F469852
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 619 | 299 | 1238 | 331 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0106794|Ga0495686_0106794_511_1569 |
| Length | 346 |
| Sequence | MTEITTTSAAEVAAETAEFSAANGTVGSDFERMIEEIRSHDRFLLTAHEGPDGDALGSLLGMHHLLNKLGKDSVMFLAAKEFPLPIEYRFLPLENVFHEAPADMADRVIMFLDCGNIDRMPVPFLTEGENRRLNIDHHHDNTRFGDVNLVAPRASCTAEIVYDIAHVLGVPIDAEMAMPLYVGLITDTGKFMYENTNAHTHRVAAELIDAGVSVDDTYRRLYEHVPIEKLRLVARALDGIQISCGGRLAISYITAEDYAATGSGEEMTEGVIDHLRSIDGIKVAAVIRDLGNRGRAARKASLRSSEGDVDVSAIARKQGAAGFSTDDDLPALVEFLCGEVTAQLGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 149 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 150 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 157 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 158 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 162 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 168 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 177 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 178 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 179 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 180 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 227 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 228 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 229 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 230 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 231 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 234 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 235 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 236 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 237 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 238 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 239 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 240 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 241 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 242 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 245 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 246 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 247 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 280 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 281 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 282 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 293 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 294 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 295 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 296 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 297 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.36 |
| Nodule | 0 |
| Rhizoplane | 9.85 |
| Rhizosphere | 83.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495686_0106794 | 3300047472 | Bacteria | 1683 |
| 2 | JGI24746J21847_1000448 | 3300001977 | Bacteria | 6156 |
| 3 | JGI24740J21852_10005544 | 3300001979 | Bacteria | 5318 |
| 4 | JGI24748J21848_1000245 | 3300002074 | Bacteria | 6465 |
| 5 | JGI24034J26672_10000228 | 3300002239 | Bacteria | 7405 |
| 6 | JGI25406J46586_10013325 | 3300003203 | Bacteria | 3536 |
| 7 | JGI25406J46586_10032267 | 3300003203 | Bacteria | 1947 |
| 8 | JGI25407J50210_10006700 | 3300003373 | Bacteria | 2875 |
| 9 | Ga0070683_100036528 | 3300005329 | Bacteria | 4496 |
| 10 | Ga0070683_100040913 | 3300005329 | Bacteria | 4262 |
| 11 | Ga0070683_100064408 | 3300005329 | Bacteria | 3412 |
| 12 | Ga0070683_100080858 | 3300005329 | Bacteria | 3042 |
| 13 | Ga0070683_100095602 | 3300005329 | Bacteria | 2794 |
| 14 | Ga0070683_100317814 | 3300005329 | Bacteria | 1482 |
| 15 | Ga0070670_100234617 | 3300005331 | Bacteria | 1597 |
| 16 | Ga0070666_10100829 | 3300005335 | Bacteria | 1990 |
| 17 | Ga0070682_100000075 | 3300005337 | Bacteria | 90547 |
| 18 | Ga0070682_100000090 | 3300005337 | Bacteria | 82642 |
| 19 | Ga0070682_100029118 | 3300005337 | Bacteria | 3324 |
| 20 | Ga0068868_100002263 | 3300005338 | Bacteria | 13307 |
| 21 | Ga0068868_100058291 | 3300005338 | Bacteria | 3052 |
| 22 | Ga0070660_100130062 | 3300005339 | Bacteria | 2014 |
| 23 | Ga0070660_100214557 | 3300005339 | Bacteria | 1563 |
| 24 | Ga0070691_10000044 | 3300005341 | Bacteria | 36029 |
| 25 | Ga0070661_100000099 | 3300005344 | Bacteria | 71115 |
| 26 | Ga0070668_100007577 | 3300005347 | Bacteria | 8057 |
| 27 | Ga0070669_100141018 | 3300005353 | Bacteria | 1858 |
| 28 | Ga0070675_100000106 | 3300005354 | Bacteria | 49336 |
| 29 | Ga0070674_100000012 | 3300005356 | Bacteria | 130773 |
| 30 | Ga0070674_100000023 | 3300005356 | Bacteria | 84887 |
| 31 | Ga0070674_100038302 | 3300005356 | Bacteria | 3230 |
| 32 | Ga0070673_100086078 | 3300005364 | Bacteria | 2560 |
| 33 | Ga0070688_100221513 | 3300005365 | Bacteria | 1333 |
| 34 | Ga0070659_100002550 | 3300005366 | Bacteria | 12957 |
| 35 | Ga0070714_100097160 | 3300005435 | Bacteria | 2589 |
| 36 | Ga0070713_100000010 | 3300005436 | Bacteria | 151790 |
| 37 | Ga0070701_10146866 | 3300005438 | Bacteria | 1354 |
| 38 | Ga0070711_100000890 | 3300005439 | Bacteria | 15699 |
| 39 | Ga0070711_100023878 | 3300005439 | Bacteria | 3982 |
| 40 | Ga0070711_100111315 | 3300005439 | Bacteria | 2010 |
| 41 | Ga0070705_100045395 | 3300005440 | Bacteria | 2528 |
| 42 | Ga0070700_100083955 | 3300005441 | Unclassified | 2063 |
| 43 | Ga0070700_100121439 | 3300005441 | Bacteria | 1751 |
| 44 | Ga0070663_100003155 | 3300005455 | Bacteria | 9451 |
| 45 | Ga0070678_100011298 | 3300005456 | Bacteria | 5502 |
| 46 | Ga0070678_100027118 | 3300005456 | Bacteria | 3885 |
| 47 | Ga0070678_100289797 | 3300005456 | Unclassified | 1387 |
| 48 | Ga0070662_100000002 | 3300005457 | Bacteria | 253208 |
| 49 | Ga0070662_100151860 | 3300005457 | Bacteria | 1804 |
| 50 | Ga0070681_10056165 | 3300005458 | Bacteria | 3919 |
| 51 | Ga0070681_10285857 | 3300005458 | Bacteria | 1560 |
| 52 | Ga0068867_100023529 | 3300005459 | Bacteria | 4410 |
| 53 | Ga0070685_10001018 | 3300005466 | Bacteria | 15078 |
| 54 | Ga0070685_10003345 | 3300005466 | Bacteria | 8161 |
| 55 | Ga0070685_10042491 | 3300005466 | Bacteria | 2594 |
| 56 | Ga0070679_100000369 | 3300005530 | Bacteria | 38264 |
| 57 | Ga0070684_100020599 | 3300005535 | Bacteria | 5469 |
| 58 | Ga0070684_100025738 | 3300005535 | Bacteria | 4948 |
| 59 | Ga0070684_100085055 | 3300005535 | Bacteria | 2805 |
| 60 | Ga0070684_100110427 | 3300005535 | Bacteria | 2465 |
| 61 | Ga0068853_100064522 | 3300005539 | Bacteria | 3176 |
| 62 | Ga0070672_100000001 | 3300005543 | Bacteria | 204624 |
| 63 | Ga0070695_100031572 | 3300005545 | Bacteria | 3306 |
| 64 | Ga0070696_100093886 | 3300005546 | Bacteria | 2140 |
| 65 | Ga0070693_100000341 | 3300005547 | Bacteria | 21257 |
| 66 | Ga0070665_100000135 | 3300005548 | Bacteria | 138925 |
| 67 | Ga0070665_100041372 | 3300005548 | Bacteria | 4631 |
| 68 | Ga0070665_100058089 | 3300005548 | Bacteria | 3878 |
| 69 | Ga0070665_100180821 | 3300005548 | Bacteria | 2110 |
| 70 | Ga0070704_100015164 | 3300005549 | Bacteria | 4834 |
| 71 | Ga0070704_100209650 | 3300005549 | Bacteria | 1578 |
| 72 | Ga0068855_100134528 | 3300005563 | Bacteria | 2821 |
| 73 | Ga0068855_100296368 | 3300005563 | Bacteria | 1792 |
| 74 | Ga0068855_100504142 | 3300005563 | Bacteria | 1315 |
| 75 | Ga0068854_100000947 | 3300005578 | Bacteria | 17454 |
| 76 | Ga0068856_100036208 | 3300005614 | Bacteria | 4838 |
| 77 | Ga0068856_100039424 | 3300005614 | Bacteria | 4638 |
| 78 | Ga0070702_100104151 | 3300005615 | Bacteria | 1746 |
| 79 | Ga0070702_100117582 | 3300005615 | Bacteria | 1659 |
| 80 | Ga0068852_100001985 | 3300005616 | Bacteria | 13958 |
| 81 | Ga0068866_10000008 | 3300005718 | Bacteria | 117658 |
| 82 | Ga0068866_10000460 | 3300005718 | Bacteria | 18634 |
| 83 | Ga0068851_10003096 | 3300005834 | Bacteria | 7366 |
| 84 | Ga0068863_100000022 | 3300005841 | Bacteria | 188278 |
