| 251 | Ga0207686_10130428 | 3300025934 | Bacteria | 1723 |
| 252 | Ga0207686_10328215 | 3300025934 | Bacteria | 1146 |
| 253 | Ga0207709_10246936 | 3300025935 | Bacteria | 1301 |
| 254 | Ga0207669_10006835 | 3300025937 | Bacteria | 5246 |
| 255 | Ga0207704_10055508 | 3300025938 | Bacteria | 2421 |
| 256 | Ga0207704_10068995 | 3300025938 | Bacteria | 2231 |
| 257 | Ga0207691_10119865 | 3300025940 | Bacteria | 2333 |
| 258 | Ga0207711_10019284 | 3300025941 | Bacteria | 5680 |
| 259 | Ga0207711_10072826 | 3300025941 | Bacteria | 2985 |
| 260 | Ga0207711_10119099 | 3300025941 | Bacteria | 2356 |
| 261 | Ga0207711_10306079 | 3300025941 | Bacteria | 1467 |
| 262 | Ga0207689_10029178 | 3300025942 | Unclassified | 4610 |
| 263 | Ga0207689_10098455 | 3300025942 | Bacteria | 2403 |
| 264 | Ga0207661_10000006 | 3300025944 | Bacteria | 537727 |
| 265 | Ga0207661_10134858 | 3300025944 | Bacteria | 2119 |
| 266 | Ga0207667_10010726 | 3300025949 | Bacteria | 10689 |
| 267 | Ga0207667_10026193 | 3300025949 | Bacteria | 6374 |
| 268 | Ga0207667_10061271 | 3300025949 | Bacteria | 3936 |
| 269 | Ga0207658_10267203 | 3300025986 | Bacteria | 1460 |
| 270 | Ga0207677_10000153 | 3300026023 | Bacteria | 55121 |
| 271 | Ga0207677_10013946 | 3300026023 | Bacteria | 4674 |
| 272 | Ga0207677_10019662 | 3300026023 | Bacteria | 4084 |
| 273 | Ga0207677_10063496 | 3300026023 | Bacteria | 2568 |
| 274 | Ga0207677_10106202 | 3300026023 | Bacteria | 2080 |
| 275 | Ga0207703_10148414 | 3300026035 | Bacteria | 2042 |
| 276 | Ga0207639_10030065 | 3300026041 | Bacteria | 3981 |
| 277 | Ga0207678_10001896 | 3300026067 | Bacteria | 19082 |
| 278 | Ga0207708_10009060 | 3300026075 | Bacteria | 7363 |
| 279 | Ga0207708_10013355 | 3300026075 | Bacteria | 6135 |
| 280 | Ga0207702_10018806 | 3300026078 | Bacteria | 5714 |
| 281 | Ga0207702_10107075 | 3300026078 | Bacteria | 2478 |
| 282 | Ga0207641_10009778 | 3300026088 | Bacteria | 7896 |
| 283 | Ga0207648_10042300 | 3300026089 | Bacteria | 3999 |
| 284 | Ga0207676_10013266 | 3300026095 | Bacteria | 5919 |
| 285 | Ga0207674_10058553 | 3300026116 | Bacteria | 3902 |
| 286 | Ga0207674_10250715 | 3300026116 | Bacteria | 1717 |
| 287 | Ga0207675_100038552 | 3300026118 | Bacteria | 4460 |
| 288 | Ga0207683_10217638 | 3300026121 | Bacteria | 1740 |
| 289 | Ga0207428_10000486 | 3300027907 | Bacteria | 47460 |
| 290 | Ga0207428_10003655 | 3300027907 | Bacteria | 14825 |
| 291 | Ga0207428_10031154 | 3300027907 | Bacteria | 4405 |
| 292 | Ga0207428_10069883 | 3300027907 | Bacteria | 2761 |
| 293 | Ga0268266_10000835 | 3300028379 | Bacteria | 40250 |
| 294 | Ga0268266_10002480 | 3300028379 | Bacteria | 19713 |
| 295 | Ga0268266_10158828 | 3300028379 | Bacteria | 2044 |
| 296 | Ga0268265_10005666 | 3300028380 | Bacteria | 8531 |
| 297 | Ga0268264_10048107 | 3300028381 | Bacteria | 3547 |
| 298 | Ga0265319_1011501 | 3300028563 | Bacteria | 3621 |
| 299 | Ga0265318_10000347 | 3300028577 | Bacteria | 36774 |
| 300 | Ga0265318_10014030 | 3300028577 | Bacteria | 3368 |
| 301 | Ga0265318_10067830 | 3300028577 | Bacteria | 1324 |
| 302 | Ga0265323_10001639 | 3300028653 | Bacteria | 10767 |
| 303 | Ga0265323_10014205 | 3300028653 | Bacteria | 3160 |
| 304 | Ga0265323_10016449 | 3300028653 | Bacteria | 2887 |
| 305 | Ga0265338_10037679 | 3300028800 | Bacteria | 4596 |
| 306 | Ga0265338_10081345 | 3300028800 | Bacteria | 2717 |
| 307 | Ga0265324_10001058 | 3300029957 | Bacteria | 16723 |
| 308 | Ga0307511_10000628 | 3300030521 | Bacteria | 37805 |
| 309 | Ga0265330_10000718 | 3300031235 | Bacteria | 20901 |
| 310 | Ga0265330_10001084 | 3300031235 | Bacteria | 16403 |
| 311 | Ga0265330_10001195 | 3300031235 | Bacteria | 15396 |
| 312 | Ga0265330_10001697 | 3300031235 | Bacteria | 12463 |
| 313 | Ga0265330_10003679 | 3300031235 | Bacteria | 7960 |
| 314 | Ga0265332_10000920 | 3300031238 | Bacteria | 17618 |
| 315 | Ga0265332_10015406 | 3300031238 | Bacteria | 3374 |
| 316 | Ga0265332_10036827 | 3300031238 | Bacteria | 2123 |
| 317 | Ga0265328_10007066 | 3300031239 | Bacteria | 4703 |
| 318 | Ga0265328_10041183 | 3300031239 | Bacteria | 1701 |
| 319 | Ga0265320_10000726 | 3300031240 | Bacteria | 25199 |
| 320 | Ga0265320_10003799 | 3300031240 | Bacteria | 10019 |
| 321 | Ga0265325_10000903 | 3300031241 | Bacteria | 21441 |
| 322 | Ga0265325_10024890 | 3300031241 | Bacteria | 3252 |
| 323 | Ga0265325_10104286 | 3300031241 | Bacteria | 1385 |
| 324 | Ga0265329_10000666 | 3300031242 | Bacteria | 17637 |
| 325 | Ga0265329_10002112 | 3300031242 | Bacteria | 9220 |
| 326 | Ga0265340_10002116 | 3300031247 | Bacteria | 11380 |
| 327 | Ga0265339_10022601 | 3300031249 | Bacteria | 3643 |
| 328 | Ga0265339_10026493 | 3300031249 | Bacteria | 3320 |
| 329 | Ga0265331_10000019 | 3300031250 | Bacteria | 258837 |
| 330 | Ga0265331_10001289 | 3300031250 | Bacteria | 18660 |
| 331 | Ga0265331_10002335 | 3300031250 | Bacteria | 12894 |
| 332 | Ga0265331_10025540 | 3300031250 | Bacteria | 2981 |
| 333 | Ga0265331_10030086 | 3300031250 | Bacteria | 2705 |
| 334 | Ga0265331_10063376 | 3300031250 | Bacteria | 1742 |
| 335 | Ga0265331_10068780 | 3300031250 | Bacteria | 1660 |
| 336 | Ga0265327_10000420 | 3300031251 | Bacteria | 77601 |
| 337 | Ga0265316_10003160 | 3300031344 | Bacteria | 16764 |
| 338 | Ga0265316_10005513 | 3300031344 | Bacteria | 12280 |
| 339 | Ga0265316_10008129 | 3300031344 | Bacteria | 9770 |
| 340 | Ga0265316_10009835 | 3300031344 | Bacteria | 8775 |
| 341 | Ga0265316_10021159 | 3300031344 | Bacteria | 5518 |
| 342 | Ga0265316_10025959 | 3300031344 | Bacteria | 4881 |
