F469842

General Info

Members Datasets Scaffolds Average Seq Length
619 203 1238 213

Family's Representative Sequence

Representative Sequence 3300042461|Ga0439460_0087339|Ga0439460_0087339_302_958
Length 212
Sequence MTSSSRKRVVPRTYKEQPFDLYGLDGISDPQITEHLALYAGYVKQVNGLNEALAAMTGRGQASGKNPEFAELTRRLGFEYNGMLLHEHYFSSLRPAADPNPPSGSALAAALAESFGSVAQWQAAFHAIGELRGVGWVILFQDPATHWLTNQEGVPAGFKPLLVMDVWEHAFMRDYKATEKAKYVEAFFRNIDWQAVEHRLREESAVRPAAAA

Samples

Sample ID Description Type Environment
1 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
129 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
130 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
131 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
132 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
133 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
142 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
143 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
144 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
158 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
159 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
160 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.81
Rhizosphere 98.71
Stem 0
Stem Tuber 0
Unclassified 8.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439460_0087339 3300042461 Unclassified 987
2 Ga0058859_11689533 3300004798 Bacteria 700
3 Ga0058860_11955186 3300004801 Bacteria 695
4 Ga0058860_12112715 3300004801 Bacteria 930
5 Ga0065707_10116350 3300005295 Bacteria 2240
6 Ga0070676_10000511 3300005328 Bacteria 18619
7 Ga0070670_100075781 3300005331 Bacteria 2890
8 Ga0068869_100003089 3300005334 Bacteria 10143
9 Ga0070666_10273608 3300005335 Bacteria 1199
10 Ga0070680_100077107 3300005336 Bacteria 2745
11 Ga0070682_100002931 3300005337 Bacteria 9468
12 Ga0068868_100063653 3300005338 Bacteria 2926
13 Ga0070660_100002746 3300005339 Bacteria 12099
14 Ga0070689_100058468 3300005340 Bacteria 2994
15 Ga0070691_10010763 3300005341 Bacteria 4173
16 Ga0070661_100001190 3300005344 Bacteria 18360
17 Ga0070692_10025020 3300005345 Bacteria 2940
18 Ga0070669_100275790 3300005353 Bacteria 1346
19 Ga0070675_100282933 3300005354 Bacteria 1458
20 Ga0070673_100027615 3300005364 Bacteria 4209
21 Ga0070659_100004742 3300005366 Bacteria 9717
22 Ga0070703_10013321 3300005406 Bacteria 2335
23 Ga0070705_100012575 3300005440 Bacteria 4306
24 Ga0070694_100000075 3300005444 Bacteria 47763
25 Ga0070694_100000116 3300005444 Bacteria 38891
26 Ga0070694_100008467 3300005444 Bacteria 6292
27 Ga0070694_100017101 3300005444 Bacteria 4577
28 Ga0070708_100034263 3300005445 Bacteria 4416
29 Ga0070708_100074445 3300005445 Bacteria 3063
30 Ga0070708_100165213 3300005445 Bacteria 2064
31 Ga0070708_100275140 3300005445 Bacteria 1584
32 Ga0070708_100285388 3300005445 Bacteria 1554
33 Ga0070708_100297354 3300005445 Bacteria 1520
34 Ga0070708_100305060 3300005445 Bacteria 1499
35 Ga0070708_100354137 3300005445 Bacteria 1383
36 Ga0070708_100733283 3300005445 Bacteria 929
37 Ga0070663_100013766 3300005455 Bacteria 5173
38 Ga0070662_100002383 3300005457 Bacteria 11548
39 Ga0070681_10301354 3300005458 Bacteria 1512
40 Ga0070681_10551841 3300005458 Bacteria 1066
41 Ga0068867_100001933 3300005459 Bacteria 14438
42 Ga0068867_100376735 3300005459 Unclassified 1191
43 Ga0068867_100822340 3300005459 Bacteria 830
44 Ga0070706_100009685 3300005467 Bacteria 8954
45 Ga0070706_100015253 3300005467 Bacteria 7093
46 Ga0070706_100027912 3300005467 Bacteria 5192
47 Ga0070706_100328797 3300005467 Bacteria 1425
48 Ga0070706_100590099 3300005467 Bacteria 1033
49 Ga0070707_100028514 3300005468 Bacteria 5314
50 Ga0070707_100036914 3300005468 Bacteria 4664
51 Ga0070707_100062738 3300005468 Bacteria 3566
52 Ga0070707_100095679 3300005468 Bacteria 2876
53 Ga0070707_100521327 3300005468 Bacteria 1150
54 Ga0070698_100007345 3300005471 Bacteria 11929
55 Ga0070698_100041498 3300005471 Bacteria 4723
56 Ga0070698_100088346 3300005471 Bacteria 3085
57 Ga0070698_100169228 3300005471 Bacteria 2126
58 Ga0070698_100219241 3300005471 Bacteria 1836
59 Ga0070699_100005568 3300005518 Bacteria 11042
60 Ga0070699_100009767 3300005518 Bacteria 8302
61 Ga0070699_100291231 3300005518 Unclassified 1464
62 Ga0070699_100470125 3300005518 Bacteria 1141
63 Ga0070679_100049808 3300005530 Bacteria 4172
64 Ga0070684_100299333 3300005535 Bacteria 1476
65 Ga0070697_100007110 3300005536 Bacteria 8705
66 Ga0070697_100008056 3300005536 Bacteria 8219
67 Ga0070697_100013814 3300005536 Bacteria 6335
68 Ga0070697_100050339 3300005536 Bacteria 3381
69 Ga0070697_100058677 3300005536 Bacteria 3132
70 Ga0070697_100506022 3300005536 Bacteria 1056
71 Ga0068853_100003438 3300005539 Bacteria 12113
72 Ga0070695_100004280 3300005545 Bacteria 8349
73 Ga0070695_100018873 3300005545 Bacteria 4192
74 Ga0070695_100617043 3300005545 Unclassified 853
75 Ga0070696_100002014 3300005546 Bacteria 13327
76 Ga0070696_100212415 3300005546 Bacteria 1449
77 Ga0070696_100256293 3300005546 Bacteria 1325
78 Ga0070696_100301142 3300005546 Bacteria 1228
79 Ga0070696_100350839 3300005546 Bacteria 1143
80 Ga0070693_100067378 3300005547 Bacteria 2098
81 Ga0070704_100075391 3300005549 Bacteria 2464
82 Ga0070704_100076771 3300005549 Bacteria 2445
83 Ga0068855_100282070 3300005563 Bacteria 1844
84 Ga0068856_100111323 3300005614 Bacteria 2735
85 Ga0070702_100667812 3300005615 Unclassified 788
86 Ga0068859_100054000 3300005617 Bacteria 4040
87 Ga0068859_100064852 3300005617 Bacteria 3686
88 Ga0068859_100551621 3300005617 Bacteria 1247
89 Ga0068864_100041871 3300005618 Bacteria 3918
90 Ga0068866_10160244 3300005718 Bacteria 1311
91 Ga0068861_100041484 3300005719 Bacteria 3447
92 Ga0068861_100120721 3300005719 Bacteria 2114
93 Ga0068870_10008586 3300005840 Bacteria 4602
94 Ga0068863_100270582 3300005841 Bacteria 1644
95 Ga0068858_101296265 3300005842 Bacteria 717
96 Ga0068860_100171965 3300005843 Bacteria 2093
97 Ga0068862_100003295 3300005844 Bacteria 13970
98 Ga0068862_100087371 3300005844 Bacteria 2712