| 85 | Ga0068863_100084455 | 3300005841 | Bacteria | 3009 |
| 86 | Ga0068863_100312012 | 3300005841 | Bacteria | 1527 |
| 87 | Ga0068858_100000075 | 3300005842 | Bacteria | 104349 |
| 88 | Ga0068858_100003213 | 3300005842 | Bacteria | 16316 |
| 89 | Ga0068860_100010748 | 3300005843 | Bacteria | 9034 |
| 90 | Ga0068860_100237194 | 3300005843 | Bacteria | 1773 |
| 91 | Ga0068862_100001298 | 3300005844 | Bacteria | 23354 |
| 92 | Ga0081455_10020241 | 3300005937 | Bacteria | 6272 |
| 93 | Ga0081455_10025411 | 3300005937 | Bacteria | 5468 |
| 94 | Ga0081455_10026546 | 3300005937 | Bacteria | 5323 |
| 95 | Ga0081455_10052960 | 3300005937 | Bacteria | 3470 |
| 96 | Ga0081538_10000141 | 3300005981 | Bacteria | 74085 |
| 97 | Ga0081538_10000568 | 3300005981 | Bacteria | 40894 |
| 98 | Ga0081538_10005974 | 3300005981 | Bacteria | 10836 |
| 99 | Ga0081538_10023885 | 3300005981 | Bacteria | 4376 |
| 100 | Ga0081540_1002030 | 3300005983 | Bacteria | 16890 |
| 101 | Ga0081539_10000878 | 3300005985 | Bacteria | 57633 |
| 102 | Ga0081539_10001538 | 3300005985 | Bacteria | 38558 |
| 103 | Ga0081539_10009688 | 3300005985 | Bacteria | 7978 |
| 104 | Ga0081539_10017083 | 3300005985 | Bacteria | 5122 |
| 105 | Ga0075365_10000294 | 3300006038 | Bacteria | 17330 |
| 106 | Ga0075365_10005137 | 3300006038 | Bacteria | 7029 |
| 107 | Ga0075365_10012358 | 3300006038 | Bacteria | 5068 |
| 108 | Ga0075365_10079359 | 3300006038 | Bacteria | 2221 |
| 109 | Ga0075365_10085997 | 3300006038 | Bacteria | 2136 |
| 110 | Ga0075365_10208054 | 3300006038 | Bacteria | 1371 |
| 111 | Ga0075363_100124535 | 3300006048 | Bacteria | 1442 |
| 112 | Ga0075364_10085022 | 3300006051 | Bacteria | 2095 |
| 113 | Ga0075364_10149550 | 3300006051 | Bacteria | 1573 |
| 114 | Ga0075364_10156480 | 3300006051 | Unclassified | 1537 |
| 115 | Ga0075364_10183983 | 3300006051 | Bacteria | 1414 |
| 116 | Ga0070715_10000021 | 3300006163 | Bacteria | 119283 |
| 117 | Ga0070712_100015682 | 3300006175 | Bacteria | 4884 |
| 118 | Ga0075367_10120948 | 3300006178 | Bacteria | 1613 |
| 119 | Ga0075367_10207860 | 3300006178 | Bacteria | 1224 |
| 120 | Ga0075370_10043043 | 3300006353 | Unclassified | 2552 |
| 121 | Ga0075428_100168049 | 3300006844 | Unclassified | 2379 |
| 122 | Ga0075428_100197425 | 3300006844 | Bacteria | 2176 |
| 123 | Ga0075428_100197815 | 3300006844 | Bacteria | 2174 |
| 124 | Ga0075430_100171108 | 3300006846 | Bacteria | 1807 |
| 125 | Ga0075431_100000083 | 3300006847 | Bacteria | 56463 |
| 126 | Ga0075431_100059091 | 3300006847 | Bacteria | 3957 |
| 127 | Ga0075433_10026103 | 3300006852 | Bacteria | 4942 |
| 128 | Ga0075433_10036301 | 3300006852 | Bacteria | 4245 |
| 129 | Ga0075433_10312881 | 3300006852 | Bacteria | 1390 |
| 130 | Ga0075434_100066000 | 3300006871 | Bacteria | 3604 |
| 131 | Ga0068865_100000490 | 3300006881 | Bacteria | 22178 |
| 132 | Ga0075436_100135286 | 3300006914 | Bacteria | 1730 |
| 133 | Ga0075435_100121727 | 3300007076 | Bacteria | 2178 |
| 134 | Ga0111539_10011397 | 3300009094 | Bacteria | 11161 |
| 135 | Ga0111539_10092497 | 3300009094 | Bacteria | 3554 |
| 136 | Ga0105245_10000278 | 3300009098 | Bacteria | 48473 |
| 137 | Ga0105245_10000415 | 3300009098 | Bacteria | 39764 |
| 138 | Ga0105245_10010216 | 3300009098 | Bacteria | 8174 |
| 139 | Ga0105245_10236811 | 3300009098 | Bacteria | 1768 |
| 140 | Ga0105245_10507824 | 3300009098 | Bacteria | 1222 |
| 141 | Ga0105247_10000305 | 3300009101 | Bacteria | 44071 |
| 142 | Ga0114129_10011162 | 3300009147 | Bacteria | 12806 |
| 143 | Ga0114129_10038150 | 3300009147 | Bacteria | 6780 |
| 144 | Ga0114129_10069445 | 3300009147 | Bacteria | 4911 |
| 145 | Ga0114129_10376262 | 3300009147 | Bacteria | 1876 |
| 146 | Ga0114129_10555439 | 3300009147 | Bacteria | 1492 |
| 147 | Ga0105243_10038717 | 3300009148 | Bacteria | 3714 |
| 148 | Ga0105242_10000603 | 3300009176 | Bacteria | 28175 |
| 149 | Ga0105242_10003748 | 3300009176 | Bacteria | 11810 |
| 150 | Ga0105248_10000020 | 3300009177 | Bacteria | 284637 |
| 151 | Ga0105238_10000055 | 3300009551 | Bacteria | 139232 |
| 152 | Ga0105238_10451435 | 3300009551 | Bacteria | 1282 |
| 153 | Ga0105249_10000143 | 3300009553 | Bacteria | 92539 |
| 154 | Ga0105249_10023295 | 3300009553 | Bacteria | 5555 |
| 155 | Ga0105249_10068962 | 3300009553 | Bacteria | 3263 |
| 156 | Ga0105249_10093858 | 3300009553 | Bacteria | 2812 |
| 157 | Ga0105249_10207509 | 3300009553 | Unclassified | 1920 |
| 158 | Ga0105239_10101908 | 3300010375 | Bacteria | 3177 |
| 159 | Ga0105239_10220543 | 3300010375 | Bacteria | 2127 |
| 160 | Ga0105246_10165684 | 3300011119 | Bacteria | 1688 |
| 161 | Ga0105246_10223048 | 3300011119 | Bacteria | 1479 |
| 162 | Ga0157370_10018133 | 3300013104 | Bacteria | 7086 |
| 163 | Ga0157370_10056831 | 3300013104 | Bacteria | 3723 |
| 164 | Ga0157370_10102427 | 3300013104 | Bacteria | 2681 |
| 165 | Ga0157369_10000074 | 3300013105 | Bacteria | 136668 |
| 166 | Ga0157374_10012359 | 3300013296 | Bacteria | 7428 |
| 167 | Ga0157378_10005561 | 3300013297 | Bacteria | 11033 |
| 168 | Ga0157378_10079154 | 3300013297 | Bacteria | 2967 |
| 169 | Ga0157372_10026046 | 3300013307 | Bacteria | 6361 |
| 170 | Ga0157375_10009814 | 3300013308 | Bacteria | 8416 |
| 171 | Ga0157375_10053210 | 3300013308 | Bacteria | 3982 |
| 172 | Ga0163163_10041962 | 3300014325 | Bacteria | 4477 |
| 173 | Ga0163163_10087466 | 3300014325 | Bacteria | 3126 |
| 174 | Ga0157380_10000016 | 3300014326 | Bacteria | 126029 |
| 175 | Ga0157379_10317483 | 3300014968 | Bacteria | 1422 |
| 176 | Ga0157376_10379074 | 3300014969 | Bacteria | 1362 |
| 177 | Ga0163161_10000053 | 3300017792 | Bacteria | 117408 |
| 178 | Ga0163161_10026609 | 3300017792 | Bacteria | 4097 |
| 179 | Ga0206356_10481544 | 3300020070 | Bacteria | 2461 |
| 180 | Ga0206350_11586870 | 3300020080 | Bacteria | 1301 |
| 181 | Ga0207656_10000570 | 3300025321 | Bacteria | 12237 |
| 182 | Ga0207682_10000091 | 3300025893 | Bacteria | 41479 |
| 183 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 184 | Ga0207642_10000275 | 3300025899 | Bacteria | 15398 |
| 185 | Ga0207642_10125725 | 3300025899 | Bacteria | 1330 |
| 186 | Ga0207710_10000157 | 3300025900 | Bacteria | 72764 |
| 187 | Ga0207688_10032696 | 3300025901 | Bacteria | 2876 |
| 188 | Ga0207680_10024183 | 3300025903 | Bacteria | 3330 |
| 189 | Ga0207685_10000028 | 3300025905 | Bacteria | 97935 |
| 190 | Ga0207707_10031693 | 3300025912 | Bacteria | 4627 |
| 191 | Ga0207693_10001086 | 3300025915 | Bacteria | 24419 |
| 192 | Ga0207693_10095615 | 3300025915 | Bacteria | 2329 |
| 193 | Ga0207693_10334952 | 3300025915 | Bacteria | 1184 |
| 194 | Ga0207663_10000409 | 3300025916 | Bacteria | 18629 |
| 195 | Ga0207657_10168337 | 3300025919 | Bacteria | 1776 |
| 196 | Ga0207649_10000127 | 3300025920 | Bacteria | 64603 |
| 197 | Ga0207652_10000321 | 3300025921 | Bacteria | 49720 |
| 198 | Ga0207681_10119746 | 3300025923 | Bacteria | 1929 |
| 199 | Ga0207694_10000063 | 3300025924 | Bacteria | 139700 |
| 200 | Ga0207650_10080137 | 3300025925 | Bacteria | 2475 |
| 201 | Ga0207659_10000013 | 3300025926 | Bacteria | 172742 |
| 202 | Ga0207687_10000032 | 3300025927 | Bacteria | 143196 |
| 203 | Ga0207687_10000036 | 3300025927 | Bacteria | 121934 |
| 204 | Ga0207687_10157963 | 3300025927 | Bacteria | 1737 |
| 205 | Ga0207687_10233901 | 3300025927 | Bacteria | 1453 |
| 206 | Ga0207700_10000007 | 3300025928 | Bacteria | 345720 |
| 207 | Ga0207664_10075797 | 3300025929 | Bacteria | 2721 |
| 208 | Ga0207664_10083242 | 3300025929 | Bacteria | 2608 |
| 209 | Ga0207690_10007226 | 3300025932 | Bacteria | 6595 |
| 210 | Ga0207690_10031841 | 3300025932 | Bacteria | 3379 |
| 211 | Ga0207706_10000001 | 3300025933 | Bacteria | 423014 |
| 212 | Ga0207706_10018417 | 3300025933 | Bacteria | 6284 |