| 343 | Ga0265316_10090391 | 3300031344 | Bacteria | 2336 |
| 344 | Ga0265316_10137640 | 3300031344 | Bacteria | 1836 |
| 345 | Ga0310116_103478 | 3300031591 | Eukaryota | 1620 |
| 346 | Ga0310117_103307 | 3300031592 | Eukaryota | 1693 |
| 347 | Ga0265313_10001693 | 3300031595 | Bacteria | 20343 |
| 348 | Ga0265313_10003004 | 3300031595 | Bacteria | 14025 |
| 349 | Ga0265313_10005305 | 3300031595 | Bacteria | 9533 |
| 350 | Ga0265313_10008011 | 3300031595 | Bacteria | 7090 |
| 351 | Ga0310103_105569 | 3300031614 | Eukaryota | 1672 |
| 352 | Ga0310107_104984 | 3300031615 | Eukaryota | 1733 |
| 353 | Ga0310108_103350 | 3300031633 | Eukaryota | 1778 |
| 354 | Ga0310115_104372 | 3300031635 | Eukaryota | 1710 |
| 355 | Ga0310113_103395 | 3300031636 | Eukaryota | 1751 |
| 356 | Ga0316575_10004268 | 3300031665 | Bacteria | 5019 |
| 357 | Ga0316575_10004767 | 3300031665 | Bacteria | 4787 |
| 358 | Ga0316575_10008074 | 3300031665 | Bacteria | 3826 |
| 359 | Ga0310105_103633 | 3300031666 | Eukaryota | 1731 |
| 360 | Ga0310111_104370 | 3300031667 | Eukaryota | 1773 |
| 361 | Ga0310114_103105 | 3300031678 | Eukaryota | 1664 |
| 362 | Ga0310119_104453 | 3300031686 | Eukaryota | 1729 |
| 363 | Ga0310101_104287 | 3300031690 | Eukaryota | 1719 |
| 364 | Ga0316579_10000505 | 3300031691 | Bacteria | 12751 |
| 365 | Ga0316579_10001795 | 3300031691 | Bacteria | 7907 |
| 366 | Ga0316579_10042392 | 3300031691 | Bacteria | 2114 |
| 367 | Ga0316579_10088854 | 3300031691 | Bacteria | 1475 |
| 368 | Ga0265314_10000075 | 3300031711 | Bacteria | 147341 |
| 369 | Ga0265314_10002010 | 3300031711 | Bacteria | 21589 |
| 370 | Ga0265314_10002372 | 3300031711 | Bacteria | 19404 |
| 371 | Ga0265314_10011671 | 3300031711 | Bacteria | 7228 |
| 372 | Ga0265342_10000036 | 3300031712 | Bacteria | 142882 |
| 373 | Ga0265342_10001387 | 3300031712 | Bacteria | 22662 |
| 374 | Ga0265342_10006550 | 3300031712 | Bacteria | 8663 |
| 375 | Ga0265342_10013145 | 3300031712 | Bacteria | 5568 |
| 376 | Ga0316576_10000646 | 3300031727 | Bacteria | 16869 |
| 377 | Ga0316576_10013873 | 3300031727 | Bacteria | 5370 |
| 378 | Ga0316576_10014391 | 3300031727 | Bacteria | 5287 |
| 379 | Ga0316576_10025226 | 3300031727 | Bacteria | 4160 |
| 380 | Ga0316576_10085253 | 3300031727 | Bacteria | 2348 |
| 381 | Ga0316576_10196212 | 3300031727 | Bacteria | 1521 |
| 382 | Ga0316578_10000138 | 3300031728 | Bacteria | 18681 |
| 383 | Ga0316578_10002792 | 3300031728 | Bacteria | 7788 |
| 384 | Ga0316578_10012025 | 3300031728 | Bacteria | 4555 |
| 385 | Ga0316578_10034400 | 3300031728 | Bacteria | 2909 |
| 386 | Ga0316577_10000619 | 3300031733 | Bacteria | 14703 |
| 387 | Ga0316577_10031429 | 3300031733 | Bacteria | 2966 |
| 388 | Ga0316044_103932 | 3300031810 | Eukaryota | 1844 |
| 389 | Ga0316045_107597 | 3300031815 | Eukaryota | 1336 |
| 390 | Ga0316042_105845 | 3300031816 | Eukaryota | 1784 |
| 391 | Ga0307413_10010359 | 3300031824 | Bacteria | 4518 |
| 392 | Ga0316043_105265 | 3300031828 | Eukaryota | 1845 |
| 393 | Ga0307410_10076337 | 3300031852 | Bacteria | 2339 |
| 394 | Ga0307411_10205028 | 3300032005 | Bacteria | 1518 |
| 395 | Ga0316585_10001681 | 3300032137 | Bacteria | 5872 |
| 396 | Ga0316580_10000109 | 3300032139 | Bacteria | 15261 |
| 397 | Ga0316593_10000214 | 3300032168 | Bacteria | 9231 |
| 398 | Ga0316593_10000891 | 3300032168 | Bacteria | 6089 |
| 399 | Ga0316593_10001595 | 3300032168 | Bacteria | 5058 |
| 400 | Ga0316593_10002198 | 3300032168 | Bacteria | 4560 |
| 401 | Ga0316593_10002464 | 3300032168 | Bacteria | 4400 |
| 402 | Ga0316593_10002612 | 3300032168 | Bacteria | 4313 |
| 403 | Ga0316593_10002718 | 3300032168 | Bacteria | 4261 |
| 404 | Ga0316593_10002806 | 3300032168 | Bacteria | 4217 |
| 405 | Ga0316593_10002911 | 3300032168 | Bacteria | 4158 |
| 406 | Ga0316593_10013592 | 3300032168 | Bacteria | 2413 |
| 407 | Ga0316593_10014224 | 3300032168 | Bacteria | 2370 |
| 408 | Ga0316593_10015004 | 3300032168 | Bacteria | 2323 |
| 409 | Ga0316593_10049495 | 3300032168 | Bacteria | 1417 |
| 410 | Ga0316592_1000598 | 3300033524 | Bacteria | 5204 |
| 411 | Ga0316592_1001089 | 3300033524 | Bacteria | 4238 |
| 412 | Ga0316592_1001125 | 3300033524 | Bacteria | 4189 |
| 413 | Ga0316592_1002859 | 3300033524 | Bacteria | 3038 |
| 414 | Ga0316592_1006374 | 3300033524 | Bacteria | 2270 |
| 415 | Ga0316586_1002792 | 3300033527 | Bacteria | 2220 |
| 416 | Ga0316588_1000277 | 3300033528 | Bacteria | 6330 |
| 417 | Ga0316588_1000863 | 3300033528 | Bacteria | 4613 |
| 418 | Ga0316588_1007063 | 3300033528 | Bacteria | 2269 |
| 419 | Ga0316588_1008669 | 3300033528 | Bacteria | 2100 |
| 420 | Ga0316588_1011486 | 3300033528 | Bacteria | 1890 |
| 421 | Ga0316587_1003084 | 3300033529 | Bacteria | 2300 |
| 422 | Ga0316587_1003135 | 3300033529 | Bacteria | 2287 |
| 423 | Ga0316587_1003987 | 3300033529 | Bacteria | 2114 |
| 424 | Ga0316596_1000225 | 3300033541 | Bacteria | 8518 |
| 425 | Ga0316596_1000831 | 3300033541 | Bacteria | 5743 |
| 426 | Ga0316596_1001071 | 3300033541 | Bacteria | 5302 |
| 427 | Ga0316596_1001094 | 3300033541 | Bacteria | 5271 |
| 428 | Ga0316596_1004419 | 3300033541 | Bacteria | 3153 |
| 429 | Ga0316596_1004697 | 3300033541 | Bacteria | 3082 |
| 430 | Ga0316596_1014144 | 3300033541 | Bacteria | 1976 |
| 431 | Ga0373932_0000055 | 3300035112 | Bacteria | 27399 |
| 432 | Ga0373946_0002592 | 3300035171 | Bacteria | 6390 |
| 433 | Ga0373955_0113004 | 3300035172 | Bacteria | 1572 |
| 434 | Ga0316574_0000468 | 3300035398 | Bacteria | 16332 |