99 Ga0068862_100346460 3300005844 Unclassified 1377
100 Ga0081455_10024112 3300005937 Bacteria 5643
101 Ga0081455_10340821 3300005937 Unclassified 1061
102 Ga0081540_1019047 3300005983 Unclassified 4188
103 Ga0081539_10000002 3300005985 Bacteria 601032
104 Ga0075428_100006097 3300006844 Bacteria 13408
105 Ga0075428_100011162 3300006844 Bacteria 9995
106 Ga0075428_100011421 3300006844 Bacteria 9880
107 Ga0075428_100015425 3300006844 Bacteria 8470
108 Ga0075428_100040376 3300006844 Bacteria 5134
109 Ga0075428_100082923 3300006844 Bacteria 3498
110 Ga0075428_100175935 3300006844 Bacteria 2318
111 Ga0075428_100185254 3300006844 Unclassified 2253
112 Ga0075428_100441458 3300006844 Bacteria 1394
113 Ga0075430_100000647 3300006846 Bacteria 26556
114 Ga0075430_100010977 3300006846 Bacteria 7672
115 Ga0075430_100071989 3300006846 Bacteria 2899
116 Ga0075430_100145741 3300006846 Bacteria 1972
117 Ga0075430_100494040 3300006846 Bacteria 1010
118 Ga0075431_100002578 3300006847 Bacteria 17509
119 Ga0075431_100004635 3300006847 Bacteria 13502
120 Ga0075431_100009590 3300006847 Bacteria 9721
121 Ga0075431_100023269 3300006847 Bacteria 6338
122 Ga0075431_100025646 3300006847 Bacteria 6042
123 Ga0075431_100037293 3300006847 Bacteria 5009
124 Ga0075431_100057380 3300006847 Bacteria 4016
125 Ga0075431_100076001 3300006847 Bacteria 3466
126 Ga0075431_100094219 3300006847 Bacteria 3090
127 Ga0075431_100251435 3300006847 Unclassified 1796
128 Ga0075431_100339958 3300006847 Bacteria 1511
129 Ga0075431_100372777 3300006847 Bacteria 1432
130 Ga0075433_10000423 3300006852 Bacteria 27086
131 Ga0075433_10008518 3300006852 Bacteria 8179
132 Ga0075433_10008925 3300006852 Bacteria 8003
133 Ga0075433_10014900 3300006852 Bacteria 6363
134 Ga0075433_10106600 3300006852 Bacteria 2484
135 Ga0075433_10180433 3300006852 Bacteria 1879
136 Ga0075433_10310517 3300006852 Bacteria 1396
137 Ga0075433_10353349 3300006852 Bacteria 1299
138 Ga0075433_10364357 3300006852 Bacteria 1277
139 Ga0075433_10453276 3300006852 Bacteria 1131
140 Ga0075434_100031055 3300006871 Bacteria 5265
141 Ga0075434_100152018 3300006871 Bacteria 2335
142 Ga0075434_100323918 3300006871 Bacteria 1561
143 Ga0075434_100334524 3300006871 Bacteria 1535
144 Ga0075434_100424331 3300006871 Bacteria 1351
145 Ga0075434_100436357 3300006871 Unclassified 1331
146 Ga0075434_100519998 3300006871 Bacteria 1210
147 Ga0075434_100645475 3300006871 Bacteria 1077
148 Ga0075434_100708748 3300006871 Bacteria 1024
149 Ga0075429_100003550 3300006880 Bacteria 13290
150 Ga0075429_100006040 3300006880 Bacteria 10474
151 Ga0075429_100016852 3300006880 Bacteria 6322
152 Ga0075429_100039263 3300006880 Bacteria 4121
153 Ga0075429_100056205 3300006880 Bacteria 3425
154 Ga0075429_100097566 3300006880 Bacteria 2564
155 Ga0075429_100185657 3300006880 Bacteria 1822
156 Ga0075429_100308265 3300006880 Bacteria 1386
157 Ga0075429_100486300 3300006880 Bacteria 1081
158 Ga0068865_100592421 3300006881 Bacteria 936
159 Ga0075436_100006114 3300006914 Bacteria 8262
160 Ga0075436_100167064 3300006914 Bacteria 1553
161 Ga0075436_100203768 3300006914 Bacteria 1401
162 Ga0097620_100053998 3300006931 Bacteria 4040
163 Ga0097620_100064850 3300006931 Bacteria 3686
164 Ga0097620_100551577 3300006931 Bacteria 1247
165 Ga0075435_100008330 3300007076 Bacteria 7430
166 Ga0075435_100011334 3300007076 Bacteria 6553
167 Ga0075435_100023078 3300007076 Bacteria 4804
168 Ga0075435_100032795 3300007076 Bacteria 4103
169 Ga0075435_100049491 3300007076 Bacteria 3380
170 Ga0075435_100053454 3300007076 Bacteria 3257
171 Ga0075435_100057239 3300007076 Bacteria 3153
172 Ga0075435_100259646 3300007076 Bacteria 1480
173 Ga0075435_101069402 3300007076 Bacteria 705
174 Ga0099794_10024311 3300007265 Bacteria 2779
175 Ga0099794_10068353 3300007265 Bacteria 1737
176 Ga0099794_10125445 3300007265 Unclassified 1294
177 Ga0111539_10000122 3300009094 Bacteria 87286
178 Ga0111539_10003950 3300009094 Bacteria 19474
179 Ga0111539_10122923 3300009094 Bacteria 3042
180 Ga0111539_10397398 3300009094 Bacteria 1605
181 Ga0111539_10580813 3300009094 Unclassified 1305
182 Ga0114129_10000439 3300009147 Bacteria 49346
183 Ga0114129_10001249 3300009147 Bacteria 33890
184 Ga0114129_10004586 3300009147 Bacteria 19493
185 Ga0114129_10008384 3300009147 Bacteria 14725
186 Ga0114129_10011311 3300009147 Bacteria 12716
187 Ga0114129_10015348 3300009147 Bacteria 10898
188 Ga0114129_10031976 3300009147 Bacteria 7439
189 Ga0114129_10064562 3300009147 Bacteria 5110
190 Ga0114129_10099806 3300009147 Bacteria 4017
191 Ga0114129_10123209 3300009147 Bacteria 3566
192 Ga0114129_10163179 3300009147 Bacteria 3042
193 Ga0114129_10178773 3300009147 Bacteria 2889
194 Ga0114129_10184313 3300009147 Bacteria 2838
195 Ga0114129_10192638 3300009147 Bacteria 2767
196 Ga0114129_10195056 3300009147 Bacteria 2747
197 Ga0114129_10212927 3300009147 Bacteria 2611
198 Ga0114129_10229024 3300009147 Bacteria 2504
199 Ga0114129_10281563 3300009147 Bacteria 2221
200 Ga0114129_10378760 3300009147 Bacteria 1869
201 Ga0114129_10579419 3300009147 Bacteria 1456
202 Ga0114129_10785514 3300009147 Bacteria 1216
203 Ga0105243_10165077 3300009148 Bacteria 1913
204 Ga0105241_10000067 3300009174 Bacteria 79719
205 Ga0105241_10089667 3300009174 Bacteria 2423
206 Ga0105242_10412002 3300009176 Bacteria 1264
207 Ga0105248_10414379 3300009177 Bacteria 1517
208 Ga0105249_10387817 3300009553 Bacteria 1424
209 Ga0105249_10545226 3300009553 Bacteria 1210
210 Ga0105249_11173298 3300009553 Bacteria 839
211 Ga0157373_10000398 3300013100 Bacteria 34875
212 Ga0157369_10135236 3300013105 Bacteria 2610
213 Ga0157378_10347283 3300013297 Unclassified 1448
214 Ga0163162_10430773 3300013306 Unclassified 1451
215 Ga0163162_10572756 3300013306 Bacteria 1256
216 Ga0157372_10027845 3300013307 Bacteria 6160
217 Ga0157372_10343757 3300013307 Bacteria 1738
218 Ga0157375_10085411 3300013308 Bacteria 3206
219 Ga0157375_10254035 3300013308 Bacteria 1919
220 Ga0157380_10119075 3300014326 Bacteria 2233
221 Ga0157380_10228888 3300014326 Bacteria 1668