| 213 | Ga0207706_10062147 | 3300025933 | Bacteria | 3289 |
| 214 | Ga0207686_10000097 | 3300025934 | Bacteria | 72219 |
| 215 | Ga0207686_10000411 | 3300025934 | Bacteria | 29706 |
| 216 | Ga0207669_10000017 | 3300025937 | Bacteria | 119878 |
| 217 | Ga0207669_10000026 | 3300025937 | Bacteria | 92199 |
| 218 | Ga0207669_10074675 | 3300025937 | Bacteria | 2145 |
| 219 | Ga0207704_10000805 | 3300025938 | Bacteria | 13852 |
| 220 | Ga0207665_10074954 | 3300025939 | Bacteria | 2317 |
| 221 | Ga0207691_10000747 | 3300025940 | Bacteria | 32117 |
| 222 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 223 | Ga0207689_10072097 | 3300025942 | Bacteria | 2837 |
| 224 | Ga0207661_10005476 | 3300025944 | Bacteria | 8952 |
| 225 | Ga0207661_10008364 | 3300025944 | Bacteria | 7391 |
| 226 | Ga0207661_10009986 | 3300025944 | Bacteria | 6821 |
| 227 | Ga0207661_10013674 | 3300025944 | Bacteria | 5926 |
| 228 | Ga0207661_10118210 | 3300025944 | Bacteria | 2253 |
| 229 | Ga0207661_10441613 | 3300025944 | Bacteria | 1184 |
| 230 | Ga0207661_10539049 | 3300025944 | Bacteria | 1068 |
| 231 | Ga0207667_10306651 | 3300025949 | Bacteria | 1622 |
| 232 | Ga0207667_10491257 | 3300025949 | Bacteria | 1245 |
| 233 | Ga0207651_10000448 | 3300025960 | Bacteria | 17432 |
| 234 | Ga0207712_10000058 | 3300025961 | Bacteria | 140948 |
| 235 | Ga0207712_10016807 | 3300025961 | Bacteria | 4744 |
| 236 | Ga0207668_10016755 | 3300025972 | Bacteria | 4581 |
| 237 | Ga0207668_10113662 | 3300025972 | Bacteria | 2036 |
| 238 | Ga0207658_10011985 | 3300025986 | Bacteria | 5913 |
| 239 | Ga0207677_10000284 | 3300026023 | Bacteria | 37886 |
| 240 | Ga0207677_10001254 | 3300026023 | Bacteria | 13667 |
| 241 | Ga0207703_10000088 | 3300026035 | Bacteria | 106080 |
| 242 | Ga0207703_10000287 | 3300026035 | Bacteria | 55757 |
| 243 | Ga0207703_10044258 | 3300026035 | Bacteria | 3577 |
| 244 | Ga0207639_10014925 | 3300026041 | Bacteria | 5472 |
| 245 | Ga0207639_10172698 | 3300026041 | Bacteria | 1832 |
| 246 | Ga0207678_10001743 | 3300026067 | Bacteria | 19907 |
| 247 | Ga0207708_10031466 | 3300026075 | Bacteria | 4027 |
| 248 | Ga0207708_10042963 | 3300026075 | Bacteria | 3444 |
| 249 | Ga0207702_10007528 | 3300026078 | Bacteria | 9285 |
| 250 | Ga0207641_10000016 | 3300026088 | Bacteria | 307363 |
| 251 | Ga0207641_10030625 | 3300026088 | Bacteria | 4457 |
| 252 | Ga0207641_10345463 | 3300026088 | Bacteria | 1417 |
| 253 | Ga0207648_10004310 | 3300026089 | Bacteria | 14650 |
| 254 | Ga0207676_10000018 | 3300026095 | Bacteria | 306375 |
| 255 | Ga0207683_10019197 | 3300026121 | Bacteria | 5837 |
| 256 | Ga0207683_10130162 | 3300026121 | Bacteria | 2263 |
| 257 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 258 | Ga0207698_10133239 | 3300026142 | Bacteria | 2127 |
| 259 | Ga0207428_10030572 | 3300027907 | Bacteria | 4452 |
| 260 | Ga0207428_10206806 | 3300027907 | Bacteria | 1476 |
| 261 | Ga0207428_10210921 | 3300027907 | Bacteria | 1459 |
| 262 | Ga0207428_10211897 | 3300027907 | Bacteria | 1455 |
| 263 | Ga0268266_10000056 | 3300028379 | Bacteria | 289176 |
| 264 | Ga0268266_10000674 | 3300028379 | Bacteria | 46135 |
| 265 | Ga0268266_10015138 | 3300028379 | Bacteria | 6623 |
| 266 | Ga0268266_10015515 | 3300028379 | Bacteria | 6535 |
| 267 | Ga0268266_10109390 | 3300028379 | Bacteria | 2447 |
| 268 | Ga0268265_10014206 | 3300028380 | Bacteria | 5423 |
| 269 | Ga0268264_10009842 | 3300028381 | Bacteria | 7914 |
| 270 | Ga0265337_1000066 | 3300028556 | Bacteria | 48673 |
| 271 | Ga0265326_10000258 | 3300028558 | Bacteria | 24473 |
| 272 | Ga0265319_1000317 | 3300028563 | Bacteria | 35915 |
| 273 | Ga0265322_10000011 | 3300028654 | Bacteria | 167597 |
| 274 | Ga0265336_10010612 | 3300028666 | Bacteria | 3153 |
| 275 | Ga0265338_10007586 | 3300028800 | Bacteria | 13402 |
| 276 | Ga0265324_10001593 | 3300029957 | Bacteria | 12632 |
| 277 | Ga0265324_10033605 | 3300029957 | Bacteria | 1789 |
| 278 | Ga0265320_10000011 | 3300031240 | Bacteria | 249534 |
| 279 | Ga0265325_10025131 | 3300031241 | Bacteria | 3235 |
| 280 | Ga0265329_10023150 | 3300031242 | Bacteria | 2071 |
| 281 | Ga0265331_10011614 | 3300031250 | Bacteria | 4816 |
| 282 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 283 | Ga0265314_10000640 | 3300031711 | Bacteria | 42944 |
| 284 | Ga0307410_10024605 | 3300031852 | Bacteria | 3765 |
| 285 | Ga0307407_10010761 | 3300031903 | Bacteria | 4327 |
| 286 | Ga0307409_100051835 | 3300031995 | Bacteria | 3142 |
| 287 | Ga0307409_100141048 | 3300031995 | Bacteria | 2077 |
| 288 | Ga0307416_100024159 | 3300032002 | Bacteria | 4429 |
| 289 | Ga0307414_10048032 | 3300032004 | Bacteria | 2942 |
| 290 | Ga0307411_10210341 | 3300032005 | Bacteria | 1501 |
| 291 | Ga0307415_100002308 | 3300032126 | Bacteria | 9461 |
| 292 | Ga0307415_100011517 | 3300032126 | Bacteria | 5067 |
| 293 | Ga0373943_0112414 | 3300035170 | Bacteria | 1438 |
| 294 | Ga0316574_0021795 | 3300035398 | Bacteria | 3808 |
| 295 | Ga0316574_0046989 | 3300035398 | Unclassified | 2678 |
| 296 | Ga0373937_0004956 | 3300036401 | Bacteria | 11321 |
| 297 | Ga0373937_0030944 | 3300036401 | Bacteria | 4847 |
| 298 | Ga0316584_0007137 | 3300036712 | Bacteria | 7617 |
| 299 | Ga0395900_0009556 | 3300037418 | Bacteria | 9943 |
| 300 | Ga0395900_0079423 | 3300037418 | Bacteria | 3371 |
| 301 | Ga0395900_0160915 | 3300037418 | Bacteria | 2290 |
| 302 | Ga0395900_0164594 | 3300037418 | Bacteria | 2261 |
| 303 | Ga0395900_0225955 | 3300037418 | Bacteria | 1885 |
| 304 | Ga0395898_0002264 | 3300037466 | Bacteria | 23336 |
| 305 | Ga0395898_0008352 | 3300037466 | Bacteria | 10948 |
| 306 | Ga0395898_0010733 | 3300037466 | Bacteria | 9569 |
| 307 | Ga0395898_0076418 | 3300037466 | Bacteria | 3234 |
| 308 | Ga0395905_0036048 | 3300037471 | Bacteria | 4645 |
| 309 | Ga0395905_0071067 | 3300037471 | Bacteria | 3263 |
| 310 | Ga0395905_0194885 | 3300037471 | Unclassified | 1900 |
| 311 | Ga0395901_0008042 | 3300038443 | Bacteria | 10652 |
| 312 | Ga0395901_0017662 | 3300038443 | Bacteria | 7282 |
| 313 | Ga0395901_0073322 | 3300038443 | Bacteria | 3570 |
| 314 | Ga0395901_0207232 | 3300038443 | Bacteria | 2053 |
| 315 | Ga0451853_0614736 | 3300041512 | Unclassified | 2306 |
| 316 | Ga0451853_2510563 | 3300041512 | Bacteria | 1549 |
| 317 | Ga0450920_004565 | 3300042122 | Bacteria | 2438 |
| 318 | Ga0466963_0000017 | 3300044694 | Bacteria | 58283 |
| 319 | Ga0466963_0021887 | 3300044694 | Bacteria | 4041 |
| 320 | Ga0466967_0000001 | 3300045976 | Bacteria | 229823 |
| 321 | Ga0495592_0000261 | 3300046454 | Bacteria | 44965 |
| 322 | Ga0495603_0000098 | 3300046455 | Bacteria | 40307 |
| 323 | Ga0495603_0012212 | 3300046455 | Bacteria | 5202 |
| 324 | Ga0495629_0002184 | 3300046459 | Bacteria | 15103 |
| 325 | Ga0495629_0020308 | 3300046459 | Bacteria | 4743 |
| 326 | Ga0495629_0108082 | 3300046459 | Bacteria | 1940 |
| 327 | Ga0495629_0123573 | 3300046459 | Bacteria | 1803 |
| 328 | Ga0495641_0000312 | 3300046461 | Bacteria | 39169 |
| 329 | Ga0495641_0020331 | 3300046461 | Bacteria | 3370 |
| 330 | Ga0495641_0021579 | 3300046461 | Bacteria | 3238 |
| 331 | Ga0495653_0016285 | 3300046463 | Bacteria | 6058 |
| 332 | Ga0495582_0000001 | 3300046473 | Bacteria | 252434 |
| 333 | Ga0495639_0012010 | 3300046475 | Bacteria | 3735 |
| 334 | Ga0495662_0003997 | 3300046476 | Bacteria | 7429 |
| 335 | Ga0495662_0098696 | 3300046476 | Bacteria | 1428 |
| 336 | Ga0495594_0000030 | 3300046499 | Bacteria | 66443 |
| 337 | Ga0495594_0102028 | 3300046499 | Bacteria | 1614 |
| 338 | Ga0495596_0028153 | 3300046500 | Bacteria | 2257 |
| 339 | Ga0495606_0000040 | 3300046507 | Bacteria | 223500 |
| 340 | Ga0495608_0000007 | 3300046511 | Bacteria | 313495 |
| 341 | Ga0495608_0001909 | 3300046511 | Bacteria | 14948 |
| 342 | Ga0495608_0007743 | 3300046511 | Bacteria | 7563 |