| 435 | Ga0316574_0030927 | 3300035398 | Bacteria | 3245 |
| 436 | Ga0316574_0031449 | 3300035398 | Bacteria | 3219 |
| 437 | Ga0316574_0031477 | 3300035398 | Bacteria | 3217 |
| 438 | Ga0373924_0037024 | 3300035410 | Bacteria | 1984 |
| 439 | Ga0373935_0020269 | 3300035692 | Bacteria | 4061 |
| 440 | Ga0373927_0053330 | 3300035695 | Unclassified | 2616 |
| 441 | Ga0373933_0031292 | 3300035724 | Bacteria | 3087 |
| 442 | Ga0373947_0054811 | 3300035725 | Bacteria | 2407 |
| 443 | Ga0373937_0004297 | 3300036401 | Bacteria | 12074 |
| 444 | Ga0373937_0045671 | 3300036401 | Bacteria | 4003 |
| 445 | Ga0373937_0088535 | 3300036401 | Unclassified | 2866 |
| 446 | Ga0373937_0160694 | 3300036401 | Bacteria | 2106 |
| 447 | Ga0372808_005429 | 3300036459 | Eukaryota | 1681 |
| 448 | Ga0310109_005480 | 3300036534 | Eukaryota | 1626 |
| 449 | Ga0310110_006088 | 3300036535 | Eukaryota | 1749 |
| 450 | Ga0316582_0000060 | 3300036647 | Bacteria | 27489 |
| 451 | Ga0316582_0125968 | 3300036647 | Bacteria | 1717 |
| 452 | Ga0316582_0178068 | 3300036647 | Bacteria | 1446 |
| 453 | Ga0316584_0003005 | 3300036712 | Bacteria | 10859 |
| 454 | Ga0316584_0010119 | 3300036712 | Bacteria | 6579 |
| 455 | Ga0316584_0038308 | 3300036712 | Bacteria | 3566 |
| 456 | Ga0316584_0161767 | 3300036712 | Bacteria | 1663 |
| 457 | Ga0395899_0005070 | 3300037312 | Bacteria | 10249 |
| 458 | Ga0395899_0137742 | 3300037312 | Bacteria | 1739 |
| 459 | Ga0436364_0737248 | 3300037853 | Bacteria | 154680 |
| 460 | Ga0436364_1071411 | 3300037853 | Bacteria | 28160 |
| 461 | Ga0395901_0204732 | 3300038443 | Bacteria | 2068 |
| 462 | Ga0395901_0303232 | 3300038443 | Bacteria | 1656 |
| 463 | Ga0400490_07674 | 3300038726 | Bacteria | 4689 |
| 464 | Ga0400490_13033 | 3300038726 | Bacteria | 1565 |
| 465 | Ga0400483_057130 | 3300039062 | Bacteria | 2685 |
| 466 | Ga0400487_14277 | 3300039110 | Bacteria | 29430 |
| 467 | Ga0400487_30204 | 3300039110 | Bacteria | 1445 |
| 468 | Ga0436365_0285258 | 3300039437 | Bacteria | 125381 |
| 469 | Ga0436365_0316969 | 3300039437 | Bacteria | 1339 |
| 470 | Ga0436365_1560237 | 3300039437 | Bacteria | 1206 |
| 471 | Ga0436360_0074223 | 3300039438 | Bacteria | 1387 |
| 472 | Ga0436362_0290872 | 3300039453 | Bacteria | 21554 |
| 473 | Ga0451808_23863 | 3300041464 | Eukaryota | 1279 |
| 474 | Ga0439460_0009618 | 3300042461 | Bacteria | 2457 |
| 475 | Ga0451577_0001329 | 3300042876 | Bacteria | 33659 |
| 476 | Ga0451577_0031390 | 3300042876 | Bacteria | 4793 |
| 477 | Ga0451577_0083955 | 3300042876 | Bacteria | 2842 |
| 478 | Ga0451577_0174771 | 3300042876 | Bacteria | 1935 |
| 479 | Ga0451577_0328222 | 3300042876 | Bacteria | 1388 |
| 480 | Ga0453684_0000006 | 3300044712 | Bacteria | 1364191 |
| 481 | Ga0453684_0000031 | 3300044712 | Bacteria | 752632 |
| 482 | Ga0453684_0000040 | 3300044712 | Bacteria | 690210 |
| 483 | Ga0453684_0000443 | 3300044712 | Bacteria | 168617 |
| 484 | Ga0453684_0004682 | 3300044712 | Bacteria | 28347 |
| 485 | Ga0453684_0008845 | 3300044712 | Bacteria | 17849 |
| 486 | Ga0453684_0020635 | 3300044712 | Bacteria | 9917 |
| 487 | Ga0453684_0047639 | 3300044712 | Bacteria | 5681 |
| 488 | Ga0453684_0051285 | 3300044712 | Bacteria | 5412 |
| 489 | Ga0453684_0061007 | 3300044712 | Bacteria | 4844 |
| 490 | Ga0453684_0086333 | 3300044712 | Bacteria | 3894 |
| 491 | Ga0453684_0117756 | 3300044712 | Bacteria | 3214 |
| 492 | Ga0453684_0221511 | 3300044712 | Bacteria | 2191 |
| 493 | Ga0466970_0027199 | 3300044765 | Bacteria | 3000 |
| 494 | Ga0451576_0000444 | 3300045051 | Bacteria | 94213 |
| 495 | Ga0451576_0001947 | 3300045051 | Bacteria | 32995 |
| 496 | Ga0451576_0008389 | 3300045051 | Bacteria | 12131 |
| 497 | Ga0451576_0052813 | 3300045051 | Bacteria | 4259 |
| 498 | Ga0466967_0191703 | 3300045976 | Bacteria | 1932 |
| 499 | Ga0495629_0430314 | 3300046459 | Bacteria | 895 |
| 500 | Ga0495580_0189672 | 3300046472 | Bacteria | 1418 |
| 501 | Ga0495639_0131470 | 3300046475 | Bacteria | 1199 |
| 502 | Ga0495594_0038846 | 3300046499 | Bacteria | 2601 |
| 503 | Ga0495628_0115124 | 3300046516 | Bacteria | 2065 |
| 504 | Ga0495613_0014285 | 3300046689 | Bacteria | 5893 |
| 505 | Ga0495581_0071720 | 3300047315 | Bacteria | 2004 |
| 506 | Ga0495679_008345 | 3300047446 | Bacteria | 4220 |
| 507 | Ga0496100_0077705 | 3300048903 | Bacteria | 2232 |
| 508 | Ga0496101_0000685 | 3300048904 | Bacteria | 20428 |
| 509 | Ga0496110_0001960 | 3300048913 | Bacteria | 15284 |
| 510 | Ga0496114_0000504 | 3300048917 | Bacteria | 28590 |
| 511 | Ga0496116_0000473 | 3300048919 | Bacteria | 55659 |
| 512 | Ga0496116_0011173 | 3300048919 | Bacteria | 7460 |
| 513 | Ga0496117_0000161 | 3300048920 | Bacteria | 141379 |
| 514 | Ga0496119_0000042 | 3300048922 | Bacteria | 200701 |
| 515 | Ga0496119_0068224 | 3300048922 | Bacteria | 2094 |
| 516 | Ga0496120_0000083 | 3300048923 | Bacteria | 157876 |
| 517 | Ga0496120_0002573 | 3300048923 | Bacteria | 18078 |
| 518 | Ga0496120_0002667 | 3300048923 | Bacteria | 17583 |
| 519 | Ga0496120_0097456 | 3300048923 | Bacteria | 1560 |
| 520 | Ga0496122_0000012 | 3300048925 | Bacteria | 526837 |
| 521 | Ga0496122_0000143 | 3300048925 | Bacteria | 168086 |
| 522 | Ga0496122_0031007 | 3300048925 | Bacteria | 4461 |
| 523 | Ga0496123_0001574 | 3300048926 | Bacteria | 31186 |
| 524 | Ga0496123_0004362 | 3300048926 | Bacteria | 14953 |
| 525 | Ga0496124_0034437 | 3300048927 | Bacteria | 4445 |
| 526 | Ga0496125_0000010 | 3300048928 | Bacteria | 671167 |
| 527 | Ga0496125_0044489 | 3300048928 | Bacteria | 3754 |
| 528 | Ga0496126_0000008 | 3300048929 | Bacteria | 781752 |