222 Ga0157377_10178718 3300014745 Bacteria 1333
223 Ga0157377_10199201 3300014745 Unclassified 1270
224 Ga0224712_10068158 3300022467 Bacteria 1437
225 Ga0224712_10291508 3300022467 Bacteria 761
226 Ga0207653_10003059 3300025885 Bacteria 5309
227 Ga0207653_10110341 3300025885 Bacteria 981
228 Ga0207645_10000406 3300025907 Bacteria 35625
229 Ga0207643_10000439 3300025908 Bacteria 27215
230 Ga0207684_10002380 3300025910 Bacteria 19025
231 Ga0207684_10008128 3300025910 Bacteria 9354
232 Ga0207684_10063810 3300025910 Bacteria 3127
233 Ga0207684_10097662 3300025910 Bacteria 2508
234 Ga0207684_10260208 3300025910 Bacteria 1497
235 Ga0207707_10000124 3300025912 Bacteria 79966
236 Ga0207663_10417759 3300025916 Bacteria 1029
237 Ga0207660_10006409 3300025917 Bacteria 7628
238 Ga0207660_10052397 3300025917 Bacteria 2905
239 Ga0207657_10000085 3300025919 Bacteria 89158
240 Ga0207649_10089428 3300025920 Bacteria 2013
241 Ga0207652_10000264 3300025921 Bacteria 54769
242 Ga0207646_10003351 3300025922 Bacteria 18176
243 Ga0207646_10008545 3300025922 Bacteria 10246
244 Ga0207646_10012323 3300025922 Bacteria 8222
245 Ga0207646_10016164 3300025922 Bacteria 7013
246 Ga0207646_10033162 3300025922 Bacteria 4672
247 Ga0207646_10037706 3300025922 Bacteria 4357
248 Ga0207646_10057844 3300025922 Bacteria 3464
249 Ga0207646_10103560 3300025922 Bacteria 2552
250 Ga0207681_10143897 3300025923 Bacteria 1779
251 Ga0207681_10461600 3300025923 Bacteria 1035
252 Ga0207650_10120989 3300025925 Bacteria 2038
253 Ga0207690_10038431 3300025932 Bacteria 3115
254 Ga0207706_10003538 3300025933 Bacteria 14917
255 Ga0207706_10082314 3300025933 Bacteria 2829
256 Ga0207709_10507766 3300025935 Bacteria 942
257 Ga0207670_10245831 3300025936 Bacteria 1380
258 Ga0207704_10275150 3300025938 Bacteria 1277
259 Ga0207691_10037554 3300025940 Bacteria 4485
260 Ga0207691_10973863 3300025940 Unclassified 708
261 Ga0207689_10000579 3300025942 Bacteria 34972
262 Ga0207689_10008697 3300025942 Bacteria 8834
263 Ga0207667_10101222 3300025949 Bacteria 2972
264 Ga0207712_10285044 3300025961 Bacteria 1349
265 Ga0207640_10002946 3300025981 Bacteria 9157
266 Ga0207677_10404016 3300026023 Bacteria 1159
267 Ga0207703_10218884 3300026035 Bacteria 1701
268 Ga0207703_10576259 3300026035 Bacteria 1063
269 Ga0207639_10117609 3300026041 Bacteria 2178
270 Ga0207678_10038916 3300026067 Bacteria 4129
271 Ga0207678_10254989 3300026067 Bacteria 1503
272 Ga0207641_10022933 3300026088 Bacteria 5142
273 Ga0207641_10388500 3300026088 Bacteria 1338
274 Ga0207648_10006511 3300026089 Bacteria 11597
275 Ga0207648_10612522 3300026089 Unclassified 1004
276 Ga0207648_10806863 3300026089 Bacteria 874
277 Ga0207676_10005191 3300026095 Bacteria 9216
278 Ga0207675_100016892 3300026118 Bacteria 6819
279 Ga0207675_100028417 3300026118 Bacteria 5207
280 Ga0207675_100275443 3300026118 Unclassified 1634
281 Ga0207675_100404853 3300026118 Bacteria 1345
282 Ga0207675_101203130 3300026118 Bacteria 778
283 Ga0209981_1025527 3300027378 Bacteria 855
284 Ga0209970_1004248 3300027614 Bacteria 2384
285 Ga0209983_1000006 3300027665 Bacteria 24144
286 Ga0209971_1000053 3300027682 Bacteria 37308
287 Ga0209966_1000266 3300027695 Bacteria 18647
288 Ga0209998_10000083 3300027717 Bacteria 37282
289 Ga0209974_10020741 3300027876 Bacteria 2178
290 Ga0209974_10038511 3300027876 Bacteria 1589
291 Ga0207428_10000033 3300027907 Bacteria 232081
292 Ga0207428_10151472 3300027907 Bacteria 1765
293 Ga0207428_10697737 3300027907 Bacteria 726
294 Ga0268265_10060192 3300028380 Bacteria 2909
295 Ga0268265_10063522 3300028380 Bacteria 2841
296 Ga0268265_10202159 3300028380 Bacteria 1724
297 Ga0268265_10722527 3300028380 Unclassified 964
298 Ga0268264_10070525 3300028381 Bacteria 2958
299 Ga0268264_10085808 3300028381 Bacteria 2703
300 Ga0307408_100346354 3300031548 Unclassified 1259
301 Ga0307410_10090357 3300031852 Bacteria 2172
302 Ga0307410_10158311 3300031852 Bacteria 1694
303 Ga0307416_100651515 3300032002 Bacteria 1138
304 Ga0307416_101676821 3300032002 Bacteria 740
305 Ga0307411_10197852 3300032005 Bacteria 1541
306 Ga0307411_10261695 3300032005 Bacteria 1366
307 Ga0307411_11091684 3300032005 Bacteria 719
308 Ga0373959_0052868 3300034820 Bacteria 881
309 Ga0373949_0134355 3300035090 Bacteria 704
310 Ga0373952_0025924 3300035092 Unclassified 1270
311 Ga0373932_0001934 3300035112 Bacteria 5499
312 Ga0373939_0034581 3300035114 Unclassified 1484
313 Ga0373960_0007876 3300035121 Bacteria 2536
314 Ga0373961_0143584 3300035241 Unclassified 808
315 Ga0373931_0062357 3300035691 Bacteria 2012
316 Ga0395899_0079906 3300037312 Bacteria 2381
317 Ga0395900_0002001 3300037418 Bacteria 23007
318 Ga0395898_0018739 3300037466 Bacteria 7054
319 Ga0395905_0215361 3300037471 Bacteria 1799
320 Ga0395905_0780356 3300037471 Unclassified 858
321 Ga0395901_0000506 3300038443 Bacteria 45146
322 Ga0395901_0015352 3300038443 Bacteria 7794
323 Ga0242420_028490 3300038996 Bacteria 1028
324 Ga0439458_0004698 3300042157 Bacteria 3113
325 Ga0439458_0048494 3300042157 Bacteria 1044
326 Ga0439444_0017563 3300042437 Bacteria 1230
327 Ga0439459_0022598 3300042438 Bacteria 1218
328 Ga0439460_0009583 3300042461 Bacteria 2460
329 Ga0439460_0063668 3300042461 Bacteria 1130
330 Ga0451577_0082703 3300042876 Bacteria 2864
331 Ga0451577_0103310 3300042876 Bacteria 2547
332 Ga0451577_0135248 3300042876 Bacteria 2213
333 Ga0451577_0384818 3300042876 Bacteria 1273
334 Ga0453683_0010371 3300044673 Bacteria 6176
335 Ga0453683_0042884 3300044673 Bacteria 2840
336 Ga0451576_0008158 3300045051 Bacteria 12329
337 Ga0451576_0027403 3300045051 Bacteria 6119
338 Ga0451576_0046122 3300045051 Bacteria 4589
339 Ga0451576_0248820 3300045051 Bacteria 1857
340 Ga0451576_0385986 3300045051 Unclassified 1468
341 Ga0451576_0451726 3300045051 Bacteria 1349
342 Ga0495580_0000545 3300046472 Bacteria 31827
343 Ga0495580_0098535 3300046472 Bacteria 2033
344 Ga0495580_0105561 3300046472 Bacteria 1957
345 Ga0495584_0124715 3300046491 Bacteria 1305