| 343 | Ga0495608_0009516 | 3300046511 | Bacteria | 6789 |
| 344 | Ga0495618_0000014 | 3300046514 | Bacteria | 163136 |
| 345 | Ga0495620_0000139 | 3300046515 | Bacteria | 59244 |
| 346 | Ga0495628_0000679 | 3300046516 | Bacteria | 31290 |
| 347 | Ga0495628_0020312 | 3300046516 | Bacteria | 5481 |
| 348 | Ga0495628_0068421 | 3300046516 | Bacteria | 2771 |
| 349 | Ga0495628_0130454 | 3300046516 | Bacteria | 1923 |
| 350 | Ga0495630_0000014 | 3300046517 | Bacteria | 217229 |
| 351 | Ga0495630_0002438 | 3300046517 | Bacteria | 12870 |
| 352 | Ga0495630_0060815 | 3300046517 | Bacteria | 2836 |
| 353 | Ga0495652_0000037 | 3300046529 | Bacteria | 133232 |
| 354 | Ga0495652_0020278 | 3300046529 | Bacteria | 5910 |
| 355 | Ga0495640_0019044 | 3300046533 | Bacteria | 5075 |
| 356 | Ga0495640_0089749 | 3300046533 | Bacteria | 2029 |
| 357 | Ga0495587_0011600 | 3300046536 | Bacteria | 5580 |
| 358 | Ga0495645_0122413 | 3300046543 | Bacteria | 1830 |
| 359 | Ga0495622_0000080 | 3300046557 | Bacteria | 85557 |
| 360 | Ga0495667_0000020 | 3300046559 | Bacteria | 180876 |
| 361 | Ga0495634_0000028 | 3300046642 | Bacteria | 114075 |
| 362 | Ga0495634_0000293 | 3300046642 | Bacteria | 47827 |
| 363 | Ga0495634_0014587 | 3300046642 | Bacteria | 5661 |
| 364 | Ga0495634_0092022 | 3300046642 | Bacteria | 1968 |
| 365 | Ga0495625_0000409 | 3300046660 | Bacteria | 65188 |
| 366 | Ga0495635_0000076 | 3300046663 | Bacteria | 61665 |
| 367 | Ga0495635_0020283 | 3300046663 | Bacteria | 4631 |
| 368 | Ga0495635_0032802 | 3300046663 | Bacteria | 3602 |
| 369 | Ga0495588_0000387 | 3300046674 | Bacteria | 25193 |
| 370 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 371 | Ga0495657_0062206 | 3300046675 | Bacteria | 2467 |
| 372 | Ga0495599_0053095 | 3300046678 | Bacteria | 2539 |
| 373 | Ga0495647_0000001 | 3300046681 | Bacteria | 222371 |
| 374 | Ga0495647_0002409 | 3300046681 | Bacteria | 5891 |
| 375 | Ga0495647_0009033 | 3300046681 | Bacteria | 3363 |
| 376 | Ga0495658_0000002 | 3300046683 | Bacteria | 309651 |
| 377 | Ga0495658_0023776 | 3300046683 | Bacteria | 3256 |
| 378 | Ga0495669_0000113 | 3300046684 | Bacteria | 52780 |
| 379 | Ga0495669_0018751 | 3300046684 | Bacteria | 2978 |
| 380 | Ga0495613_0000005 | 3300046689 | Bacteria | 222558 |
| 381 | Ga0495613_0000041 | 3300046689 | Bacteria | 130784 |
| 382 | Ga0495613_0077294 | 3300046689 | Bacteria | 2422 |
| 383 | Ga0495624_0001423 | 3300046690 | Bacteria | 18632 |
| 384 | Ga0495624_0002990 | 3300046690 | Bacteria | 12645 |
| 385 | Ga0495624_0018966 | 3300046690 | Bacteria | 4596 |
| 386 | Ga0495670_0008755 | 3300046691 | Bacteria | 4980 |
| 387 | Ga0495649_0003735 | 3300046694 | Bacteria | 10123 |
| 388 | Ga0495600_0004414 | 3300046809 | Bacteria | 8414 |
| 389 | Ga0495600_0010082 | 3300046809 | Bacteria | 5857 |
| 390 | Ga0495604_0000050 | 3300047317 | Bacteria | 108094 |
| 391 | Ga0495604_0000704 | 3300047317 | Bacteria | 28417 |
| 392 | Ga0495604_0038729 | 3300047317 | Bacteria | 3751 |
| 393 | Ga0495674_0000030 | 3300047319 | Bacteria | 115975 |
| 394 | Ga0495676_0000621 | 3300047321 | Bacteria | 29385 |
| 395 | Ga0495676_0001246 | 3300047321 | Bacteria | 21839 |
| 396 | Ga0495676_0045210 | 3300047321 | Bacteria | 3586 |
| 397 | Ga0495680_0001593 | 3300047322 | Bacteria | 24235 |
| 398 | Ga0495680_0006381 | 3300047322 | Bacteria | 10972 |
| 399 | Ga0495680_0021812 | 3300047322 | Bacteria | 5352 |
| 400 | Ga0495675_0000055 | 3300047444 | Bacteria | 77878 |
| 401 | Ga0495686_0101244 | 3300047472 | Bacteria | 1737 |
| 402 | Ga0495602_0000007 | 3300048088 | Bacteria | 273212 |
| 403 | Ga0495602_0014028 | 3300048088 | Bacteria | 8155 |
| 404 | Ga0495614_0110026 | 3300048089 | Bacteria | 1209 |
| 405 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 406 | Ga0496100_0000013 | 3300048903 | Bacteria | 177476 |
| 407 | Ga0496100_0071231 | 3300048903 | Bacteria | 2320 |
| 408 | Ga0496101_0000004 | 3300048904 | Bacteria | 331599 |
| 409 | Ga0496101_0000035 | 3300048904 | Bacteria | 177237 |
| 410 | Ga0496102_0000211 | 3300048905 | Bacteria | 77793 |
| 411 | Ga0496102_0000677 | 3300048905 | Bacteria | 34100 |
| 412 | Ga0496102_0075759 | 3300048905 | Bacteria | 3093 |
| 413 | Ga0496102_0392057 | 3300048905 | Bacteria | 1306 |
| 414 | Ga0496103_0000083 | 3300048906 | Bacteria | 108615 |
| 415 | Ga0496103_0009864 | 3300048906 | Bacteria | 5653 |
| 416 | Ga0496103_0067891 | 3300048906 | Bacteria | 2227 |
| 417 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 418 | Ga0496104_0000052 | 3300048907 | Bacteria | 137286 |
| 419 | Ga0496104_0017109 | 3300048907 | Bacteria | 6597 |
| 420 | Ga0496104_0033938 | 3300048907 | Bacteria | 4757 |
| 421 | Ga0496104_0090092 | 3300048907 | Bacteria | 2930 |
| 422 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 423 | Ga0496105_0000030 | 3300048908 | Bacteria | 137325 |
| 424 | Ga0496105_0024185 | 3300048908 | Bacteria | 4934 |
| 425 | Ga0496106_0000076 | 3300048909 | Bacteria | 79088 |
| 426 | Ga0496106_0000121 | 3300048909 | Bacteria | 59910 |
| 427 | Ga0496106_0000959 | 3300048909 | Bacteria | 21012 |
| 428 | Ga0496106_0028359 | 3300048909 | Bacteria | 4170 |
| 429 | Ga0496107_0000005 | 3300048910 | Bacteria | 281747 |
| 430 | Ga0496107_0000020 | 3300048910 | Bacteria | 148990 |
| 431 | Ga0496107_0034539 | 3300048910 | Bacteria | 3622 |
| 432 | Ga0496107_0183247 | 3300048910 | Bacteria | 1555 |
| 433 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 434 | Ga0496108_0000063 | 3300048911 | Bacteria | 118950 |
| 435 | Ga0496108_0000550 | 3300048911 | Bacteria | 29326 |
| 436 | Ga0496108_0000741 | 3300048911 | Bacteria | 25376 |
| 437 | Ga0496108_0025733 | 3300048911 | Bacteria | 4852 |
| 438 | Ga0496108_0239912 | 3300048911 | Bacteria | 1577 |
| 439 | Ga0496109_0000009 | 3300048912 | Bacteria | 236561 |
| 440 | Ga0496109_0000088 | 3300048912 | Bacteria | 94877 |
| 441 | Ga0496109_0000174 | 3300048912 | Bacteria | 63794 |
| 442 | Ga0496109_0000261 | 3300048912 | Bacteria | 50812 |
| 443 | Ga0496109_0023152 | 3300048912 | Bacteria | 5510 |
| 444 | Ga0496109_0069535 | 3300048912 | Bacteria | 3229 |
| 445 | Ga0496110_0000038 | 3300048913 | Bacteria | 64272 |
| 446 | Ga0496110_0016143 | 3300048913 | Bacteria | 6227 |
| 447 | Ga0496110_0094797 | 3300048913 | Bacteria | 2672 |
| 448 | Ga0496110_0095699 | 3300048913 | Bacteria | 2660 |
| 449 | Ga0496110_0297422 | 3300048913 | Bacteria | 1470 |
| 450 | Ga0496111_0000192 | 3300048914 | Bacteria | 28263 |
| 451 | Ga0496111_0017591 | 3300048914 | Bacteria | 4943 |
| 452 | Ga0496111_0052767 | 3300048914 | Bacteria | 2936 |
| 453 | Ga0496111_0053722 | 3300048914 | Bacteria | 2911 |
| 454 | Ga0496112_0000025 | 3300048915 | Bacteria | 146197 |
| 455 | Ga0496112_0002961 | 3300048915 | Bacteria | 13853 |
| 456 | Ga0496113_0000013 | 3300048916 | Bacteria | 81224 |
| 457 | Ga0496113_0021043 | 3300048916 | Bacteria | 4597 |
| 458 | Ga0496113_0087265 | 3300048916 | Bacteria | 2398 |
| 459 | Ga0496113_0123981 | 3300048916 | Bacteria | 2022 |
| 460 | Ga0496113_0194826 | 3300048916 | Bacteria | 1609 |
| 461 | Ga0496114_0024870 | 3300048917 | Bacteria | 4889 |
| 462 | Ga0496115_0000011 | 3300048918 | Bacteria | 222529 |
| 463 | Ga0496115_0000659 | 3300048918 | Bacteria | 25718 |
| 464 | Ga0496115_0015153 | 3300048918 | Bacteria | 5842 |
| 465 | Ga0496115_0057322 | 3300048918 | Bacteria | 3133 |
| 466 | Ga0496117_0003638 | 3300048920 | Bacteria | 17752 |
| 467 | Ga0496118_0002918 | 3300048921 | Bacteria | 22210 |
| 468 | Ga0496118_0122903 | 3300048921 | Bacteria | 1687 |
| 469 | Ga0496119_0011049 | 3300048922 | Bacteria | 7528 |
| 470 | Ga0496119_0012933 | 3300048922 | Bacteria | 6713 |
| 471 | Ga0496119_0014174 | 3300048922 | Bacteria | 6263 |
| 472 | Ga0496120_0006622 | 3300048923 | Bacteria | 8833 |
| 473 | Ga0496121_0006140 | 3300048924 | Bacteria | 15082 |