| 529 | Ga0496126_0000091 | 3300048929 | Bacteria | 209427 |
| 530 | Ga0496126_0000211 | 3300048929 | Bacteria | 129943 |
| 531 | Ga0496126_0000461 | 3300048929 | Bacteria | 80907 |
| 532 | Ga0496126_0077610 | 3300048929 | Bacteria | 2944 |
| 533 | Ga0496126_0103372 | 3300048929 | Bacteria | 2489 |
| 534 | Ga0496126_0194040 | 3300048929 | Bacteria | 1718 |
| 535 | Ga0501033_0040199 | 3300049570 | Bacteria | 3492 |
| 536 | Ga0501033_0064824 | 3300049570 | Bacteria | 2688 |
| 537 | Ga0501034_0008338 | 3300049571 | Bacteria | 10964 |
| 538 | Ga0501034_0016341 | 3300049571 | Bacteria | 7616 |
| 539 | Ga0501034_0020427 | 3300049571 | Bacteria | 6762 |
| 540 | Ga0501034_0025878 | 3300049571 | Bacteria | 5976 |
| 541 | Ga0501034_0123689 | 3300049571 | Bacteria | 2573 |
| 542 | Ga0501037_0013024 | 3300049573 | Bacteria | 6132 |
| 543 | Ga0501038_0190991 | 3300049574 | Unclassified | 1648 |
| 544 | Ga0501038_0269703 | 3300049574 | Bacteria | 1342 |
| 545 | Ga0501039_0075705 | 3300049575 | Bacteria | 2616 |
| 546 | Ga0501039_0245589 | 3300049575 | Bacteria | 1408 |
| 547 | Ga0501040_0064347 | 3300049576 | Bacteria | 2525 |
| 548 | Ga0501043_0158977 | 3300049579 | Bacteria | 1766 |
| 549 | Ga0501046_0000037 | 3300049580 | Bacteria | 159431 |
| 550 | Ga0501046_0017699 | 3300049580 | Bacteria | 5944 |
| 551 | Ga0501046_0067503 | 3300049580 | Bacteria | 2785 |
| 552 | Ga0501046_0238754 | 3300049580 | Unclassified | 1341 |
| 553 | Ga0501046_0274392 | 3300049580 | Bacteria | 1236 |
| 554 | Ga0501047_0009603 | 3300049581 | Bacteria | 9146 |
| 555 | Ga0501047_0011106 | 3300049581 | Bacteria | 8524 |
| 556 | Ga0501047_0012186 | 3300049581 | Bacteria | 8139 |
| 557 | Ga0501047_0136512 | 3300049581 | Unclassified | 2333 |
| 558 | Ga0501047_0345080 | 3300049581 | Unclassified | 1326 |
| 559 | Ga0501047_0371387 | 3300049581 | Bacteria | 1265 |
| 560 | Ga0501067_0121998 | 3300049583 | Bacteria | 1450 |
| 561 | Ga0501069_0068051 | 3300049585 | Bacteria | 1993 |
| 562 | Ga0501070_0001559 | 3300049586 | Bacteria | 20381 |
| 563 | Ga0501070_0008616 | 3300049586 | Bacteria | 8626 |
| 564 | Ga0501070_0033085 | 3300049586 | Bacteria | 4325 |
| 565 | Ga0501071_0007295 | 3300049587 | Bacteria | 7239 |
| 566 | Ga0501071_0015020 | 3300049587 | Bacteria | 5308 |
| 567 | Ga0501071_0145197 | 3300049587 | Bacteria | 1768 |
| 568 | Ga0501072_0015283 | 3300049588 | Bacteria | 5885 |
| 569 | Ga0501073_0008905 | 3300049589 | Bacteria | 7417 |
| 570 | Ga0501073_0050679 | 3300049589 | Bacteria | 2909 |
| 571 | Ga0501074_0288167 | 3300049590 | Bacteria | 1167 |
| 572 | Ga0501075_0040114 | 3300049591 | Bacteria | 3505 |
| 573 | Ga0501075_0112808 | 3300049591 | Bacteria | 2067 |
| 574 | Ga0501079_0181947 | 3300049741 | Bacteria | 1640 |
| 575 | Ga0501080_0182497 | 3300049742 | Bacteria | 1930 |
| 576 | Ga0501080_0283637 | 3300049742 | Bacteria | 1505 |
| 577 | Ga0501081_0042837 | 3300049743 | Bacteria | 3103 |
| 578 | Ga0501035_0062267 | 3300049822 | Bacteria | 3320 |
| 579 | Ga0501044_0001456 | 3300049823 | Bacteria | 27781 |
| 580 | Ga0501044_0007831 | 3300049823 | Bacteria | 11744 |
| 581 | Ga0501044_0008147 | 3300049823 | Bacteria | 11499 |
| 582 | Ga0501044_0011204 | 3300049823 | Bacteria | 9724 |
| 583 | Ga0501044_0021481 | 3300049823 | Bacteria | 6883 |
| 584 | Ga0501044_0069608 | 3300049823 | Bacteria | 3582 |
| 585 | Ga0501044_0187234 | 3300049823 | Bacteria | 2034 |
| 586 | Ga0501044_0247975 | 3300049823 | Bacteria | 1723 |
| 587 | nmdc:mga05p37_30065_c1 | 3300050507 | Bacteria | 6629 |
| 588 | nmdc:mga05p37_99915_c1 | 3300050507 | Bacteria | 3573 |
| 589 | nmdc:mga0qj67_10476_c1 | 3300050509 | Bacteria | 6925 |
| 590 | nmdc:mga0qj67_122431_c1 | 3300050509 | Archaea | 2104 |
| 591 | nmdc:mga0qj67_296941_c1 | 3300050509 | Unclassified | 1309 |
| 592 | nmdc:mga06r32_38774_c1 | 3300050510 | Bacteria | 4517 |
| 593 | nmdc:mga08y16_123166_c1 | 3300050511 | Bacteria | 2698 |
| 594 | nmdc:mga08y16_148615_c1 | 3300050511 | Bacteria | 2436 |
| 595 | nmdc:mga08y16_5843_c1 | 3300050511 | Bacteria | 12897 |
| 596 | nmdc:mga08y16_6667_c1 | 3300050511 | Bacteria | 12111 |
| 597 | nmdc:mga0n895_117899_c1 | 3300050512 | Bacteria | 2674 |
| 598 | nmdc:mga0n895_53041_c1 | 3300050512 | Bacteria | 3982 |
| 599 | nmdc:mga0rr50_84970_c1 | 3300050513 | Bacteria | 2451 |
| 600 | nmdc:mga08x19_191_c1 | 3300050514 | Bacteria | 48247 |
| 601 | nmdc:mga08x19_1_c1 | 3300050514 | Bacteria | 2010344 |
| 602 | nmdc:mga0a205_12338_c1 | 3300050515 | Bacteria | 7904 |
| 603 | nmdc:mga0a205_34810_c1 | 3300050515 | Bacteria | 4833 |
| 604 | Ga0495619_0324326 | 3300053085 | Bacteria | 1066 |
| 605 | Ga0500646_0023522 | 3300053090 | Bacteria | 1653 |
| 606 | Ga0500647_0032015 | 3300053091 | Bacteria | 2504 |
| 607 | Ga0500556_0008031 | 3300053104 | Bacteria | 3035 |
| 608 | Ga0500562_000318 | 3300053108 | Bacteria | 11718 |
| 609 | Ga0500595_003547 | 3300053119 | Bacteria | 7249 |
| 610 | Ga0500568_0000362 | 3300053139 | Bacteria | 35157 |
| 611 | Ga0590075_015137 | 3300059424 | Bacteria | 1892 |
| 612 | Ga0587072_006742 | 3300059643 | Eukaryota | 1759 |
| 613 | Ga0587071_007502 | 3300060344 | Eukaryota | 1741 |
| 614 | Ga0501082_0039733 | 3300060353 | Bacteria | 4059 |
| 615 | Ga0501082_0226141 | 3300060353 | Bacteria | 1628 |
| 616 | 2511699025 | 2511231119 | Bacteria | 4019861 |
| 617 | 2524613334 | 2524023250 | Bacteria | 5457705 |
| 618 | 2540606256 | 2540341094 | Bacteria | 4061186 |
| 619 | 3006880276 | 3006879489 | Bacteria | 4064221 |
| 620 | Ga0311003_166887 | |||