346 Ga0495659_0077219 3300046664 Unclassified 1258
347 Ga0495669_0126592 3300046684 Unclassified 1201
348 Ga0495670_0352483 3300046691 Unclassified 792
349 Ga0496101_0758302 3300048904 Bacteria 766
350 Ga0496102_0018364 3300048905 Bacteria 6144
351 Ga0496102_0110028 3300048905 Bacteria 2568
352 Ga0496106_0080046 3300048909 Bacteria 2509
353 Ga0496107_0112497 3300048910 Bacteria 2002
354 Ga0501290_016192 3300049513 Bacteria 992
355 Ga0501292_030173 3300049515 Bacteria 909
356 Ga0501298_075720 3300049521 Bacteria 733
357 Ga0501299_008100 3300049522 Bacteria 1700
358 Ga0501031_0021370 3300049568 Bacteria 4219
359 Ga0501033_0046375 3300049570 Bacteria 3232
360 Ga0501033_0059811 3300049570 Bacteria 2813
361 Ga0501033_0077750 3300049570 Bacteria 2435
362 Ga0501036_0002194 3300049572 Bacteria 15254
363 Ga0501036_0011211 3300049572 Bacteria 7416
364 Ga0501036_0012994 3300049572 Bacteria 6913
365 Ga0501036_0098851 3300049572 Bacteria 2468
366 Ga0501037_0184616 3300049573 Unclassified 1479
367 Ga0501037_0361501 3300049573 Bacteria 1000
368 Ga0501037_0411746 3300049573 Bacteria 926
369 Ga0501038_0003015 3300049574 Bacteria 15701
370 Ga0501038_0032957 3300049574 Bacteria 4564
371 Ga0501038_0076909 3300049574 Bacteria 2819
372 Ga0501038_0141659 3300049574 Bacteria 1966
373 Ga0501038_0210424 3300049574 Bacteria 1556
374 Ga0501038_0441533 3300049574 Bacteria 1002
375 Ga0501038_0598975 3300049574 Bacteria 834
376 Ga0501038_0619721 3300049574 Bacteria 817
377 Ga0501039_0028341 3300049575 Bacteria 4311
378 Ga0501039_0059579 3300049575 Bacteria 2957
379 Ga0501039_0087764 3300049575 Unclassified 2423
380 Ga0501039_0210846 3300049575 Bacteria 1528
381 Ga0501039_0221096 3300049575 Bacteria 1489
382 Ga0501039_0233672 3300049575 Bacteria 1445
383 Ga0501040_0000517 3300049576 Bacteria 23113
384 Ga0501040_0003453 3300049576 Bacteria 10199
385 Ga0501040_0005290 3300049576 Bacteria 8347
386 Ga0501040_0005709 3300049576 Bacteria 8050
387 Ga0501040_0134478 3300049576 Bacteria 1740
388 Ga0501040_0141777 3300049576 Bacteria 1693
389 Ga0501040_0173624 3300049576 Bacteria 1527
390 Ga0501040_0208081 3300049576 Bacteria 1390
391 Ga0501040_0430330 3300049576 Bacteria 949
392 Ga0501041_0001305 3300049577 Bacteria 13711
393 Ga0501041_0005451 3300049577 Bacteria 7450
394 Ga0501041_0005901 3300049577 Bacteria 7157
395 Ga0501041_0026681 3300049577 Bacteria 3476
396 Ga0501041_0036506 3300049577 Bacteria 2977
397 Ga0501041_0039235 3300049577 Bacteria 2874
398 Ga0501041_0177926 3300049577 Bacteria 1331
399 Ga0501041_0191823 3300049577 Bacteria 1280
400 Ga0501041_0423468 3300049577 Bacteria 844
401 Ga0501042_0000656 3300049578 Bacteria 18578
402 Ga0501042_0015940 3300049578 Bacteria 5154
403 Ga0501042_0083867 3300049578 Unclassified 2284
404 Ga0501042_0151474 3300049578 Bacteria 1672
405 Ga0501042_0157058 3300049578 Bacteria 1641
406 Ga0501042_0387679 3300049578 Bacteria 1012
407 Ga0501042_0477895 3300049578 Unclassified 904
408 Ga0501043_0153575 3300049579 Bacteria 1801
409 Ga0501046_0007755 3300049580 Bacteria 9417
410 Ga0501046_0009018 3300049580 Bacteria 8649
411 Ga0501046_0132753 3300049580 Bacteria 1888
412 Ga0501046_0238810 3300049580 Bacteria 1341
413 Ga0501046_0331983 3300049580 Bacteria 1106
414 Ga0501047_0020667 3300049581 Bacteria 6321
415 Ga0501048_0001395 3300049582 Bacteria 18319
416 Ga0501048_0010878 3300049582 Bacteria 6786
417 Ga0501048_0049956 3300049582 Bacteria 2979
418 Ga0501048_0057315 3300049582 Bacteria 2763
419 Ga0501067_0149863 3300049583 Bacteria 1299
420 Ga0501068_0033284 3300049584 Bacteria 3069
421 Ga0501068_0043910 3300049584 Bacteria 2690
422 Ga0501068_0352964 3300049584 Bacteria 945
423 Ga0501069_0092002 3300049585 Bacteria 1716
424 Ga0501069_0132468 3300049585 Bacteria 1428
425 Ga0501070_0035967 3300049586 Bacteria 4136
426 Ga0501070_0351514 3300049586 Bacteria 1196
427 Ga0501071_0000310 3300049587 Bacteria 23357
428 Ga0501071_0025796 3300049587 Bacteria 4119
429 Ga0501071_0113454 3300049587 Unclassified 2004
430 Ga0501071_0219417 3300049587 Bacteria 1431
431 Ga0501071_0249706 3300049587 Bacteria 1339
432 Ga0501072_0000642 3300049588 Bacteria 25065
433 Ga0501072_0007106 3300049588 Bacteria 8497
434 Ga0501072_0024337 3300049588 Bacteria 4710
435 Ga0501072_0043461 3300049588 Bacteria 3531
436 Ga0501072_0082547 3300049588 Bacteria 2548
437 Ga0501072_0085551 3300049588 Bacteria 2501
438 Ga0501072_0091346 3300049588 Bacteria 2417
439 Ga0501072_0272981 3300049588 Bacteria 1345
440 Ga0501072_0305032 3300049588 Bacteria 1266
441 Ga0501072_0406774 3300049588 Bacteria 1079
442 Ga0501072_0549280 3300049588 Bacteria 912
443 Ga0501074_0000460 3300049590 Bacteria 24494
444 Ga0501074_0014360 3300049590 Bacteria 5763
445 Ga0501074_0142163 3300049590 Bacteria 1716
446 Ga0501074_0163178 3300049590 Bacteria 1591
447 Ga0501075_0000003 3300049591 Bacteria 173182
448 Ga0501075_0000200 3300049591 Bacteria 31730
449 Ga0501075_0003950 3300049591 Bacteria 9990
450 Ga0501075_0030465 3300049591 Bacteria 3997
451 Ga0501075_0049513 3300049591 Bacteria 3158
452 Ga0501075_0072650 3300049591 Bacteria 2601
453 Ga0501075_0090102 3300049591 Bacteria 2327
454 Ga0501075_0142929 3300049591 Bacteria 1824
455 Ga0501075_0626299 3300049591 Bacteria 820
456 Ga0501075_0640867 3300049591 Archaea 810
457 Ga0501075_0850311 3300049591 Bacteria 694
458 Ga0501076_0000010 3300049592 Bacteria 116774
459 Ga0501076_0000868 3300049592 Bacteria 19647
460 Ga0501076_0028545 3300049592 Bacteria 4333
461 Ga0501076_0036622 3300049592 Bacteria 3845
462 Ga0501076_0038015 3300049592 Bacteria 3777
463 Ga0501076_0088158 3300049592 Bacteria 2494
464 Ga0501076_0115229 3300049592 Bacteria 2175
465 Ga0501076_0140587 3300049592 Bacteria 1961
466 Ga0501076_0230981 3300049592 Bacteria 1512
467 Ga0501076_0324836 3300049592 Bacteria 1262
468 Ga0501077_0000171 3300049593 Bacteria 37157
469 Ga0501077_0048521 3300049593 Bacteria 2698
470 Ga0501077_0057620 3300049593 Bacteria 2466
471 Ga0501077_0076316 3300049593 Bacteria 2123
472 Ga0501079_0001602 3300049741 Bacteria 16109