| 474 | Ga0496121_0027272 | 3300048924 | Bacteria | 5348 |
| 475 | Ga0496124_0032916 | 3300048927 | Bacteria | 4570 |
| 476 | Ga0496125_0076385 | 3300048928 | Bacteria | 2587 |
| 477 | Ga0496126_0106992 | 3300048929 | Bacteria | 2440 |
| 478 | Ga0501031_0000558 | 3300049568 | Bacteria | 21809 |
| 479 | Ga0501031_0038615 | 3300049568 | Bacteria | 3116 |
| 480 | Ga0501031_0149043 | 3300049568 | Bacteria | 1528 |
| 481 | Ga0501032_0001109 | 3300049569 | Bacteria | 21549 |
| 482 | Ga0501032_0042985 | 3300049569 | Bacteria | 3063 |
| 483 | Ga0501032_0119734 | 3300049569 | Bacteria | 1741 |
| 484 | Ga0501033_0001357 | 3300049570 | Bacteria | 21809 |
| 485 | Ga0501033_0187683 | 3300049570 | Bacteria | 1480 |
| 486 | Ga0501034_0001826 | 3300049571 | Bacteria | 27013 |
| 487 | Ga0501034_0016651 | 3300049571 | Bacteria | 7537 |
| 488 | Ga0501034_0116104 | 3300049571 | Bacteria | 2665 |
| 489 | Ga0501034_0183278 | 3300049571 | Bacteria | 2058 |
| 490 | Ga0501036_0054524 | 3300049572 | Bacteria | 3386 |
| 491 | Ga0501036_0220543 | 3300049572 | Bacteria | 1592 |
| 492 | Ga0501037_0000896 | 3300049573 | Bacteria | 22215 |
| 493 | Ga0501038_0001454 | 3300049574 | Bacteria | 21766 |
| 494 | Ga0501038_0029547 | 3300049574 | Bacteria | 4855 |
| 495 | Ga0501038_0125559 | 3300049574 | Bacteria | 2112 |
| 496 | Ga0501039_0024460 | 3300049575 | Bacteria | 4639 |
| 497 | Ga0501039_0041002 | 3300049575 | Bacteria | 3574 |
| 498 | Ga0501039_0068274 | 3300049575 | Bacteria | 2760 |
| 499 | Ga0501039_0075108 | 3300049575 | Bacteria | 2627 |
| 500 | Ga0501039_0206148 | 3300049575 | Unclassified | 1546 |
| 501 | Ga0501040_0029714 | 3300049576 | Bacteria | 3689 |
| 502 | Ga0501040_0162426 | 3300049576 | Bacteria | 1579 |
| 503 | Ga0501041_0020228 | 3300049577 | Bacteria | 3977 |
| 504 | Ga0501041_0040363 | 3300049577 | Bacteria | 2832 |
| 505 | Ga0501042_0016774 | 3300049578 | Bacteria | 5036 |
| 506 | Ga0501042_0048645 | 3300049578 | Bacteria | 3023 |
| 507 | Ga0501042_0057878 | 3300049578 | Bacteria | 2766 |
| 508 | Ga0501042_0410202 | 3300049578 | Bacteria | 982 |
| 509 | Ga0501043_0001315 | 3300049579 | Bacteria | 21712 |
| 510 | Ga0501043_0066247 | 3300049579 | Bacteria | 2836 |
| 511 | Ga0501043_0087187 | 3300049579 | Bacteria | 2453 |
| 512 | Ga0501046_0001583 | 3300049580 | Bacteria | 21765 |
| 513 | Ga0501046_0020434 | 3300049580 | Bacteria | 5476 |
| 514 | Ga0501047_0035520 | 3300049581 | Bacteria | 4815 |
| 515 | Ga0501048_0000914 | 3300049582 | Bacteria | 21758 |
| 516 | Ga0501048_0026831 | 3300049582 | Bacteria | 4192 |
| 517 | Ga0501048_0032516 | 3300049582 | Bacteria | 3769 |
| 518 | Ga0501068_0046321 | 3300049584 | Bacteria | 2622 |
| 519 | Ga0501068_0061344 | 3300049584 | Bacteria | 2285 |
| 520 | Ga0501068_0203089 | 3300049584 | Bacteria | 1257 |
| 521 | Ga0501069_0026586 | 3300049585 | Bacteria | 3169 |
| 522 | Ga0501069_0037660 | 3300049585 | Bacteria | 2669 |
| 523 | Ga0501070_0001344 | 3300049586 | Bacteria | 22000 |
| 524 | Ga0501070_0034184 | 3300049586 | Bacteria | 4252 |
| 525 | Ga0501070_0059040 | 3300049586 | Bacteria | 3180 |
| 526 | Ga0501071_0172196 | 3300049587 | Bacteria | 1620 |
| 527 | Ga0501072_0020240 | 3300049588 | Bacteria | 5154 |
| 528 | Ga0501072_0025046 | 3300049588 | Bacteria | 4645 |
| 529 | Ga0501072_0138433 | 3300049588 | Bacteria | 1941 |
| 530 | Ga0501072_0279931 | 3300049588 | Unclassified | 1327 |
| 531 | Ga0501073_0020432 | 3300049589 | Bacteria | 4776 |
| 532 | Ga0501074_0017639 | 3300049590 | Bacteria | 5185 |
| 533 | Ga0501074_0048576 | 3300049590 | Bacteria | 3065 |
| 534 | Ga0501075_0002912 | 3300049591 | Bacteria | 11484 |
| 535 | Ga0501075_0004099 | 3300049591 | Bacteria | 9846 |
| 536 | Ga0501075_0063182 | 3300049591 | Bacteria | 2791 |
| 537 | Ga0501075_0071487 | 3300049591 | Bacteria | 2623 |
| 538 | Ga0501075_0084059 | 3300049591 | Bacteria | 2410 |
| 539 | Ga0501076_0014421 | 3300049592 | Bacteria | 5952 |
| 540 | Ga0501076_0076893 | 3300049592 | Bacteria | 2677 |
| 541 | Ga0501076_0246996 | 3300049592 | Bacteria | 1460 |
| 542 | Ga0501077_0012254 | 3300049593 | Bacteria | 5369 |
| 543 | Ga0501077_0047966 | 3300049593 | Bacteria | 2713 |
| 544 | Ga0501079_0007813 | 3300049741 | Bacteria | 8098 |
| 545 | Ga0501079_0015854 | 3300049741 | Bacteria | 5758 |
| 546 | Ga0501079_0030879 | 3300049741 | Bacteria | 4117 |
| 547 | Ga0501079_0038916 | 3300049741 | Bacteria | 3667 |
| 548 | Ga0501079_0199900 | 3300049741 | Bacteria | 1561 |
| 549 | Ga0501080_0062484 | 3300049742 | Bacteria | 3466 |
| 550 | Ga0501080_0070687 | 3300049742 | Bacteria | 3246 |
| 551 | Ga0501081_0026645 | 3300049743 | Bacteria | 3899 |
| 552 | Ga0501081_0041862 | 3300049743 | Bacteria | 3139 |
| 553 | Ga0501081_0054710 | 3300049743 | Bacteria | 2757 |
| 554 | Ga0501083_0000952 | 3300049744 | Bacteria | 19139 |
| 555 | Ga0501083_0013734 | 3300049744 | Bacteria | 5664 |
| 556 | Ga0501083_0015580 | 3300049744 | Bacteria | 5322 |
| 557 | Ga0501083_0022693 | 3300049744 | Bacteria | 4354 |
| 558 | Ga0501083_0048421 | 3300049744 | Bacteria | 2869 |
| 559 | Ga0501035_0001491 | 3300049822 | Bacteria | 23985 |
| 560 | Ga0501035_0028283 | 3300049822 | Bacteria | 5118 |
| 561 | Ga0501044_0002295 | 3300049823 | Bacteria | 21790 |
| 562 | Ga0501044_0041785 | 3300049823 | Bacteria | 4772 |
| 563 | Ga0501044_0074043 | 3300049823 | Bacteria | 3461 |
| 564 | Ga0501044_0103861 | 3300049823 | Bacteria | 2856 |
| 565 | Ga0501044_0117853 | 3300049823 | Bacteria | 2658 |
| 566 | Ga0501045_0007862 | 3300049824 | Bacteria | 7422 |
| 567 | nmdc:mga00v17_15439_c2 | 3300050491 | Bacteria | 3074 |
| 568 | nmdc:mga00v17_34999_c1 | 3300050491 | Bacteria | 2986 |
| 569 | nmdc:mga00v17_94333_c1 | 3300050491 | Bacteria | 1883 |
| 570 | nmdc:mga0yw44_2497_c1 | 3300050492 | Bacteria | 7870 |
| 571 | nmdc:mga0yw44_35377_c1 | 3300050492 | Bacteria | 2935 |
| 572 | nmdc:mga0yw44_39381_c1 | 3300050492 | Bacteria | 2802 |
| 573 | nmdc:mga0yw44_48124_c1 | 3300050492 | Bacteria | 2570 |
| 574 | nmdc:mga06z11_134684_c1 | 3300050494 | Bacteria | 1391 |
| 575 | nmdc:mga05p37_107099_c1 | 3300050507 | Bacteria | 3439 |
| 576 | nmdc:mga05p37_118300_c1 | 3300050507 | Bacteria | 3256 |
| 577 | nmdc:mga05p37_33282_c1 | 3300050507 | Bacteria | 6312 |
| 578 | nmdc:mga05p37_49759_c1 | 3300050507 | Bacteria | 5155 |
| 579 | nmdc:mga06r32_49570_c1 | 3300050510 | Bacteria | 4016 |
| 580 | nmdc:mga08y16_10273_c1 | 3300050511 | Bacteria | 9824 |
| 581 | nmdc:mga08y16_28191_c1 | 3300050511 | Bacteria | 5919 |
| 582 | nmdc:mga08y16_300379_c1 | 3300050511 | Bacteria | 1655 |
| 583 | nmdc:mga08y16_60961_c1 | 3300050511 | Bacteria | 3939 |
| 584 | nmdc:mga0rr50_88107_c1 | 3300050513 | Bacteria | 2410 |
| 585 | nmdc:mga0a205_16260_c1 | 3300050515 | Bacteria | 6967 |
| 586 | nmdc:mga0a205_43_c2 | 3300050515 | Bacteria | 18020 |
| 587 | nmdc:mga0a205_54292_c1 | 3300050515 | Bacteria | 3868 |
| 588 | Ga0495601_0000060 | 3300053077 | Bacteria | 60600 |
| 589 | Ga0495601_0011214 | 3300053077 | Bacteria | 5353 |
| 590 | Ga0495601_0062210 | 3300053077 | Bacteria | 2370 |
| 591 | Ga0495601_0110935 | 3300053077 | Bacteria | 1777 |
| 592 | Ga0495612_0000460 | 3300053078 | Bacteria | 16359 |
| 593 | Ga0495612_0001300 | 3300053078 | Bacteria | 10304 |
| 594 | Ga0495612_0010250 | 3300053078 | Bacteria | 3790 |
| 595 | Ga0495612_0062145 | 3300053078 | Bacteria | 1548 |
| 596 | Ga0495655_0000002 | 3300053083 | Bacteria | 312752 |
| 597 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 598 | Ga0495595_0020183 | 3300053084 | Bacteria | 2898 |
| 599 | Ga0495619_0000008 | 3300053085 | Bacteria | 305999 |
| 600 | Ga0495619_0000047 | 3300053085 | Bacteria | 102152 |
| 601 | Ga0495619_0000095 | 3300053085 | Bacteria | 66204 |
| 602 | Ga0495619_0000217 | 3300053085 | Bacteria | 41863 |
| 603 | Ga0495619_0000449 | 3300053085 | Bacteria | 27774 |