| 621 | Ga0006556J51387_1011473 | |||
| 622 | Ga0070658_10000031 | |||
| 623 | Ga0070658_10046994 | |||
| 624 | Ga0070658_10172234 | |||
| 625 | Ga0070683_100017049 | |||
| 626 | Ga0070683_100084079 | |||
| 627 | Ga0070683_100122865 | |||
| 628 | Ga0070670_100000150 | |||
| 629 | Ga0068869_100032869 | |||
| 630 | Ga0068869_100043285 | |||
| 631 | Ga0070666_10003473 | |||
| 632 | Ga0070666_10181348 | |||
| 633 | Ga0070680_100043532 | |||
| 634 | Ga0068868_100000028 | |||
| 635 | Ga0068868_100013770 | |||
| 636 | Ga0068868_100265865 | |||
| 637 | Ga0070669_100004094 | |||
| 638 | Ga0070669_100083407 | |||
| 639 | Ga0070674_100011652 | |||
| 640 | Ga0070667_100026186 | |||
| 641 | Ga0070709_10016682 | |||
| 642 | Ga0070709_10023748 | |||
| 643 | Ga0070709_10057517 | |||
| 644 | Ga0070709_10058667 | |||
| 645 | Ga0070713_100010196 | |||
| 646 | Ga0070713_100065385 | |||
| 647 | Ga0070713_100127647 | |||
| 648 | Ga0070700_100001476 | |||
| 649 | Ga0070694_100002182 | |||
| 650 | Ga0070708_100001314 | |||
| 651 | Ga0070708_100022493 | |||
| 652 | Ga0070708_100052716 | |||
| 653 | Ga0070708_100095262 | |||
| 654 | Ga0070678_100355853 | |||
| 655 | Ga0070681_10025507 | |||
| 656 | Ga0070681_10059776 | |||
| 657 | Ga0070681_10121591 | |||
| 658 | Ga0070681_10412664 | |||
| 659 | Ga0068867_100305274 | |||
| 660 | Ga0070706_100023926 | |||
| 661 | Ga0070707_100000212 | |||
| 662 | Ga0070707_100008812 | |||
| 663 | Ga0070707_100017858 | |||
| 664 | Ga0070707_100059473 | |||
| 665 | Ga0070707_100299199 | |||
| 666 | Ga0070698_100013553 | |||
| 667 | Ga0070699_100205394 | |||
| 668 | Ga0070679_100035527 | |||
| 669 | Ga0070679_100120828 | |||
| 670 | Ga0070684_100073268 | |||
| 671 | Ga0070697_100027109 | |||
| 672 | Ga0070697_100048957 | |||
| 673 | Ga0068853_100008821 | |||
| 674 | Ga0070686_100037862 | |||
| 675 | Ga0070665_100005701 | |||
| 676 | Ga0070665_100032461 | |||
| 677 | Ga0070704_100022666 | |||
| 678 | Ga0070704_100084877 | |||
| 679 | Ga0070704_100100026 | |||
| 680 | Ga0070704_100160408 | |||
| 681 | Ga0068855_100010762 | |||
| 682 | Ga0068855_100082385 | |||
| 683 | Ga0068855_100159601 | |||
| 684 | Ga0068855_100192597 | |||
| 685 | Ga0070664_100069911 | |||
| 686 | Ga0070664_100174068 | |||
| 687 | Ga0068857_100050661 | |||
| 688 | Ga0068857_100095725 | |||
| 689 | Ga0068854_100008184 | |||
| 690 | Ga0068854_100009584 | |||
| 691 | Ga0068854_100017695 | |||
| 692 | Ga0068854_100309491 | |||
| 693 | Ga0068856_100024922 | |||
| 694 | Ga0068859_100000020 | |||
| 695 | Ga0068859_100074968 | |||
| 696 | Ga0068859_100435552 | |||
| 697 | Ga0068866_10143341 | |||
| 698 | Ga0068866_10175749 | |||
| 699 | Ga0068863_100004416 | |||
| 700 | Ga0068858_100017600 | |||
| 701 | Ga0068862_100003559 | |||
| 702 | Ga0081455_10195861 | |||
| 703 | Ga0081455_10215603 | |||
| 704 | Ga0081538_10029223 | |||
| 705 | Ga0081539_10002036 | |||
| 706 | Ga0070715_10056253 | |||
| 707 | Ga0070716_100053321 | |||
| 708 | Ga0097621_100000311 | |||
| 709 | Ga0097621_100013066 | |||
| 710 | Ga0097621_100021142 | |||
| 711 | Ga0097621_100091017 | |||
| 712 | Ga0097621_100105192 | |||
| 713 | Ga0068871_100000337 | |||
| 714 | Ga0068871_100020930 | |||
| 715 | Ga0068871_100034122 | |||
| 716 | Ga0068871_100108356 | |||
| 717 | Ga0075428_100009648 | |||
| 718 | Ga0075428_100160572 | |||
| 719 | Ga0075430_100006967 | |||
| 720 | Ga0075430_100307845 | |||
| 721 | Ga0075431_100043392 | |||
| 722 | Ga0075433_10050783 | |||
| 723 | Ga0075429_100360010 | |||
| 724 | Ga0068865_100108607 | |||
| 725 | Ga0075436_100000019 | |||
| 726 | Ga0075436_100005231 | |||
| 727 | Ga0075436_100088435 | |||
| 728 | Ga0097620_100000020 | |||
| 729 | Ga0097620_100074969 | |||
| 730 | Ga0075435_100027225 | |||
| 731 | Ga0075435_100036063 | |||
| 732 | Ga0099794_10124541 | |||
| 733 | Ga0105240_10000709 | |||
| 734 | Ga0105240_10001828 | |||
| 735 | Ga0105240_10002450 | |||
| 736 | Ga0105240_10024692 | |||
| 737 | Ga0105240_10271050 | |||
| 738 | Ga0105240_10286117 | |||
| 739 | Ga0105240_10372065 | |||
| 740 | Ga0105240_10816088 | |||
| 741 | Ga0111539_10023461 | |||
| 742 | Ga0111539_10585367 | |||
| 743 | Ga0105245_10000006 | |||
| 744 | Ga0105245_10041058 | |||
| 745 | Ga0105245_10055670 | |||
| 746 | Ga0114129_10009063 | |||
| 747 | Ga0114129_10009389 | |||
| 748 | Ga0114129_10121730 | |||
| 749 | Ga0114129_10244860 | |||
| 750 | Ga0105243_10019800 | |||
| 751 | Ga0105243_10080782 | |||
| 752 | Ga0105241_10017922 | |||
| 753 | Ga0105242_10035151 | |||
| 754 | Ga0105242_10046504 | |||
| 755 | Ga0105242_10054735 | |||
| 756 | Ga0105242_10055158 | |||
| 757 | Ga0105242_10129387 | |||
| 758 | Ga0105242_10235811 | |||
| 759 | Ga0105242_10340141 | |||
| 760 | Ga0105242_10399517 | |||
| 761 | Ga0105248_10043934 | |||
| 762 | Ga0105248_10284402 | |||
| 763 | Ga0105248_10289128 | |||
| 764 | Ga0105248_10349316 | |||
| 765 | Ga0105248_10350601 | |||
| 766 | Ga0105237_10016005 | |||
| 767 | Ga0105237_10077379 | |||
| 768 | Ga0105237_10344895 | |||
| 769 | Ga0105238_10000005 | |||
| 770 | Ga0105238_10000280 | |||
| 771 | Ga0105238_10028945 | |||
| 772 | Ga0105238_10046516 | |||
| 773 | Ga0105249_10298886 | |||
| 774 | Ga0099796_10042197 | |||
| 775 | Ga0105239_10030322 | |||
| 776 | Ga0105239_10319108 | |||
| 777 | Ga0105246_10310124 | |||
| 778 | Ga0157370_10011961 | |||
| 779 | Ga0157370_10230790 | |||
| 780 | Ga0157369_10013806 | |||
| 781 | Ga0157374_10000006 | |||
| 782 | Ga0157374_10024485 | |||
| 783 | Ga0157374_10076596 | |||
| 784 | Ga0157374_10417890 | |||
| 785 | Ga0157378_10000392 | |||