473 Ga0501079_0007978 3300049741 Bacteria 8022
474 Ga0501079_0009344 3300049741 Bacteria 7431
475 Ga0501079_0011807 3300049741 Bacteria 6670
476 Ga0501079_0011947 3300049741 Bacteria 6627
477 Ga0501079_0122282 3300049741 Unclassified 2024
478 Ga0501079_0159801 3300049741 Bacteria 1757
479 Ga0501079_0420806 3300049741 Bacteria 1049
480 Ga0501079_0430141 3300049741 Unclassified 1036
481 Ga0501080_0036903 3300049742 Bacteria 4562
482 Ga0501080_0180659 3300049742 Unclassified 1942
483 Ga0501080_0280110 3300049742 Bacteria 1516
484 Ga0501080_0281866 3300049742 Bacteria 1511
485 Ga0501081_0000019 3300049743 Bacteria 56581
486 Ga0501081_0000618 3300049743 Bacteria 20298
487 Ga0501081_0004472 3300049743 Bacteria 8967
488 Ga0501081_0006317 3300049743 Bacteria 7681
489 Ga0501081_0009366 3300049743 Bacteria 6382
490 Ga0501081_0021237 3300049743 Bacteria 4332
491 Ga0501081_0035498 3300049743 Bacteria 3394
492 Ga0501081_0272546 3300049743 Bacteria 1238
493 Ga0501081_0285936 3300049743 Bacteria 1208
494 Ga0501081_0347724 3300049743 Bacteria 1092
495 Ga0501081_0367940 3300049743 Bacteria 1061
496 Ga0501083_0054764 3300049744 Bacteria 2676
497 Ga0501083_0068550 3300049744 Bacteria 2361
498 Ga0501083_0181941 3300049744 Bacteria 1372
499 Ga0501035_0051281 3300049822 Bacteria 3695
500 Ga0501035_0084820 3300049822 Bacteria 2793
501 Ga0501035_0205097 3300049822 Bacteria 1689
502 Ga0501044_0893199 3300049823 Bacteria 764
503 Ga0501045_0000013 3300049824 Bacteria 73989
504 Ga0501045_0003706 3300049824 Bacteria 10511
505 Ga0501045_0022050 3300049824 Bacteria 4557
506 Ga0501045_0024044 3300049824 Bacteria 4373
507 Ga0501045_0049003 3300049824 Bacteria 3080
508 Ga0501045_0085066 3300049824 Unclassified 2334
509 Ga0501045_0239822 3300049824 Bacteria 1350
510 Ga0501045_0489999 3300049824 Unclassified 913
511 nmdc:mga05p37_108685_c1 3300050507 Bacteria 3412
512 nmdc:mga05p37_112684_c1 3300050507 Bacteria 3345
513 nmdc:mga05p37_12745_c1 3300050507 Bacteria 10052
514 nmdc:mga05p37_176674_c1 3300050507 Bacteria 2601
515 nmdc:mga05p37_187771_c1 3300050507 Bacteria 2512
516 nmdc:mga05p37_201989_c1 3300050507 Bacteria 2407
517 nmdc:mga05p37_2058_c1 3300050507 Bacteria 23449
518 nmdc:mga05p37_227723_c1 3300050507 Bacteria 2247
519 nmdc:mga05p37_317883_c1 3300050507 Bacteria 1844
520 nmdc:mga05p37_34802_c1 3300050507 Bacteria 5416
521 nmdc:mga05p37_364155_c1 3300050507 Bacteria 1699
522 nmdc:mga05p37_378021_c1 3300050507 Bacteria 1661
523 nmdc:mga05p37_3858_c1 3300050507 Bacteria 9061
524 nmdc:mga05p37_454833_c1 3300050507 Bacteria 1481
525 nmdc:mga05p37_46742_c1 3300050507 Bacteria 5322
526 nmdc:mga05p37_4699_c1 3300050507 Bacteria 15950
527 nmdc:mga05p37_682318_c1 3300050507 Unclassified 1145
528 nmdc:mga05p37_685159_c1 3300050507 Bacteria 1142
529 nmdc:mga05p37_7483_c1 3300050507 Bacteria 12876
530 nmdc:mga05p37_91501_c1 3300050507 Bacteria 3748
531 nmdc:mga05p37_94147_c1 3300050507 Bacteria 3691
532 nmdc:mga09592_19515_c1 3300050508 Bacteria 5568
533 nmdc:mga09592_273319_c1 3300050508 Bacteria 1466
534 nmdc:mga09592_31416_c1 3300050508 Bacteria 4425
535 nmdc:mga09592_36834_c1 3300050508 Bacteria 4100
536 nmdc:mga09592_472834_c1 3300050508 Unclassified 1080
537 nmdc:mga09592_52066_c1 3300050508 Bacteria 3455
538 nmdc:mga0qj67_12237_c1 3300050509 Bacteria 6461
539 nmdc:mga0qj67_1548_c1 3300050509 Bacteria 16140
540 nmdc:mga0qj67_211759_c1 3300050509 Bacteria 1574
541 nmdc:mga0qj67_27387_c1 3300050509 Bacteria 4418
542 nmdc:mga0qj67_89963_c1 3300050509 Bacteria 2465
543 nmdc:mga06r32_106945_c1 3300050510 Unclassified 2749
544 nmdc:mga06r32_130421_c1 3300050510 Bacteria 2486
545 nmdc:mga06r32_148066_c1 3300050510 Unclassified 2325
546 nmdc:mga06r32_14886_c1 3300050510 Bacteria 7058
547 nmdc:mga06r32_220849_c1 3300050510 Bacteria 1883
548 nmdc:mga06r32_221871_c1 3300050510 Bacteria 1879
549 nmdc:mga06r32_30838_c1 3300050510 Bacteria 5031
550 nmdc:mga06r32_3605_c1 3300050510 Bacteria 13817
551 nmdc:mga06r32_55702_c1 3300050510 Bacteria 3794
552 nmdc:mga06r32_777324_c1 3300050510 Unclassified 919
553 nmdc:mga08y16_10576_c1 3300050511 Bacteria 9684
554 nmdc:mga08y16_1358968_c1 3300050511 Bacteria 675
555 nmdc:mga08y16_23200_c1 3300050511 Bacteria 6550
556 nmdc:mga08y16_454772_c1 3300050511 Unclassified 1305
557 nmdc:mga08y16_515123_c1 3300050511 Bacteria 1214
558 nmdc:mga0n895_102752_c1 3300050512 Bacteria 2869
559 nmdc:mga0n895_195215_c1 3300050512 Unclassified 2055
560 nmdc:mga0n895_22977_c1 3300050512 Bacteria 5854
561 nmdc:mga0n895_23856_c1 3300050512 Bacteria 5757
562 nmdc:mga0n895_254853_c1 3300050512 Bacteria 1781
563 nmdc:mga0n895_369708_c1 3300050512 Bacteria 1452
564 nmdc:mga0n895_55399_c1 3300050512 Bacteria 3903
565 nmdc:mga0n895_557357_c1 3300050512 Unclassified 1151
566 nmdc:mga0rr50_1027_c1 3300050513 Bacteria 15146
567 nmdc:mga0rr50_11272_c1 3300050513 Bacteria 5714
568 nmdc:mga0rr50_185167_c1 3300050513 Bacteria 1704
569 nmdc:mga0rr50_34273_c1 3300050513 Bacteria 3634
570 nmdc:mga0rr50_40556_c1 3300050513 Bacteria 3386
571 nmdc:mga0rr50_46281_c1 3300050513 Bacteria 3203
572 nmdc:mga08x19_10951_c1 3300050514 Bacteria 5456
573 nmdc:mga08x19_176721_c1 3300050514 Bacteria 1456
574 nmdc:mga0a205_114774_c1 3300050515 Bacteria 2592
575 nmdc:mga0a205_150209_c1 3300050515 Unclassified 2230
576 nmdc:mga0a205_161179_c1 3300050515 Bacteria 2140
577 nmdc:mga0a205_17873_c1 3300050515 Bacteria 6655
578 nmdc:mga0a205_263970_c1 3300050515 Bacteria 1599
579 nmdc:mga0a205_331748_c1 3300050515 Unclassified 1391
580 nmdc:mga0a205_3408_c1 3300050515 Bacteria 14171
581 nmdc:mga0a205_478120_c1 3300050515 Bacteria 1104
582 nmdc:mga0a205_536054_c1 3300050515 Unclassified 1026
583 nmdc:mga0a205_60135_c1 3300050515 Bacteria 3670
584 nmdc:mga0a205_8240_c1 3300050515 Bacteria 9473
585 nmdc:mga0a205_90189_c1 3300050515 Bacteria 2962
586 nmdc:mga0a205_97598_c1 3300050515 Bacteria 2837
587 Ga0501084_0000482 3300054114 Bacteria 30469
588 Ga0501084_0001427 3300054114 Bacteria 18952
589 Ga0501084_0007855 3300054114 Bacteria 8779