| 604 | Ga0495619_0004492 | 3300053085 | Bacteria | 8909 |
| 605 | Ga0495619_0009944 | 3300053085 | Bacteria | 5990 |
| 606 | Ga0495619_0018739 | 3300053085 | Bacteria | 4394 |
| 607 | Ga0500566_0014438 | 3300053094 | Bacteria | 4644 |
| 608 | Ga0500641_0004522 | 3300053096 | Bacteria | 4915 |
| 609 | Ga0500614_001518 | 3300053123 | Bacteria | 5521 |
| 610 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 611 | Ga0500658_0035405 | 3300053134 | Bacteria | 1976 |
| 612 | Ga0501084_0031833 | 3300054114 | Bacteria | 4410 |
| 613 | Ga0501084_0145166 | 3300054114 | Bacteria | 1998 |
| 614 | Ga0501084_0157538 | 3300054114 | Unclassified | 1915 |
| 615 | Ga0501084_0278060 | 3300054114 | Bacteria | 1413 |
| 616 | Ga0501082_0015127 | 3300060353 | Bacteria | 6648 |
| 617 | Ga0501082_0026442 | 3300060353 | Bacteria | 5001 |
| 618 | Ga0501082_0117553 | 3300060353 | Bacteria | 2303 |
| 619 | Ga0530510_0010490 | 3300061734 | Bacteria | 6496 |
| 620 | Ga0495686_0106794 | |||
| 621 | JGI24746J21847_1000448 | |||
| 622 | JGI24740J21852_10005544 | |||
| 623 | JGI24748J21848_1000245 | |||
| 624 | JGI24034J26672_10000228 | |||
| 625 | JGI25406J46586_10013325 | |||
| 626 | JGI25406J46586_10032267 | |||
| 627 | JGI25407J50210_10006700 | |||
| 628 | Ga0070683_100036528 | |||
| 629 | Ga0070683_100040913 | |||
| 630 | Ga0070683_100064408 | |||
| 631 | Ga0070683_100080858 | |||
| 632 | Ga0070683_100095602 | |||
| 633 | Ga0070683_100317814 | |||
| 634 | Ga0070670_100234617 | |||
| 635 | Ga0070666_10100829 | |||
| 636 | Ga0070682_100000075 | |||
| 637 | Ga0070682_100000090 | |||
| 638 | Ga0070682_100029118 | |||
| 639 | Ga0068868_100002263 | |||
| 640 | Ga0068868_100058291 | |||
| 641 | Ga0070660_100130062 | |||
| 642 | Ga0070660_100214557 | |||
| 643 | Ga0070691_10000044 | |||
| 644 | Ga0070661_100000099 | |||
| 645 | Ga0070668_100007577 | |||
| 646 | Ga0070669_100141018 | |||
| 647 | Ga0070675_100000106 | |||
| 648 | Ga0070674_100000012 | |||
| 649 | Ga0070674_100000023 | |||
| 650 | Ga0070674_100038302 | |||
| 651 | Ga0070673_100086078 | |||
| 652 | Ga0070688_100221513 | |||
| 653 | Ga0070659_100002550 | |||
| 654 | Ga0070714_100097160 | |||
| 655 | Ga0070713_100000010 | |||
| 656 | Ga0070701_10146866 | |||
| 657 | Ga0070711_100000890 | |||
| 658 | Ga0070711_100023878 | |||
| 659 | Ga0070711_100111315 | |||
| 660 | Ga0070705_100045395 | |||
| 661 | Ga0070700_100083955 | |||
| 662 | Ga0070700_100121439 | |||
| 663 | Ga0070663_100003155 | |||
| 664 | Ga0070678_100011298 | |||
| 665 | Ga0070678_100027118 | |||
| 666 | Ga0070678_100289797 | |||
| 667 | Ga0070662_100000002 | |||
| 668 | Ga0070662_100151860 | |||
| 669 | Ga0070681_10056165 | |||
| 670 | Ga0070681_10285857 | |||
| 671 | Ga0068867_100023529 | |||
| 672 | Ga0070685_10001018 | |||
| 673 | Ga0070685_10003345 | |||
| 674 | Ga0070685_10042491 | |||
| 675 | Ga0070679_100000369 | |||
| 676 | Ga0070684_100020599 | |||
| 677 | Ga0070684_100025738 | |||
| 678 | Ga0070684_100085055 | |||
| 679 | Ga0070684_100110427 | |||
| 680 | Ga0068853_100064522 | |||
| 681 | Ga0070672_100000001 | |||
| 682 | Ga0070695_100031572 | |||
| 683 | Ga0070696_100093886 | |||
| 684 | Ga0070693_100000341 | |||
| 685 | Ga0070665_100000135 | |||
| 686 | Ga0070665_100041372 | |||
| 687 | Ga0070665_100058089 | |||
| 688 | Ga0070665_100180821 | |||
| 689 | Ga0070704_100015164 | |||
| 690 | Ga0070704_100209650 | |||
| 691 | Ga0068855_100134528 | |||
| 692 | Ga0068855_100296368 | |||
| 693 | Ga0068855_100504142 | |||
| 694 | Ga0068854_100000947 | |||
| 695 | Ga0068856_100036208 | |||
| 696 | Ga0068856_100039424 | |||
| 697 | Ga0070702_100104151 | |||
| 698 | Ga0070702_100117582 | |||
| 699 | Ga0068852_100001985 | |||
| 700 | Ga0068866_10000008 | |||
| 701 | Ga0068866_10000460 | |||
| 702 | Ga0068851_10003096 | |||
| 703 | Ga0068863_100000022 | |||
| 704 | Ga0068863_100084455 | |||
| 705 | Ga0068863_100312012 | |||
| 706 | Ga0068858_100000075 | |||
| 707 | Ga0068858_100003213 | |||
| 708 | Ga0068860_100010748 | |||
| 709 | Ga0068860_100237194 | |||
| 710 | Ga0068862_100001298 | |||
| 711 | Ga0081455_10020241 | |||
| 712 | Ga0081455_10025411 | |||
| 713 | Ga0081455_10026546 | |||
| 714 | Ga0081455_10052960 | |||
| 715 | Ga0081538_10000141 | |||
| 716 | Ga0081538_10000568 | |||
| 717 | Ga0081538_10005974 | |||
| 718 | Ga0081538_10023885 | |||
| 719 | Ga0081540_1002030 | |||
| 720 | Ga0081539_10000878 | |||
| 721 | Ga0081539_10001538 | |||
| 722 | Ga0081539_10009688 | |||
| 723 | Ga0081539_10017083 | |||
| 724 | Ga0075365_10000294 | |||
| 725 | Ga0075365_10005137 | |||
| 726 | Ga0075365_10012358 | |||
| 727 | Ga0075365_10079359 | |||
| 728 | Ga0075365_10085997 | |||
| 729 | Ga0075365_10208054 | |||
| 730 | Ga0075363_100124535 | |||
| 731 | Ga0075364_10085022 | |||
| 732 | Ga0075364_10149550 | |||
| 733 | Ga0075364_10156480 | |||
| 734 | Ga0075364_10183983 | |||
| 735 | Ga0070715_10000021 | |||
| 736 | Ga0070712_100015682 | |||
| 737 | Ga0075367_10120948 | |||
| 738 | Ga0075367_10207860 | |||
| 739 | Ga0075370_10043043 | |||
| 740 | Ga0075428_100168049 | |||
| 741 | Ga0075428_100197425 | |||
| 742 | Ga0075428_100197815 | |||
| 743 | Ga0075430_100171108 | |||
| 744 | Ga0075431_100000083 | |||
| 745 | Ga0075431_100059091 | |||
| 746 | Ga0075433_10026103 | |||
| 747 | Ga0075433_10036301 | |||
| 748 | Ga0075433_10312881 | |||
| 749 | Ga0075434_100066000 | |||
| 750 | Ga0068865_100000490 | |||
| 751 | Ga0075436_100135286 | |||
| 752 | Ga0075435_100121727 | |||
| 753 | Ga0111539_10011397 | |||
| 754 | Ga0111539_10092497 | |||
| 755 | Ga0105245_10000278 | |||
| 756 | Ga0105245_10000415 | |||
| 757 | Ga0105245_10010216 | |||
| 758 | Ga0105245_10236811 | |||
| 759 | Ga0105245_10507824 | |||
| 760 | Ga0105247_10000305 | |||
| 761 | Ga0114129_10011162 | |||
| 762 | Ga0114129_10038150 | |||
| 763 | Ga0114129_10069445 | |||
| 764 | Ga0114129_10376262 | |||
| 765 | Ga0114129_10555439 | |||
| 766 | Ga0105243_10038717 | |||
| 767 | Ga0105242_10000603 | |||
| 768 | Ga0105242_10003748 | |||
| 769 | Ga0105248_10000020 | |||
| 770 | Ga0105238_10000055 | |||
| 771 | Ga0105238_10451435 | |||
| 772 | Ga0105249_10000143 | |||
| 773 | Ga0105249_10023295 | |||
| 774 | Ga0105249_10068962 | |||
| 775 | Ga0105249_10093858 | |||
| 776 | Ga0105249_10207509 | |||
| 777 | Ga0105239_10101908 | |||
| 778 | Ga0105239_10220543 | |||
| 779 | Ga0105246_10165684 | |||
| 780 | Ga0105246_10223048 | |||
| 781 | Ga0157370_10018133 | |||
| 782 | Ga0157370_10056831 | |||
| 783 | Ga0157370_10102427 | |||
| 784 | Ga0157369_10000074 | |||
| 785 | Ga0157374_10012359 | |||
| 786 | Ga0157378_10005561 | |||
| 787 | Ga0157378_10079154 | |||
| 788 | Ga0157372_10026046 | |||
| 789 | Ga0157375_10009814 | |||
| 790 | Ga0157375_10053210 | |||
| 791 | Ga0163163_10041962 | |||
| 792 | Ga0163163_10087466 | |||
| 793 | Ga0157380_10000016 | |||
| 794 | Ga0157379_10317483 | |||
| 795 | Ga0157376_10379074 | |||
| 796 | Ga0163161_10000053 | |||
| 797 | Ga0163161_10026609 | |||
| 798 | Ga0206356_10481544 | |||
| 799 | Ga0206350_11586870 | |||
| 800 | Ga0207656_10000570 | |||
| 801 | Ga0207682_10000091 | |||
| 802 | Ga0207642_10000002 | |||
| 803 | Ga0207642_10000275 | |||
| 804 | Ga0207642_10125725 | |||
| 805 | Ga0207710_10000157 | |||
| 806 | Ga0207688_10032696 | |||
| 807 | Ga0207680_10024183 | |||
| 808 | Ga0207685_10000028 | |||
| 809 | Ga0207707_10031693 | |||
| 810 | Ga0207693_10001086 | |||
| 811 | Ga0207693_10095615 | |||
| 812 | Ga0207693_10334952 | |||
| 813 | Ga0207663_10000409 | |||
| 814 | Ga0207657_10168337 | |||
| 815 | Ga0207649_10000127 | |||
| 816 | Ga0207652_10000321 | |||
| 817 | Ga0207681_10119746 | |||
| 818 | Ga0207694_10000063 | |||
| 819 | Ga0207650_10080137 | |||
| 820 | Ga0207659_10000013 | |||
| 821 | Ga0207687_10000032 | |||
| 822 | Ga0207687_10000036 | |||
| 823 | Ga0207687_10157963 | |||