| 786 | Ga0157378_10000546 | |||
| 787 | Ga0157378_10044854 | |||
| 788 | Ga0157378_10130147 | |||
| 789 | Ga0157378_10622048 | |||
| 790 | Ga0163162_10712382 | |||
| 791 | Ga0157375_10000020 | |||
| 792 | Ga0157375_10001825 | |||
| 793 | Ga0157375_10029787 | |||
| 794 | Ga0163163_10004027 | |||
| 795 | Ga0163163_10013311 | |||
| 796 | Ga0163163_10300986 | |||
| 797 | Ga0163163_10646770 | |||
| 798 | Ga0157380_10010219 | |||
| 799 | Ga0157380_10036868 | |||
| 800 | Ga0157380_10041149 | |||
| 801 | Ga0157377_10000003 | |||
| 802 | Ga0157377_10000058 | |||
| 803 | Ga0157379_10020283 | |||
| 804 | Ga0157379_10235498 | |||
| 805 | Ga0157376_10000003 | |||
| 806 | Ga0157376_10046466 | |||
| 807 | Ga0157376_10084219 | |||
| 808 | Ga0206350_11627179 | |||
| 809 | Ga0213872_10006403 | |||
| 810 | Ga0213876_10000066 | |||
| 811 | Ga0213875_10000007 | |||
| 812 | Ga0213875_10000106 | |||
| 813 | Ga0247519_103124 | |||
| 814 | Ga0247521_102742 | |||
| 815 | Ga0247526_102872 | |||
| 816 | Ga0247529_102722 | |||
| 817 | Ga0247514_104156 | |||
| 818 | Ga0247518_104073 | |||
| 819 | Ga0247516_103221 | |||
| 820 | Ga0247530_102387 | |||
| 821 | Ga0247515_103435 | |||
| 822 | Ga0247531_102643 | |||
| 823 | Ga0247525_102936 | |||
| 824 | Ga0247528_101855 | |||
| 825 | Ga0247513_102936 | |||
| 826 | Ga0247523_103185 | |||
| 827 | Ga0247520_102551 | |||
| 828 | Ga0247522_103035 | |||
| 829 | Ga0247517_102647 | |||
| 830 | Ga0247512_103865 | |||
| 831 | Ga0207680_10002204 | |||
| 832 | Ga0207680_10046049 | |||
| 833 | Ga0207685_10002870 | |||
| 834 | Ga0207685_10028005 | |||
| 835 | Ga0207699_10013707 | |||
| 836 | Ga0207699_10271570 | |||
| 837 | Ga0207684_10045746 | |||
| 838 | Ga0207684_10082937 | |||
| 839 | Ga0207654_10048879 | |||
| 840 | Ga0207707_10042755 | |||
| 841 | Ga0207707_10215493 | |||
| 842 | Ga0207707_10228133 | |||
| 843 | Ga0207695_10001011 | |||
| 844 | Ga0207695_10006315 | |||
| 845 | Ga0207695_10030423 | |||
| 846 | Ga0207695_10169614 | |||
| 847 | Ga0207671_10008147 | |||
| 848 | Ga0207646_10000400 | |||
| 849 | Ga0207646_10052648 | |||
| 850 | Ga0207646_10084605 | |||
| 851 | Ga0207646_10088820 | |||
| 852 | Ga0207681_10011441 | |||
| 853 | Ga0207681_10025476 | |||
| 854 | Ga0207694_10000001 | |||
| 855 | Ga0207694_10001089 | |||
| 856 | Ga0207694_10009910 | |||
| 857 | Ga0207650_10000115 | |||
| 858 | Ga0207659_10090601 | |||
| 859 | Ga0207687_10000006 | |||
| 860 | Ga0207687_10152484 | |||
| 861 | Ga0207687_10192973 | |||
| 862 | Ga0207700_10005799 | |||
| 863 | Ga0207700_10031518 | |||
| 864 | Ga0207700_10133268 | |||
| 865 | Ga0207700_10133874 | |||
| 866 | Ga0207700_10430126 | |||
| 867 | Ga0207644_10238397 | |||
| 868 | Ga0207686_10025778 | |||
| 869 | Ga0207686_10068741 | |||
| 870 | Ga0207686_10130428 | |||
| 871 | Ga0207686_10328215 | |||
| 872 | Ga0207709_10246936 | |||
| 873 | Ga0207669_10006835 | |||
| 874 | Ga0207704_10055508 | |||
| 875 | Ga0207704_10068995 | |||
| 876 | Ga0207691_10119865 | |||
| 877 | Ga0207711_10019284 | |||
| 878 | Ga0207711_10072826 | |||
| 879 | Ga0207711_10119099 | |||
| 880 | Ga0207711_10306079 | |||
| 881 | Ga0207689_10029178 | |||
| 882 | Ga0207689_10098455 | |||
| 883 | Ga0207661_10000006 | |||
| 884 | Ga0207661_10134858 | |||
| 885 | Ga0207667_10010726 | |||
| 886 | Ga0207667_10026193 | |||
| 887 | Ga0207667_10061271 | |||
| 888 | Ga0207658_10267203 | |||
| 889 | Ga0207677_10000153 | |||
| 890 | Ga0207677_10013946 | |||
| 891 | Ga0207677_10019662 | |||
| 892 | Ga0207677_10063496 | |||
| 893 | Ga0207677_10106202 | |||
| 894 | Ga0207703_10148414 | |||
| 895 | Ga0207639_10030065 | |||
| 896 | Ga0207678_10001896 | |||
| 897 | Ga0207708_10009060 | |||
| 898 | Ga0207708_10013355 | |||
| 899 | Ga0207702_10018806 | |||
| 900 | Ga0207702_10107075 | |||
| 901 | Ga0207641_10009778 | |||
| 902 | Ga0207648_10042300 | |||
| 903 | Ga0207676_10013266 | |||
| 904 | Ga0207674_10058553 | |||
| 905 | Ga0207674_10250715 | |||
| 906 | Ga0207675_100038552 | |||
| 907 | Ga0207683_10217638 | |||
| 908 | Ga0207428_10000486 | |||
| 909 | Ga0207428_10003655 | |||
| 910 | Ga0207428_10031154 | |||
| 911 | Ga0207428_10069883 | |||
| 912 | Ga0268266_10000835 | |||
| 913 | Ga0268266_10002480 | |||
| 914 | Ga0268266_10158828 | |||
| 915 | Ga0268265_10005666 | |||
| 916 | Ga0268264_10048107 | |||
| 917 | Ga0265319_1011501 | |||
| 918 | Ga0265318_10000347 | |||
| 919 | Ga0265318_10014030 | |||
| 920 | Ga0265318_10067830 | |||
| 921 | Ga0265323_10001639 | |||
| 922 | Ga0265323_10014205 | |||
| 923 | Ga0265323_10016449 | |||
| 924 | Ga0265338_10037679 | |||
| 925 | Ga0265338_10081345 | |||
| 926 | Ga0265324_10001058 | |||
| 927 | Ga0307511_10000628 | |||
| 928 | Ga0265330_10000718 | |||
| 929 | Ga0265330_10001084 | |||
| 930 | Ga0265330_10001195 | |||
| 931 | Ga0265330_10001697 | |||
| 932 | Ga0265330_10003679 | |||
| 933 | Ga0265332_10000920 | |||
| 934 | Ga0265332_10015406 | |||
| 935 | Ga0265332_10036827 | |||
| 936 | Ga0265328_10007066 | |||
| 937 | Ga0265328_10041183 | |||
| 938 | Ga0265320_10000726 | |||
| 939 | Ga0265320_10003799 | |||
| 940 | Ga0265325_10000903 | |||
| 941 | Ga0265325_10024890 | |||
| 942 | Ga0265325_10104286 | |||
| 943 | Ga0265329_10000666 | |||
| 944 | Ga0265329_10002112 | |||
| 945 | Ga0265340_10002116 | |||
| 946 | Ga0265339_10022601 | |||
| 947 | Ga0265339_10026493 | |||
| 948 | Ga0265331_10000019 | |||
| 949 | Ga0265331_10001289 | |||
| 950 | Ga0265331_10002335 | |||
| 951 | Ga0265331_10025540 | |||
| 952 | Ga0265331_10030086 | |||
| 953 | Ga0265331_10063376 | |||
| 954 | Ga0265331_10068780 | |||