590 Ga0501084_0023316 3300054114 Bacteria 5167
591 Ga0501084_0037416 3300054114 Bacteria 4054
592 Ga0501084_0058981 3300054114 Bacteria 3212
593 Ga0501084_0063331 3300054114 Bacteria 3096
594 Ga0501084_0091133 3300054114 Bacteria 2560
595 Ga0501084_0245288 3300054114 Bacteria 1512
596 Ga0501084_0294431 3300054114 Bacteria 1371
597 Ga0501084_0388450 3300054114 Bacteria 1179
598 Ga0501084_0523590 3300054114 Unclassified 1002
599 Ga0501084_0911705 3300054114 Bacteria 739
600 Ga0501084_0923464 3300054114 Bacteria 734
601 Ga0501084_1018091 3300054114 Bacteria 696
602 Ga0590075_102529 3300059424 Bacteria 745
603 Ga0501082_0000752 3300060353 Bacteria 28466
604 Ga0501082_0002328 3300060353 Bacteria 16621
605 Ga0501082_0005201 3300060353 Bacteria 11313
606 Ga0501082_0020773 3300060353 Bacteria 5662
607 Ga0501082_0217974 3300060353 Bacteria 1660
608 Ga0530510_0000008 3300061734 Bacteria 165671
609 Ga0530510_0000706 3300061734 Bacteria 21648
610 Ga0530510_0013201 3300061734 Bacteria 5809
611 Ga0530510_0019068 3300061734 Bacteria 4865
612 Ga0530510_0027979 3300061734 Bacteria 4041
613 Ga0530510_0055100 3300061734 Bacteria 2873
614 Ga0530510_0068834 3300061734 Bacteria 2568
615 Ga0530510_0072266 3300061734 Bacteria 2504
616 Ga0530510_0102316 3300061734 Bacteria 2095
617 Ga0530510_0129223 3300061734 Bacteria 1858
618 Ga0530510_0702392 3300061734 Unclassified 771
619 Ga0530510_0795585 3300061734 Bacteria 721
620 Ga0439460_0087339
621 Ga0058859_11689533
622 Ga0058860_11955186
623 Ga0058860_12112715
624 Ga0065707_10116350
625 Ga0070676_10000511
626 Ga0070670_100075781
627 Ga0068869_100003089
628 Ga0070666_10273608
629 Ga0070680_100077107
630 Ga0070682_100002931
631 Ga0068868_100063653
632 Ga0070660_100002746
633 Ga0070689_100058468
634 Ga0070691_10010763
635 Ga0070661_100001190
636 Ga0070692_10025020
637 Ga0070669_100275790
638 Ga0070675_100282933
639 Ga0070673_100027615
640 Ga0070659_100004742
641 Ga0070703_10013321
642 Ga0070705_100012575
643 Ga0070694_100000075
644 Ga0070694_100000116
645 Ga0070694_100008467
646 Ga0070694_100017101
647 Ga0070708_100034263
648 Ga0070708_100074445
649 Ga0070708_100165213
650 Ga0070708_100275140
651 Ga0070708_100285388
652 Ga0070708_100297354
653 Ga0070708_100305060
654 Ga0070708_100354137
655 Ga0070708_100733283
656 Ga0070663_100013766
657 Ga0070662_100002383
658 Ga0070681_10301354
659 Ga0070681_10551841
660 Ga0068867_100001933
661 Ga0068867_100376735
662 Ga0068867_100822340
663 Ga0070706_100009685
664 Ga0070706_100015253
665 Ga0070706_100027912
666 Ga0070706_100328797
667 Ga0070706_100590099
668 Ga0070707_100028514
669 Ga0070707_100036914
670 Ga0070707_100062738
671 Ga0070707_100095679
672 Ga0070707_100521327
673 Ga0070698_100007345
674 Ga0070698_100041498
675 Ga0070698_100088346
676 Ga0070698_100169228
677 Ga0070698_100219241
678 Ga0070699_100005568
679 Ga0070699_100009767
680 Ga0070699_100291231
681 Ga0070699_100470125
682 Ga0070679_100049808
683 Ga0070684_100299333
684 Ga0070697_100007110
685 Ga0070697_100008056
686 Ga0070697_100013814
687 Ga0070697_100050339
688 Ga0070697_100058677
689 Ga0070697_100506022
690 Ga0068853_100003438
691 Ga0070695_100004280
692 Ga0070695_100018873
693 Ga0070695_100617043
694 Ga0070696_100002014
695 Ga0070696_100212415
696 Ga0070696_100256293
697 Ga0070696_100301142
698 Ga0070696_100350839
699 Ga0070693_100067378
700 Ga0070704_100075391
701 Ga0070704_100076771
702 Ga0068855_100282070
703 Ga0068856_100111323
704 Ga0070702_100667812
705 Ga0068859_100054000
706 Ga0068859_100064852
707 Ga0068859_100551621
708 Ga0068864_100041871
709 Ga0068866_10160244
710 Ga0068861_100041484
711 Ga0068861_100120721
712 Ga0068870_10008586
713 Ga0068863_100270582
714 Ga0068858_101296265
715 Ga0068860_100171965
716 Ga0068862_100003295
717 Ga0068862_100087371
718 Ga0068862_100346460
719 Ga0081455_10024112
720 Ga0081455_10340821
721 Ga0081540_1019047
722 Ga0081539_10000002
723 Ga0075428_100006097
724 Ga0075428_100011162
725 Ga0075428_100011421
726 Ga0075428_100015425
727 Ga0075428_100040376
728 Ga0075428_100082923
729 Ga0075428_100175935
730 Ga0075428_100185254
731 Ga0075428_100441458
732 Ga0075430_100000647
733 Ga0075430_100010977
734 Ga0075430_100071989
735 Ga0075430_100145741
736 Ga0075430_100494040
737 Ga0075431_100002578
738 Ga0075431_100004635
739 Ga0075431_100009590
740 Ga0075431_100023269
741 Ga0075431_100025646
742 Ga0075431_100037293
743 Ga0075431_100057380
744 Ga0075431_100076001
745 Ga0075431_100094219
746 Ga0075431_100251435
747 Ga0075431_100339958
748 Ga0075431_100372777
749 Ga0075433_10000423
750 Ga0075433_10008518
751 Ga0075433_10008925
752 Ga0075433_10014900
753 Ga0075433_10106600
754 Ga0075433_10180433
755 Ga0075433_10310517
756 Ga0075433_10353349
757 Ga0075433_10364357
758 Ga0075433_10453276
759 Ga0075434_100031055
760 Ga0075434_100152018
761 Ga0075434_100323918
762 Ga0075434_100334524
763 Ga0075434_100424331
764 Ga0075434_100436357
765 Ga0075434_100519998
766 Ga0075434_100645475
767 Ga0075434_100708748
768 Ga0075429_100003550
769 Ga0075429_100006040
770 Ga0075429_100016852
771 Ga0075429_100039263
772 Ga0075429_100056205
773 Ga0075429_100097566
774 Ga0075429_100185657
775 Ga0075429_100308265
776 Ga0075429_100486300
777 Ga0068865_100592421
778 Ga0075436_100006114
779 Ga0075436_100167064
780 Ga0075436_100203768
781 Ga0097620_100053998
782 Ga0097620_100064850
783 Ga0097620_100551577
784 Ga0075435_100008330
785 Ga0075435_100011334
786 Ga0075435_100023078
787 Ga0075435_100032795
788 Ga0075435_100049491
789 Ga0075435_100053454
790 Ga0075435_100057239
791 Ga0075435_100259646
792 Ga0075435_101069402
793 Ga0099794_10024311
794 Ga0099794_10068353
795 Ga0099794_10125445
796 Ga0111539_10000122
797 Ga0111539_10003950
798 Ga0111539_10122923
799 Ga0111539_10397398
800 Ga0111539_10580813
801 Ga0114129_10000439
802 Ga0114129_10001249
803 Ga0114129_10004586
804 Ga0114129_10008384
805 Ga0114129_10011311
806 Ga0114129_10015348
807 Ga0114129_10031976
808 Ga0114129_10064562
809 Ga0114129_10099806
810 Ga0114129_10123209
811 Ga0114129_10163179
812 Ga0114129_10178773
813 Ga0114129_10184313