| 824 | Ga0207687_10233901 | |||
| 825 | Ga0207700_10000007 | |||
| 826 | Ga0207664_10075797 | |||
| 827 | Ga0207664_10083242 | |||
| 828 | Ga0207690_10007226 | |||
| 829 | Ga0207690_10031841 | |||
| 830 | Ga0207706_10000001 | |||
| 831 | Ga0207706_10018417 | |||
| 832 | Ga0207706_10062147 | |||
| 833 | Ga0207686_10000097 | |||
| 834 | Ga0207686_10000411 | |||
| 835 | Ga0207669_10000017 | |||
| 836 | Ga0207669_10000026 | |||
| 837 | Ga0207669_10074675 | |||
| 838 | Ga0207704_10000805 | |||
| 839 | Ga0207665_10074954 | |||
| 840 | Ga0207691_10000747 | |||
| 841 | Ga0207711_10000006 | |||
| 842 | Ga0207689_10072097 | |||
| 843 | Ga0207661_10005476 | |||
| 844 | Ga0207661_10008364 | |||
| 845 | Ga0207661_10009986 | |||
| 846 | Ga0207661_10013674 | |||
| 847 | Ga0207661_10118210 | |||
| 848 | Ga0207661_10441613 | |||
| 849 | Ga0207661_10539049 | |||
| 850 | Ga0207667_10306651 | |||
| 851 | Ga0207667_10491257 | |||
| 852 | Ga0207651_10000448 | |||
| 853 | Ga0207712_10000058 | |||
| 854 | Ga0207712_10016807 | |||
| 855 | Ga0207668_10016755 | |||
| 856 | Ga0207668_10113662 | |||
| 857 | Ga0207658_10011985 | |||
| 858 | Ga0207677_10000284 | |||
| 859 | Ga0207677_10001254 | |||
| 860 | Ga0207703_10000088 | |||
| 861 | Ga0207703_10000287 | |||
| 862 | Ga0207703_10044258 | |||
| 863 | Ga0207639_10014925 | |||
| 864 | Ga0207639_10172698 | |||
| 865 | Ga0207678_10001743 | |||
| 866 | Ga0207708_10031466 | |||
| 867 | Ga0207708_10042963 | |||
| 868 | Ga0207702_10007528 | |||
| 869 | Ga0207641_10000016 | |||
| 870 | Ga0207641_10030625 | |||
| 871 | Ga0207641_10345463 | |||
| 872 | Ga0207648_10004310 | |||
| 873 | Ga0207676_10000018 | |||
| 874 | Ga0207683_10019197 | |||
| 875 | Ga0207683_10130162 | |||
| 876 | Ga0207698_10000004 | |||
| 877 | Ga0207698_10133239 | |||
| 878 | Ga0207428_10030572 | |||
| 879 | Ga0207428_10206806 | |||
| 880 | Ga0207428_10210921 | |||
| 881 | Ga0207428_10211897 | |||
| 882 | Ga0268266_10000056 | |||
| 883 | Ga0268266_10000674 | |||
| 884 | Ga0268266_10015138 | |||
| 885 | Ga0268266_10015515 | |||
| 886 | Ga0268266_10109390 | |||
| 887 | Ga0268265_10014206 | |||
| 888 | Ga0268264_10009842 | |||
| 889 | Ga0265337_1000066 | |||
| 890 | Ga0265326_10000258 | |||
| 891 | Ga0265319_1000317 | |||
| 892 | Ga0265322_10000011 | |||
| 893 | Ga0265336_10010612 | |||
| 894 | Ga0265338_10007586 | |||
| 895 | Ga0265324_10001593 | |||
| 896 | Ga0265324_10033605 | |||
| 897 | Ga0265320_10000011 | |||
| 898 | Ga0265325_10025131 | |||
| 899 | Ga0265329_10023150 | |||
| 900 | Ga0265331_10011614 | |||
| 901 | Ga0265327_10000015 | |||
| 902 | Ga0265314_10000640 | |||
| 903 | Ga0307410_10024605 | |||
| 904 | Ga0307407_10010761 | |||
| 905 | Ga0307409_100051835 | |||
| 906 | Ga0307409_100141048 | |||
| 907 | Ga0307416_100024159 | |||
| 908 | Ga0307414_10048032 | |||
| 909 | Ga0307411_10210341 | |||
| 910 | Ga0307415_100002308 | |||
| 911 | Ga0307415_100011517 | |||
| 912 | Ga0373943_0112414 | |||
| 913 | Ga0316574_0021795 | |||
| 914 | Ga0316574_0046989 | |||
| 915 | Ga0373937_0004956 | |||
| 916 | Ga0373937_0030944 | |||
| 917 | Ga0316584_0007137 | |||
| 918 | Ga0395900_0009556 | |||
| 919 | Ga0395900_0079423 | |||
| 920 | Ga0395900_0160915 | |||
| 921 | Ga0395900_0164594 | |||
| 922 | Ga0395900_0225955 | |||
| 923 | Ga0395898_0002264 | |||
| 924 | Ga0395898_0008352 | |||
| 925 | Ga0395898_0010733 | |||
| 926 | Ga0395898_0076418 | |||
| 927 | Ga0395905_0036048 | |||
| 928 | Ga0395905_0071067 | |||
| 929 | Ga0395905_0194885 | |||
| 930 | Ga0395901_0008042 | |||
| 931 | Ga0395901_0017662 | |||
| 932 | Ga0395901_0073322 | |||
| 933 | Ga0395901_0207232 | |||
| 934 | Ga0451853_0614736 | |||
| 935 | Ga0451853_2510563 | |||
| 936 | Ga0450920_004565 | |||
| 937 | Ga0466963_0000017 | |||
| 938 | Ga0466963_0021887 | |||
| 939 | Ga0466967_0000001 | |||
| 940 | Ga0495592_0000261 | |||
| 941 | Ga0495603_0000098 | |||
| 942 | Ga0495603_0012212 | |||
| 943 | Ga0495629_0002184 | |||
| 944 | Ga0495629_0020308 | |||
| 945 | Ga0495629_0108082 | |||
| 946 | Ga0495629_0123573 | |||
| 947 | Ga0495641_0000312 | |||
| 948 | Ga0495641_0020331 | |||
| 949 | Ga0495641_0021579 | |||
| 950 | Ga0495653_0016285 | |||
| 951 | Ga0495582_0000001 | |||
| 952 | Ga0495639_0012010 | |||
| 953 | Ga0495662_0003997 | |||
| 954 | Ga0495662_0098696 | |||
| 955 | Ga0495594_0000030 | |||
| 956 | Ga0495594_0102028 | |||
| 957 | Ga0495596_0028153 | |||
| 958 | Ga0495606_0000040 | |||
| 959 | Ga0495608_0000007 | |||
| 960 | Ga0495608_0001909 | |||
| 961 | Ga0495608_0007743 | |||
| 962 | Ga0495608_0009516 | |||
| 963 | Ga0495618_0000014 | |||
| 964 | Ga0495620_0000139 | |||
| 965 | Ga0495628_0000679 | |||
| 966 | Ga0495628_0020312 | |||
| 967 | Ga0495628_0068421 | |||
| 968 | Ga0495628_0130454 | |||
| 969 | Ga0495630_0000014 | |||
| 970 | Ga0495630_0002438 | |||
| 971 | Ga0495630_0060815 | |||
| 972 | Ga0495652_0000037 | |||
| 973 | Ga0495652_0020278 | |||
| 974 | Ga0495640_0019044 | |||
| 975 | Ga0495640_0089749 | |||
| 976 | Ga0495587_0011600 | |||
| 977 | Ga0495645_0122413 | |||
| 978 | Ga0495622_0000080 | |||
| 979 | Ga0495667_0000020 | |||
| 980 | Ga0495634_0000028 | |||
| 981 | Ga0495634_0000293 | |||
| 982 | Ga0495634_0014587 | |||
| 983 | Ga0495634_0092022 | |||
| 984 | Ga0495625_0000409 | |||
| 985 | Ga0495635_0000076 | |||
| 986 | Ga0495635_0020283 | |||
| 987 | Ga0495635_0032802 | |||
| 988 | Ga0495588_0000387 | |||
| 989 | Ga0495657_0000001 | |||
| 990 | Ga0495657_0062206 | |||
| 991 | Ga0495599_0053095 | |||
| 992 | Ga0495647_0000001 | |||
| 993 | Ga0495647_0002409 | |||
| 994 | Ga0495647_0009033 | |||
| 995 | Ga0495658_0000002 | |||
| 996 | Ga0495658_0023776 | |||
| 997 | Ga0495669_0000113 | |||
| 998 | Ga0495669_0018751 | |||
| 999 | Ga0495613_0000005 | |||
| 1000 | Ga0495613_0000041 | |||
| 1001 | Ga0495613_0077294 | |||
| 1002 | Ga0495624_0001423 | |||
| 1003 | Ga0495624_0002990 | |||
| 1004 | Ga0495624_0018966 | |||
| 1005 | Ga0495670_0008755 | |||
| 1006 | Ga0495649_0003735 | |||
| 1007 | Ga0495600_0004414 | |||
| 1008 | Ga0495600_0010082 | |||
| 1009 | Ga0495604_0000050 | |||
| 1010 | Ga0495604_0000704 | |||
| 1011 | Ga0495604_0038729 | |||
| 1012 | Ga0495674_0000030 | |||
| 1013 | Ga0495676_0000621 | |||
| 1014 | Ga0495676_0001246 | |||
| 1015 | Ga0495676_0045210 | |||
| 1016 | Ga0495680_0001593 | |||
| 1017 | Ga0495680_0006381 | |||
| 1018 | Ga0495680_0021812 | |||
| 1019 | Ga0495675_0000055 | |||
| 1020 | Ga0495686_0101244 | |||
| 1021 | Ga0495602_0000007 | |||
| 1022 | Ga0495602_0014028 | |||
| 1023 | Ga0495614_0110026 | |||
| 1024 | Ga0496100_0000001 | |||
| 1025 | Ga0496100_0000013 | |||
| 1026 | Ga0496100_0071231 | |||
| 1027 | Ga0496101_0000004 | |||
| 1028 | Ga0496101_0000035 | |||
| 1029 | Ga0496102_0000211 | |||
| 1030 | Ga0496102_0000677 | |||
| 1031 | Ga0496102_0075759 | |||
| 1032 | Ga0496102_0392057 | |||
| 1033 | Ga0496103_0000083 | |||
| 1034 | Ga0496103_0009864 | |||
| 1035 | Ga0496103_0067891 | |||
| 1036 | Ga0496104_0000015 | |||
| 1037 | Ga0496104_0000052 | |||
| 1038 | Ga0496104_0017109 | |||
| 1039 | Ga0496104_0033938 | |||
| 1040 | Ga0496104_0090092 | |||
| 1041 | Ga0496105_0000004 | |||
| 1042 | Ga0496105_0000030 | |||
| 1043 | Ga0496105_0024185 | |||
| 1044 | Ga0496106_0000076 | |||
| 1045 | Ga0496106_0000121 | |||
| 1046 | Ga0496106_0000959 | |||
| 1047 | Ga0496106_0028359 | |||
| 1048 | Ga0496107_0000005 | |||
| 1049 | Ga0496107_0000020 | |||
| 1050 | Ga0496107_0034539 | |||
| 1051 | Ga0496107_0183247 | |||
| 1052 | Ga0496108_0000006 | |||
| 1053 | Ga0496108_0000063 | |||
| 1054 | Ga0496108_0000550 | |||
| 1055 | Ga0496108_0000741 | |||
| 1056 | Ga0496108_0025733 | |||
| 1057 | Ga0496108_0239912 | |||
| 1058 | Ga0496109_0000009 | |||
| 1059 | Ga0496109_0000088 | |||
| 1060 | Ga0496109_0000174 | |||
| 1061 | Ga0496109_0000261 | |||
| 1062 | Ga0496109_0023152 | |||