| 955 | Ga0265327_10000420 | |||
| 956 | Ga0265316_10003160 | |||
| 957 | Ga0265316_10005513 | |||
| 958 | Ga0265316_10008129 | |||
| 959 | Ga0265316_10009835 | |||
| 960 | Ga0265316_10021159 | |||
| 961 | Ga0265316_10025959 | |||
| 962 | Ga0265316_10090391 | |||
| 963 | Ga0265316_10137640 | |||
| 964 | Ga0310116_103478 | |||
| 965 | Ga0310117_103307 | |||
| 966 | Ga0265313_10001693 | |||
| 967 | Ga0265313_10003004 | |||
| 968 | Ga0265313_10005305 | |||
| 969 | Ga0265313_10008011 | |||
| 970 | Ga0310103_105569 | |||
| 971 | Ga0310107_104984 | |||
| 972 | Ga0310108_103350 | |||
| 973 | Ga0310115_104372 | |||
| 974 | Ga0310113_103395 | |||
| 975 | Ga0316575_10004268 | |||
| 976 | Ga0316575_10004767 | |||
| 977 | Ga0316575_10008074 | |||
| 978 | Ga0310105_103633 | |||
| 979 | Ga0310111_104370 | |||
| 980 | Ga0310114_103105 | |||
| 981 | Ga0310119_104453 | |||
| 982 | Ga0310101_104287 | |||
| 983 | Ga0316579_10000505 | |||
| 984 | Ga0316579_10001795 | |||
| 985 | Ga0316579_10042392 | |||
| 986 | Ga0316579_10088854 | |||
| 987 | Ga0265314_10000075 | |||
| 988 | Ga0265314_10002010 | |||
| 989 | Ga0265314_10002372 | |||
| 990 | Ga0265314_10011671 | |||
| 991 | Ga0265342_10000036 | |||
| 992 | Ga0265342_10001387 | |||
| 993 | Ga0265342_10006550 | |||
| 994 | Ga0265342_10013145 | |||
| 995 | Ga0316576_10000646 | |||
| 996 | Ga0316576_10013873 | |||
| 997 | Ga0316576_10014391 | |||
| 998 | Ga0316576_10025226 | |||
| 999 | Ga0316576_10085253 | |||
| 1000 | Ga0316576_10196212 | |||
| 1001 | Ga0316578_10000138 | |||
| 1002 | Ga0316578_10002792 | |||
| 1003 | Ga0316578_10012025 | |||
| 1004 | Ga0316578_10034400 | |||
| 1005 | Ga0316577_10000619 | |||
| 1006 | Ga0316577_10031429 | |||
| 1007 | Ga0316044_103932 | |||
| 1008 | Ga0316045_107597 | |||
| 1009 | Ga0316042_105845 | |||
| 1010 | Ga0307413_10010359 | |||
| 1011 | Ga0316043_105265 | |||
| 1012 | Ga0307410_10076337 | |||
| 1013 | Ga0307411_10205028 | |||
| 1014 | Ga0316585_10001681 | |||
| 1015 | Ga0316580_10000109 | |||
| 1016 | Ga0316593_10000214 | |||
| 1017 | Ga0316593_10000891 | |||
| 1018 | Ga0316593_10001595 | |||
| 1019 | Ga0316593_10002198 | |||
| 1020 | Ga0316593_10002464 | |||
| 1021 | Ga0316593_10002612 | |||
| 1022 | Ga0316593_10002718 | |||
| 1023 | Ga0316593_10002806 | |||
| 1024 | Ga0316593_10002911 | |||
| 1025 | Ga0316593_10013592 | |||
| 1026 | Ga0316593_10014224 | |||
| 1027 | Ga0316593_10015004 | |||
| 1028 | Ga0316593_10049495 | |||
| 1029 | Ga0316592_1000598 | |||
| 1030 | Ga0316592_1001089 | |||
| 1031 | Ga0316592_1001125 | |||
| 1032 | Ga0316592_1002859 | |||
| 1033 | Ga0316592_1006374 | |||
| 1034 | Ga0316586_1002792 | |||
| 1035 | Ga0316588_1000277 | |||
| 1036 | Ga0316588_1000863 | |||
| 1037 | Ga0316588_1007063 | |||
| 1038 | Ga0316588_1008669 | |||
| 1039 | Ga0316588_1011486 | |||
| 1040 | Ga0316587_1003084 | |||
| 1041 | Ga0316587_1003135 | |||
| 1042 | Ga0316587_1003987 | |||
| 1043 | Ga0316596_1000225 | |||
| 1044 | Ga0316596_1000831 | |||
| 1045 | Ga0316596_1001071 | |||
| 1046 | Ga0316596_1001094 | |||
| 1047 | Ga0316596_1004419 | |||
| 1048 | Ga0316596_1004697 | |||
| 1049 | Ga0316596_1014144 | |||
| 1050 | Ga0373932_0000055 | |||
| 1051 | Ga0373946_0002592 | |||
| 1052 | Ga0373955_0113004 | |||
| 1053 | Ga0316574_0000468 | |||
| 1054 | Ga0316574_0030927 | |||
| 1055 | Ga0316574_0031449 | |||
| 1056 | Ga0316574_0031477 | |||
| 1057 | Ga0373924_0037024 | |||
| 1058 | Ga0373935_0020269 | |||
| 1059 | Ga0373927_0053330 | |||
| 1060 | Ga0373933_0031292 | |||
| 1061 | Ga0373947_0054811 | |||
| 1062 | Ga0373937_0004297 | |||
| 1063 | Ga0373937_0045671 | |||
| 1064 | Ga0373937_0088535 | |||
| 1065 | Ga0373937_0160694 | |||
| 1066 | Ga0372808_005429 | |||
| 1067 | Ga0310109_005480 | |||
| 1068 | Ga0310110_006088 | |||
| 1069 | Ga0316582_0000060 | |||
| 1070 | Ga0316582_0125968 | |||
| 1071 | Ga0316582_0178068 | |||
| 1072 | Ga0316584_0003005 | |||
| 1073 | Ga0316584_0010119 | |||
| 1074 | Ga0316584_0038308 | |||
| 1075 | Ga0316584_0161767 | |||
| 1076 | Ga0395899_0005070 | |||
| 1077 | Ga0395899_0137742 | |||
| 1078 | Ga0436364_0737248 | |||
| 1079 | Ga0436364_1071411 | |||
| 1080 | Ga0395901_0204732 | |||
| 1081 | Ga0395901_0303232 | |||
| 1082 | Ga0400490_07674 | |||
| 1083 | Ga0400490_13033 | |||
| 1084 | Ga0400483_057130 | |||
| 1085 | Ga0400487_14277 | |||
| 1086 | Ga0400487_30204 | |||
| 1087 | Ga0436365_0285258 | |||
| 1088 | Ga0436365_0316969 | |||
| 1089 | Ga0436365_1560237 | |||
| 1090 | Ga0436360_0074223 | |||
| 1091 | Ga0436362_0290872 | |||
| 1092 | Ga0451808_23863 | |||
| 1093 | Ga0439460_0009618 | |||
| 1094 | Ga0451577_0001329 | |||
| 1095 | Ga0451577_0031390 | |||
| 1096 | Ga0451577_0083955 | |||
| 1097 | Ga0451577_0174771 | |||
| 1098 | Ga0451577_0328222 | |||
| 1099 | Ga0453684_0000006 | |||
| 1100 | Ga0453684_0000031 | |||
| 1101 | Ga0453684_0000040 | |||
| 1102 | Ga0453684_0000443 | |||
| 1103 | Ga0453684_0004682 | |||
| 1104 | Ga0453684_0008845 | |||
| 1105 | Ga0453684_0020635 | |||
| 1106 | Ga0453684_0047639 | |||
| 1107 | Ga0453684_0051285 | |||
| 1108 | Ga0453684_0061007 | |||
| 1109 | Ga0453684_0086333 | |||
| 1110 | Ga0453684_0117756 | |||
| 1111 | Ga0453684_0221511 | |||
| 1112 | Ga0466970_0027199 | |||
| 1113 | Ga0451576_0000444 | |||
| 1114 | Ga0451576_0001947 | |||
| 1115 | Ga0451576_0008389 | |||
| 1116 | Ga0451576_0052813 | |||
| 1117 | Ga0466967_0191703 | |||
| 1118 | Ga0495629_0430314 | |||
| 1119 | Ga0495580_0189672 | |||
| 1120 | Ga0495639_0131470 | |||
| 1121 | Ga0495594_0038846 | |||
| 1122 | Ga0495628_0115124 | |||
| 1123 | Ga0495613_0014285 | |||