814 Ga0114129_10192638
815 Ga0114129_10195056
816 Ga0114129_10212927
817 Ga0114129_10229024
818 Ga0114129_10281563
819 Ga0114129_10378760
820 Ga0114129_10579419
821 Ga0114129_10785514
822 Ga0105243_10165077
823 Ga0105241_10000067
824 Ga0105241_10089667
825 Ga0105242_10412002
826 Ga0105248_10414379
827 Ga0105249_10387817
828 Ga0105249_10545226
829 Ga0105249_11173298
830 Ga0157373_10000398
831 Ga0157369_10135236
832 Ga0157378_10347283
833 Ga0163162_10430773
834 Ga0163162_10572756
835 Ga0157372_10027845
836 Ga0157372_10343757
837 Ga0157375_10085411
838 Ga0157375_10254035
839 Ga0157380_10119075
840 Ga0157380_10228888
841 Ga0157377_10178718
842 Ga0157377_10199201
843 Ga0224712_10068158
844 Ga0224712_10291508
845 Ga0207653_10003059
846 Ga0207653_10110341
847 Ga0207645_10000406
848 Ga0207643_10000439
849 Ga0207684_10002380
850 Ga0207684_10008128
851 Ga0207684_10063810
852 Ga0207684_10097662
853 Ga0207684_10260208
854 Ga0207707_10000124
855 Ga0207663_10417759
856 Ga0207660_10006409
857 Ga0207660_10052397
858 Ga0207657_10000085
859 Ga0207649_10089428
860 Ga0207652_10000264
861 Ga0207646_10003351
862 Ga0207646_10008545
863 Ga0207646_10012323
864 Ga0207646_10016164
865 Ga0207646_10033162
866 Ga0207646_10037706
867 Ga0207646_10057844
868 Ga0207646_10103560
869 Ga0207681_10143897
870 Ga0207681_10461600
871 Ga0207650_10120989
872 Ga0207690_10038431
873 Ga0207706_10003538
874 Ga0207706_10082314
875 Ga0207709_10507766
876 Ga0207670_10245831
877 Ga0207704_10275150
878 Ga0207691_10037554
879 Ga0207691_10973863
880 Ga0207689_10000579
881 Ga0207689_10008697
882 Ga0207667_10101222
883 Ga0207712_10285044
884 Ga0207640_10002946
885 Ga0207677_10404016
886 Ga0207703_10218884
887 Ga0207703_10576259
888 Ga0207639_10117609
889 Ga0207678_10038916
890 Ga0207678_10254989
891 Ga0207641_10022933
892 Ga0207641_10388500
893 Ga0207648_10006511
894 Ga0207648_10612522
895 Ga0207648_10806863
896 Ga0207676_10005191
897 Ga0207675_100016892
898 Ga0207675_100028417
899 Ga0207675_100275443
900 Ga0207675_100404853
901 Ga0207675_101203130
902 Ga0209981_1025527
903 Ga0209970_1004248
904 Ga0209983_1000006
905 Ga0209971_1000053
906 Ga0209966_1000266
907 Ga0209998_10000083
908 Ga0209974_10020741
909 Ga0209974_10038511
910 Ga0207428_10000033
911 Ga0207428_10151472
912 Ga0207428_10697737
913 Ga0268265_10060192
914 Ga0268265_10063522
915 Ga0268265_10202159
916 Ga0268265_10722527
917 Ga0268264_10070525
918 Ga0268264_10085808
919 Ga0307408_100346354
920 Ga0307410_10090357
921 Ga0307410_10158311
922 Ga0307416_100651515
923 Ga0307416_101676821
924 Ga0307411_10197852
925 Ga0307411_10261695
926 Ga0307411_11091684
927 Ga0373959_0052868
928 Ga0373949_0134355
929 Ga0373952_0025924
930 Ga0373932_0001934
931 Ga0373939_0034581
932 Ga0373960_0007876
933 Ga0373961_0143584
934 Ga0373931_0062357
935 Ga0395899_0079906
936 Ga0395900_0002001
937 Ga0395898_0018739
938 Ga0395905_0215361
939 Ga0395905_0780356
940 Ga0395901_0000506
941 Ga0395901_0015352
942 Ga0242420_028490
943 Ga0439458_0004698
944 Ga0439458_0048494
945 Ga0439444_0017563
946 Ga0439459_0022598
947 Ga0439460_0009583
948 Ga0439460_0063668
949 Ga0451577_0082703
950 Ga0451577_0103310
951 Ga0451577_0135248
952 Ga0451577_0384818
953 Ga0453683_0010371
954 Ga0453683_0042884
955 Ga0451576_0008158
956 Ga0451576_0027403
957 Ga0451576_0046122
958 Ga0451576_0248820
959 Ga0451576_0385986
960 Ga0451576_0451726
961 Ga0495580_0000545
962 Ga0495580_0098535
963 Ga0495580_0105561
964 Ga0495584_0124715
965 Ga0495659_0077219
966 Ga0495669_0126592
967 Ga0495670_0352483
968 Ga0496101_0758302
969 Ga0496102_0018364
970 Ga0496102_0110028
971 Ga0496106_0080046
972 Ga0496107_0112497
973 Ga0501290_016192
974 Ga0501292_030173
975 Ga0501298_075720
976 Ga0501299_008100
977 Ga0501031_0021370
978 Ga0501033_0046375
979 Ga0501033_0059811
980 Ga0501033_0077750
981 Ga0501036_0002194
982 Ga0501036_0011211
983 Ga0501036_0012994
984 Ga0501036_0098851
985 Ga0501037_0184616
986 Ga0501037_0361501
987 Ga0501037_0411746
988 Ga0501038_0003015
989 Ga0501038_0032957
990 Ga0501038_0076909
991 Ga0501038_0141659
992 Ga0501038_0210424
993 Ga0501038_0441533
994 Ga0501038_0598975
995 Ga0501038_0619721
996 Ga0501039_0028341
997 Ga0501039_0059579
998 Ga0501039_0087764
999 Ga0501039_0210846
1000 Ga0501039_0221096
1001 Ga0501039_0233672
1002 Ga0501040_0000517
1003 Ga0501040_0003453
1004 Ga0501040_0005290
1005 Ga0501040_0005709
1006 Ga0501040_0134478
1007 Ga0501040_0141777
1008 Ga0501040_0173624
1009 Ga0501040_0208081
1010 Ga0501040_0430330
1011 Ga0501041_0001305
1012 Ga0501041_0005451
1013 Ga0501041_0005901
1014 Ga0501041_0026681
1015 Ga0501041_0036506
1016 Ga0501041_0039235
1017 Ga0501041_0177926
1018 Ga0501041_0191823
1019 Ga0501041_0423468
1020 Ga0501042_0000656
1021 Ga0501042_0015940
1022 Ga0501042_0083867
1023 Ga0501042_0151474
1024 Ga0501042_0157058
1025 Ga0501042_0387679
1026 Ga0501042_0477895
1027 Ga0501043_0153575
1028 Ga0501046_0007755
1029 Ga0501046_0009018
1030 Ga0501046_0132753
1031 Ga0501046_0238810
1032 Ga0501046_0331983
1033 Ga0501047_0020667
1034 Ga0501048_0001395
1035 Ga0501048_0010878
1036 Ga0501048_0049956
1037 Ga0501048_0057315
1038 Ga0501067_0149863
1039 Ga0501068_0033284
1040 Ga0501068_0043910
1041 Ga0501068_0352964
1042 Ga0501069_0092002
1043 Ga0501069_0132468
1044 Ga0501070_0035967
1045 Ga0501070_0351514
1046 Ga0501071_0000310
1047 Ga0501071_0025796
1048 Ga0501071_0113454
1049 Ga0501071_0219417
1050 Ga0501071_0249706
1051 Ga0501072_0000642
1052 Ga0501072_0007106
1053 Ga0501072_0024337
1054 Ga0501072_0043461
1055 Ga0501072_0082547
1056 Ga0501072_0085551
1057 Ga0501072_0091346
1058 Ga0501072_0272981
1059 Ga0501072_0305032
1060 Ga0501072_0406774
1061 Ga0501072_0549280
1062 Ga0501074_0000460
1063 Ga0501074_0014360
1064 Ga0501074_0142163
1065 Ga0501074_0163178
1066 Ga0501075_0000003
1067 Ga0501075_0000200
1068 Ga0501075_0003950
1069 Ga0501075_0030465
1070 Ga0501075_0049513
1071 Ga0501075_0072650
1072 Ga0501075_0090102
1073 Ga0501075_0142929
1074 Ga0501075_0626299
1075 Ga0501075_0640867
1076 Ga0501075_0850311