| 1063 | Ga0496109_0069535 | |||
| 1064 | Ga0496110_0000038 | |||
| 1065 | Ga0496110_0016143 | |||
| 1066 | Ga0496110_0094797 | |||
| 1067 | Ga0496110_0095699 | |||
| 1068 | Ga0496110_0297422 | |||
| 1069 | Ga0496111_0000192 | |||
| 1070 | Ga0496111_0017591 | |||
| 1071 | Ga0496111_0052767 | |||
| 1072 | Ga0496111_0053722 | |||
| 1073 | Ga0496112_0000025 | |||
| 1074 | Ga0496112_0002961 | |||
| 1075 | Ga0496113_0000013 | |||
| 1076 | Ga0496113_0021043 | |||
| 1077 | Ga0496113_0087265 | |||
| 1078 | Ga0496113_0123981 | |||
| 1079 | Ga0496113_0194826 | |||
| 1080 | Ga0496114_0024870 | |||
| 1081 | Ga0496115_0000011 | |||
| 1082 | Ga0496115_0000659 | |||
| 1083 | Ga0496115_0015153 | |||
| 1084 | Ga0496115_0057322 | |||
| 1085 | Ga0496117_0003638 | |||
| 1086 | Ga0496118_0002918 | |||
| 1087 | Ga0496118_0122903 | |||
| 1088 | Ga0496119_0011049 | |||
| 1089 | Ga0496119_0012933 | |||
| 1090 | Ga0496119_0014174 | |||
| 1091 | Ga0496120_0006622 | |||
| 1092 | Ga0496121_0006140 | |||
| 1093 | Ga0496121_0027272 | |||
| 1094 | Ga0496124_0032916 | |||
| 1095 | Ga0496125_0076385 | |||
| 1096 | Ga0496126_0106992 | |||
| 1097 | Ga0501031_0000558 | |||
| 1098 | Ga0501031_0038615 | |||
| 1099 | Ga0501031_0149043 | |||
| 1100 | Ga0501032_0001109 | |||
| 1101 | Ga0501032_0042985 | |||
| 1102 | Ga0501032_0119734 | |||
| 1103 | Ga0501033_0001357 | |||
| 1104 | Ga0501033_0187683 | |||
| 1105 | Ga0501034_0001826 | |||
| 1106 | Ga0501034_0016651 | |||
| 1107 | Ga0501034_0116104 | |||
| 1108 | Ga0501034_0183278 | |||
| 1109 | Ga0501036_0054524 | |||
| 1110 | Ga0501036_0220543 | |||
| 1111 | Ga0501037_0000896 | |||
| 1112 | Ga0501038_0001454 | |||
| 1113 | Ga0501038_0029547 | |||
| 1114 | Ga0501038_0125559 | |||
| 1115 | Ga0501039_0024460 | |||
| 1116 | Ga0501039_0041002 | |||
| 1117 | Ga0501039_0068274 | |||
| 1118 | Ga0501039_0075108 | |||
| 1119 | Ga0501039_0206148 | |||
| 1120 | Ga0501040_0029714 | |||
| 1121 | Ga0501040_0162426 | |||
| 1122 | Ga0501041_0020228 | |||
| 1123 | Ga0501041_0040363 | |||
| 1124 | Ga0501042_0016774 | |||
| 1125 | Ga0501042_0048645 | |||
| 1126 | Ga0501042_0057878 | |||
| 1127 | Ga0501042_0410202 | |||
| 1128 | Ga0501043_0001315 | |||
| 1129 | Ga0501043_0066247 | |||
| 1130 | Ga0501043_0087187 | |||
| 1131 | Ga0501046_0001583 | |||
| 1132 | Ga0501046_0020434 | |||
| 1133 | Ga0501047_0035520 | |||
| 1134 | Ga0501048_0000914 | |||
| 1135 | Ga0501048_0026831 | |||
| 1136 | Ga0501048_0032516 | |||
| 1137 | Ga0501068_0046321 | |||
| 1138 | Ga0501068_0061344 | |||
| 1139 | Ga0501068_0203089 | |||
| 1140 | Ga0501069_0026586 | |||
| 1141 | Ga0501069_0037660 | |||
| 1142 | Ga0501070_0001344 | |||
| 1143 | Ga0501070_0034184 | |||
| 1144 | Ga0501070_0059040 | |||
| 1145 | Ga0501071_0172196 | |||
| 1146 | Ga0501072_0020240 | |||
| 1147 | Ga0501072_0025046 | |||
| 1148 | Ga0501072_0138433 | |||
| 1149 | Ga0501072_0279931 | |||
| 1150 | Ga0501073_0020432 | |||
| 1151 | Ga0501074_0017639 | |||
| 1152 | Ga0501074_0048576 | |||
| 1153 | Ga0501075_0002912 | |||
| 1154 | Ga0501075_0004099 | |||
| 1155 | Ga0501075_0063182 | |||
| 1156 | Ga0501075_0071487 | |||
| 1157 | Ga0501075_0084059 | |||
| 1158 | Ga0501076_0014421 | |||
| 1159 | Ga0501076_0076893 | |||
| 1160 | Ga0501076_0246996 | |||
| 1161 | Ga0501077_0012254 | |||
| 1162 | Ga0501077_0047966 | |||
| 1163 | Ga0501079_0007813 | |||
| 1164 | Ga0501079_0015854 | |||
| 1165 | Ga0501079_0030879 | |||
| 1166 | Ga0501079_0038916 | |||
| 1167 | Ga0501079_0199900 | |||
| 1168 | Ga0501080_0062484 | |||
| 1169 | Ga0501080_0070687 | |||
| 1170 | Ga0501081_0026645 | |||
| 1171 | Ga0501081_0041862 | |||
| 1172 | Ga0501081_0054710 | |||
| 1173 | Ga0501083_0000952 | |||
| 1174 | Ga0501083_0013734 | |||
| 1175 | Ga0501083_0015580 | |||
| 1176 | Ga0501083_0022693 | |||
| 1177 | Ga0501083_0048421 | |||
| 1178 | Ga0501035_0001491 | |||
| 1179 | Ga0501035_0028283 | |||
| 1180 | Ga0501044_0002295 | |||
| 1181 | Ga0501044_0041785 | |||
| 1182 | Ga0501044_0074043 | |||
| 1183 | Ga0501044_0103861 | |||
| 1184 | Ga0501044_0117853 | |||
| 1185 | Ga0501045_0007862 | |||
| 1186 | nmdc:mga00v17_15439_c2 | |||
| 1187 | nmdc:mga00v17_34999_c1 | |||
| 1188 | nmdc:mga00v17_94333_c1 | |||
| 1189 | nmdc:mga0yw44_2497_c1 | |||
| 1190 | nmdc:mga0yw44_35377_c1 | |||
| 1191 | nmdc:mga0yw44_39381_c1 | |||
| 1192 | nmdc:mga0yw44_48124_c1 | |||
| 1193 | nmdc:mga06z11_134684_c1 | |||
| 1194 | nmdc:mga05p37_107099_c1 | |||
| 1195 | nmdc:mga05p37_118300_c1 | |||
| 1196 | nmdc:mga05p37_33282_c1 | |||
| 1197 | nmdc:mga05p37_49759_c1 | |||
| 1198 | nmdc:mga06r32_49570_c1 | |||
| 1199 | nmdc:mga08y16_10273_c1 | |||
| 1200 | nmdc:mga08y16_28191_c1 | |||
| 1201 | nmdc:mga08y16_300379_c1 | |||
| 1202 | nmdc:mga08y16_60961_c1 | |||
| 1203 | nmdc:mga0rr50_88107_c1 | |||
| 1204 | nmdc:mga0a205_16260_c1 | |||
| 1205 | nmdc:mga0a205_43_c2 | |||
| 1206 | nmdc:mga0a205_54292_c1 | |||
| 1207 | Ga0495601_0000060 | |||
| 1208 | Ga0495601_0011214 | |||
| 1209 | Ga0495601_0062210 | |||
| 1210 | Ga0495601_0110935 | |||
| 1211 | Ga0495612_0000460 | |||
| 1212 | Ga0495612_0001300 | |||
| 1213 | Ga0495612_0010250 | |||
| 1214 | Ga0495612_0062145 | |||
| 1215 | Ga0495655_0000002 | |||
| 1216 | Ga0495595_0000002 | |||
| 1217 | Ga0495595_0020183 | |||
| 1218 | Ga0495619_0000008 | |||
| 1219 | Ga0495619_0000047 | |||
| 1220 | Ga0495619_0000095 | |||
| 1221 | Ga0495619_0000217 | |||
| 1222 | Ga0495619_0000449 | |||
| 1223 | Ga0495619_0004492 | |||
| 1224 | Ga0495619_0009944 | |||
| 1225 | Ga0495619_0018739 | |||
| 1226 | Ga0500566_0014438 | |||
| 1227 | Ga0500641_0004522 | |||
| 1228 | Ga0500614_001518 | |||
| 1229 | Ga0500628_000001 | |||
| 1230 | Ga0500658_0035405 | |||
| 1231 | Ga0501084_0031833 | |||
| 1232 | Ga0501084_0145166 | |||
| 1233 | Ga0501084_0157538 | |||
| 1234 | Ga0501084_0278060 | |||
| 1235 | Ga0501082_0015127 | |||
| 1236 | Ga0501082_0026442 | |||
| 1237 | Ga0501082_0117553 | |||
| 1238 | Ga0530510_0010490 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5o25-assembly1.cif.gz_A | structure of wildtype t.maritima pde (tm1595) in ligand-free state | 0.9243 | 11 | 331 |
| 5o25-assembly1.cif.gz_A | structure of wildtype t.maritima pde (tm1595) in ligand-free state | 0.9078 | 11 | 331 |
| 5jju-assembly1.cif.gz_B | crystal structure of rv2837c complexed with 5'-papa and 5'-amp | 0.9045 | 11 | 334 |
| 5jju-assembly1.cif.gz_B | crystal structure of rv2837c complexed with 5'-papa and 5'-amp | 0.886 | 11 | 334 |
| 1sw5-assembly4.cif.gz_D | crystal structure of prox from archeoglobus fulgidus in the ligand free form | 0.8828 | 23 | 57 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXM3_201_313_3.10.310.30 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.9117 | 214 | 329 | 3.10.310.30 |
| 4py9A02 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.8943 | 210 | 330 | 3.10.310.30 |
| 4ls9B01 | Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core);inorganic pyrophosphatase (n-terminal core) | 0.8942 | 16 | 203 | 3.90.1640.10 |
| 5ippA02 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.8838 | 214 | 331 | 3.10.310.30 |
| af_Q2FXM3_201_313_3.10.310.30 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.8743 | 214 | 329 | 3.10.310.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X9GBH0-F1-model_v4 | Bifunctional oligoribonuclease/PAP phosphatase NrnA | 0.9545 | 208 | 332 |
GO:0003676
|
| AF-K1YU68-F1-model_v4 | DDH domain-containing protein | 0.9474 | 11 | 299 |
|
| AF-A0A1V5JR62-F1-model_v4 | Bifunctional oligoribonuclease and PAP phosphatase NrnA (EC 3.1.-.-) | 0.9474 | 210 | 331 |
GO:0003676
GO:0016787 |
| AF-A0A3A0G8D8-F1-model_v4 | Bifunctional oligoribonuclease/PAP phosphatase NrnA | 0.9437 | 118 | 330 |
GO:0003676
|
| AF-A0A7X9GBH0-F1-model_v4 | Bifunctional oligoribonuclease/PAP phosphatase NrnA | 0.9395 | 208 | 332 |
GO:0003676
|