| 1124 | Ga0495581_0071720 | |||
| 1125 | Ga0495679_008345 | |||
| 1126 | Ga0496100_0077705 | |||
| 1127 | Ga0496101_0000685 | |||
| 1128 | Ga0496110_0001960 | |||
| 1129 | Ga0496114_0000504 | |||
| 1130 | Ga0496116_0000473 | |||
| 1131 | Ga0496116_0011173 | |||
| 1132 | Ga0496117_0000161 | |||
| 1133 | Ga0496119_0000042 | |||
| 1134 | Ga0496119_0068224 | |||
| 1135 | Ga0496120_0000083 | |||
| 1136 | Ga0496120_0002573 | |||
| 1137 | Ga0496120_0002667 | |||
| 1138 | Ga0496120_0097456 | |||
| 1139 | Ga0496122_0000012 | |||
| 1140 | Ga0496122_0000143 | |||
| 1141 | Ga0496122_0031007 | |||
| 1142 | Ga0496123_0001574 | |||
| 1143 | Ga0496123_0004362 | |||
| 1144 | Ga0496124_0034437 | |||
| 1145 | Ga0496125_0000010 | |||
| 1146 | Ga0496125_0044489 | |||
| 1147 | Ga0496126_0000008 | |||
| 1148 | Ga0496126_0000091 | |||
| 1149 | Ga0496126_0000211 | |||
| 1150 | Ga0496126_0000461 | |||
| 1151 | Ga0496126_0077610 | |||
| 1152 | Ga0496126_0103372 | |||
| 1153 | Ga0496126_0194040 | |||
| 1154 | Ga0501033_0040199 | |||
| 1155 | Ga0501033_0064824 | |||
| 1156 | Ga0501034_0008338 | |||
| 1157 | Ga0501034_0016341 | |||
| 1158 | Ga0501034_0020427 | |||
| 1159 | Ga0501034_0025878 | |||
| 1160 | Ga0501034_0123689 | |||
| 1161 | Ga0501037_0013024 | |||
| 1162 | Ga0501038_0190991 | |||
| 1163 | Ga0501038_0269703 | |||
| 1164 | Ga0501039_0075705 | |||
| 1165 | Ga0501039_0245589 | |||
| 1166 | Ga0501040_0064347 | |||
| 1167 | Ga0501043_0158977 | |||
| 1168 | Ga0501046_0000037 | |||
| 1169 | Ga0501046_0017699 | |||
| 1170 | Ga0501046_0067503 | |||
| 1171 | Ga0501046_0238754 | |||
| 1172 | Ga0501046_0274392 | |||
| 1173 | Ga0501047_0009603 | |||
| 1174 | Ga0501047_0011106 | |||
| 1175 | Ga0501047_0012186 | |||
| 1176 | Ga0501047_0136512 | |||
| 1177 | Ga0501047_0345080 | |||
| 1178 | Ga0501047_0371387 | |||
| 1179 | Ga0501067_0121998 | |||
| 1180 | Ga0501069_0068051 | |||
| 1181 | Ga0501070_0001559 | |||
| 1182 | Ga0501070_0008616 | |||
| 1183 | Ga0501070_0033085 | |||
| 1184 | Ga0501071_0007295 | |||
| 1185 | Ga0501071_0015020 | |||
| 1186 | Ga0501071_0145197 | |||
| 1187 | Ga0501072_0015283 | |||
| 1188 | Ga0501073_0008905 | |||
| 1189 | Ga0501073_0050679 | |||
| 1190 | Ga0501074_0288167 | |||
| 1191 | Ga0501075_0040114 | |||
| 1192 | Ga0501075_0112808 | |||
| 1193 | Ga0501079_0181947 | |||
| 1194 | Ga0501080_0182497 | |||
| 1195 | Ga0501080_0283637 | |||
| 1196 | Ga0501081_0042837 | |||
| 1197 | Ga0501035_0062267 | |||
| 1198 | Ga0501044_0001456 | |||
| 1199 | Ga0501044_0007831 | |||
| 1200 | Ga0501044_0008147 | |||
| 1201 | Ga0501044_0011204 | |||
| 1202 | Ga0501044_0021481 | |||
| 1203 | Ga0501044_0069608 | |||
| 1204 | Ga0501044_0187234 | |||
| 1205 | Ga0501044_0247975 | |||
| 1206 | nmdc:mga05p37_30065_c1 | |||
| 1207 | nmdc:mga05p37_99915_c1 | |||
| 1208 | nmdc:mga0qj67_10476_c1 | |||
| 1209 | nmdc:mga0qj67_122431_c1 | |||
| 1210 | nmdc:mga0qj67_296941_c1 | |||
| 1211 | nmdc:mga06r32_38774_c1 | |||
| 1212 | nmdc:mga08y16_123166_c1 | |||
| 1213 | nmdc:mga08y16_148615_c1 | |||
| 1214 | nmdc:mga08y16_5843_c1 | |||
| 1215 | nmdc:mga08y16_6667_c1 | |||
| 1216 | nmdc:mga0n895_117899_c1 | |||
| 1217 | nmdc:mga0n895_53041_c1 | |||
| 1218 | nmdc:mga0rr50_84970_c1 | |||
| 1219 | nmdc:mga08x19_191_c1 | |||
| 1220 | nmdc:mga08x19_1_c1 | |||
| 1221 | nmdc:mga0a205_12338_c1 | |||
| 1222 | nmdc:mga0a205_34810_c1 | |||
| 1223 | Ga0495619_0324326 | |||
| 1224 | Ga0500646_0023522 | |||
| 1225 | Ga0500647_0032015 | |||
| 1226 | Ga0500556_0008031 | |||
| 1227 | Ga0500562_000318 | |||
| 1228 | Ga0500595_003547 | |||
| 1229 | Ga0500568_0000362 | |||
| 1230 | Ga0590075_015137 | |||
| 1231 | Ga0587072_006742 | |||
| 1232 | Ga0587071_007502 | |||
| 1233 | Ga0501082_0039733 | |||
| 1234 | Ga0501082_0226141 | |||
| 1235 | 2511699025 | |||
| 1236 | 2524613334 | |||
| 1237 | 2540606256 | |||
| 1238 | 3006880276 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xyg-assembly1.cif.gz_D | x-ray structure of gene product from arabidopsis thaliana at2g19940 | 0.9926 | 57 | 401 |
| 1xyg-assembly1.cif.gz_D | x-ray structure of gene product from arabidopsis thaliana at2g19940 | 0.9897 | 57 | 401 |
| 2cvo-assembly1.cif.gz_C | crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) | 0.9854 | 54 | 401 |
| 2cvo-assembly1.cif.gz_C | crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) | 0.9826 | 54 | 401 |
| 8afv-assembly1.cif.gz_A | daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) | 0.9657 | 59 | 395 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q93Z70_59_202_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9992 | 59 | 202 | 3.40.50.720 |
| af_I1KL32_193_359_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.999 | 203 | 369 | 3.30.360.10 |
| af_I1KL32_193_359_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9931 | 203 | 369 | 3.30.360.10 |
| af_Q93Z70_59_202_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9923 | 59 | 202 | 3.40.50.720 |
| 2cvoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9917 | 57 | 202 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P2MPN0-F1-model_v4 | Uncharacterized protein MANES_15G144000 | 1.001 | 258 | 401 |
|
| AF-A0A484LE06-F1-model_v4 | Semialdehyde dehydrogenase dimerisation domain-containing protein | 1.001 | 298 | 401 |
|
| AF-R7UBN4-F1-model_v4 | Uncharacterized protein | 0.9995 | 286 | 401 |
|
| AF-A0A699IMB6-F1-model_v4 | Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic | 0.9987 | 252 | 401 |
|
| AF-A0A2R6R1R0-F1-model_v4 | N-acetyl-gamma-glutamyl-phosphate reductase | 0.9973 | 209 | 401 |
|