1077 Ga0501076_0000010
1078 Ga0501076_0000868
1079 Ga0501076_0028545
1080 Ga0501076_0036622
1081 Ga0501076_0038015
1082 Ga0501076_0088158
1083 Ga0501076_0115229
1084 Ga0501076_0140587
1085 Ga0501076_0230981
1086 Ga0501076_0324836
1087 Ga0501077_0000171
1088 Ga0501077_0048521
1089 Ga0501077_0057620
1090 Ga0501077_0076316
1091 Ga0501079_0001602
1092 Ga0501079_0007978
1093 Ga0501079_0009344
1094 Ga0501079_0011807
1095 Ga0501079_0011947
1096 Ga0501079_0122282
1097 Ga0501079_0159801
1098 Ga0501079_0420806
1099 Ga0501079_0430141
1100 Ga0501080_0036903
1101 Ga0501080_0180659
1102 Ga0501080_0280110
1103 Ga0501080_0281866
1104 Ga0501081_0000019
1105 Ga0501081_0000618
1106 Ga0501081_0004472
1107 Ga0501081_0006317
1108 Ga0501081_0009366
1109 Ga0501081_0021237
1110 Ga0501081_0035498
1111 Ga0501081_0272546
1112 Ga0501081_0285936
1113 Ga0501081_0347724
1114 Ga0501081_0367940
1115 Ga0501083_0054764
1116 Ga0501083_0068550
1117 Ga0501083_0181941
1118 Ga0501035_0051281
1119 Ga0501035_0084820
1120 Ga0501035_0205097
1121 Ga0501044_0893199
1122 Ga0501045_0000013
1123 Ga0501045_0003706
1124 Ga0501045_0022050
1125 Ga0501045_0024044
1126 Ga0501045_0049003
1127 Ga0501045_0085066
1128 Ga0501045_0239822
1129 Ga0501045_0489999
1130 nmdc:mga05p37_108685_c1
1131 nmdc:mga05p37_112684_c1
1132 nmdc:mga05p37_12745_c1
1133 nmdc:mga05p37_176674_c1
1134 nmdc:mga05p37_187771_c1
1135 nmdc:mga05p37_201989_c1
1136 nmdc:mga05p37_2058_c1
1137 nmdc:mga05p37_227723_c1
1138 nmdc:mga05p37_317883_c1
1139 nmdc:mga05p37_34802_c1
1140 nmdc:mga05p37_364155_c1
1141 nmdc:mga05p37_378021_c1
1142 nmdc:mga05p37_3858_c1
1143 nmdc:mga05p37_454833_c1
1144 nmdc:mga05p37_46742_c1
1145 nmdc:mga05p37_4699_c1
1146 nmdc:mga05p37_682318_c1
1147 nmdc:mga05p37_685159_c1
1148 nmdc:mga05p37_7483_c1
1149 nmdc:mga05p37_91501_c1
1150 nmdc:mga05p37_94147_c1
1151 nmdc:mga09592_19515_c1
1152 nmdc:mga09592_273319_c1
1153 nmdc:mga09592_31416_c1
1154 nmdc:mga09592_36834_c1
1155 nmdc:mga09592_472834_c1
1156 nmdc:mga09592_52066_c1
1157 nmdc:mga0qj67_12237_c1
1158 nmdc:mga0qj67_1548_c1
1159 nmdc:mga0qj67_211759_c1
1160 nmdc:mga0qj67_27387_c1
1161 nmdc:mga0qj67_89963_c1
1162 nmdc:mga06r32_106945_c1
1163 nmdc:mga06r32_130421_c1
1164 nmdc:mga06r32_148066_c1
1165 nmdc:mga06r32_14886_c1
1166 nmdc:mga06r32_220849_c1
1167 nmdc:mga06r32_221871_c1
1168 nmdc:mga06r32_30838_c1
1169 nmdc:mga06r32_3605_c1
1170 nmdc:mga06r32_55702_c1
1171 nmdc:mga06r32_777324_c1
1172 nmdc:mga08y16_10576_c1
1173 nmdc:mga08y16_1358968_c1
1174 nmdc:mga08y16_23200_c1
1175 nmdc:mga08y16_454772_c1
1176 nmdc:mga08y16_515123_c1
1177 nmdc:mga0n895_102752_c1
1178 nmdc:mga0n895_195215_c1
1179 nmdc:mga0n895_22977_c1
1180 nmdc:mga0n895_23856_c1
1181 nmdc:mga0n895_254853_c1
1182 nmdc:mga0n895_369708_c1
1183 nmdc:mga0n895_55399_c1
1184 nmdc:mga0n895_557357_c1
1185 nmdc:mga0rr50_1027_c1
1186 nmdc:mga0rr50_11272_c1
1187 nmdc:mga0rr50_185167_c1
1188 nmdc:mga0rr50_34273_c1
1189 nmdc:mga0rr50_40556_c1
1190 nmdc:mga0rr50_46281_c1
1191 nmdc:mga08x19_10951_c1
1192 nmdc:mga08x19_176721_c1
1193 nmdc:mga0a205_114774_c1
1194 nmdc:mga0a205_150209_c1
1195 nmdc:mga0a205_161179_c1
1196 nmdc:mga0a205_17873_c1
1197 nmdc:mga0a205_263970_c1
1198 nmdc:mga0a205_331748_c1
1199 nmdc:mga0a205_3408_c1
1200 nmdc:mga0a205_478120_c1
1201 nmdc:mga0a205_536054_c1
1202 nmdc:mga0a205_60135_c1
1203 nmdc:mga0a205_8240_c1
1204 nmdc:mga0a205_90189_c1
1205 nmdc:mga0a205_97598_c1
1206 Ga0501084_0000482
1207 Ga0501084_0001427
1208 Ga0501084_0007855
1209 Ga0501084_0023316
1210 Ga0501084_0037416
1211 Ga0501084_0058981
1212 Ga0501084_0063331
1213 Ga0501084_0091133
1214 Ga0501084_0245288
1215 Ga0501084_0294431
1216 Ga0501084_0388450
1217 Ga0501084_0523590
1218 Ga0501084_0911705
1219 Ga0501084_0923464
1220 Ga0501084_1018091
1221 Ga0590075_102529
1222 Ga0501082_0000752
1223 Ga0501082_0002328
1224 Ga0501082_0005201
1225 Ga0501082_0020773
1226 Ga0501082_0217974
1227 Ga0530510_0000008
1228 Ga0530510_0000706
1229 Ga0530510_0013201
1230 Ga0530510_0019068
1231 Ga0530510_0027979
1232 Ga0530510_0055100
1233 Ga0530510_0068834
1234 Ga0530510_0072266
1235 Ga0530510_0102316
1236 Ga0530510_0129223
1237 Ga0530510_0702392
1238 Ga0530510_0795585

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02777

Sod_Fe_C

Iron/manganese superoxide dismutases, C-terminal domain

102

199

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s0d-assembly1.cif.gz_A h30 mnsod-3 mutant ii 0.9098 22 201
3c3s-assembly1.cif.gz_A role of a glutamate bridge spanning the dimeric interface of human manganese superoxide dismutase 0.9067 22 201
1zte-assembly1.cif.gz_A contribution to structure and catalysis of tyrosine 34 in human manganese suerpoxide dismutase 0.9064 22 201
1ap5-assembly1.cif.gz_A tyr34->phe mutant of human mitochondrial manganese superoxide dismutase 0.9042 22 201
1ja8-assembly1.cif.gz_A kinetic analysis of product inhibition in human manganese superoxide dismutase 0.9036 22 201
ID Description Score Start End Superfamily
3ak3B02 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.8948 92 202 3.55.40.20
1gn4D02 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.8888 93 201 3.55.40.20
af_O74379_99_220_3.55.40.20 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.8886 103 201 3.55.40.20
af_A0A0R0EIY1_182_299_3.55.40.20 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.8865 96 202 3.55.40.20
af_F4IB75_8_187_1.20.1260.60 Mainly Alpha;Up-down Bundle;Ferritin;Vacuolar protein sorting-associated protein Ist1 0.8849 26 84 1.20.1260.60
ID Description Score Start End GO Terms
AF-A0A533BKJ5-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9643 7 202 GO:0004784
GO:0046872
AF-A0A534TNM0-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9633 7 204 GO:0004784
GO:0046872
AF-E6PDX0-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9623 7 201 GO:0004784
GO:0046872
AF-A0A2V6Q6N3-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9614 1 214 GO:0004784
GO:0046872
GO:0051536
AF-A0A7C4VYZ7-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9611 14 205 GO:0004784
GO:0046872

Map