F469852

General Info

Members Datasets Scaffolds Average Seq Length
619 299 1238 331

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0106794|Ga0495686_0106794_511_1569
Length 346
Sequence MTEITTTSAAEVAAETAEFSAANGTVGSDFERMIEEIRSHDRFLLTAHEGPDGDALGSLLGMHHLLNKLGKDSVMFLAAKEFPLPIEYRFLPLENVFHEAPADMADRVIMFLDCGNIDRMPVPFLTEGENRRLNIDHHHDNTRFGDVNLVAPRASCTAEIVYDIAHVLGVPIDAEMAMPLYVGLITDTGKFMYENTNAHTHRVAAELIDAGVSVDDTYRRLYEHVPIEKLRLVARALDGIQISCGGRLAISYITAEDYAATGSGEEMTEGVIDHLRSIDGIKVAAVIRDLGNRGRAARKASLRSSEGDVDVSAIARKQGAAGFSTDDDLPALVEFLCGEVTAQLGD

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
149 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
152 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
155 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
288 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
289 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
293 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
294 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
295 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
296 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.36
Nodule 0
Rhizoplane 9.85
Rhizosphere 83.52
Stem 0
Stem Tuber 0
Unclassified 1.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0106794 3300047472 Bacteria 1683
2 JGI24746J21847_1000448 3300001977 Bacteria 6156
3 JGI24740J21852_10005544 3300001979 Bacteria 5318
4 JGI24748J21848_1000245 3300002074 Bacteria 6465
5 JGI24034J26672_10000228 3300002239 Bacteria 7405
6 JGI25406J46586_10013325 3300003203 Bacteria 3536
7 JGI25406J46586_10032267 3300003203 Bacteria 1947
8 JGI25407J50210_10006700 3300003373 Bacteria 2875
9 Ga0070683_100036528 3300005329 Bacteria 4496
10 Ga0070683_100040913 3300005329 Bacteria 4262
11 Ga0070683_100064408 3300005329 Bacteria 3412
12 Ga0070683_100080858 3300005329 Bacteria 3042
13 Ga0070683_100095602 3300005329 Bacteria 2794
14 Ga0070683_100317814 3300005329 Bacteria 1482
15 Ga0070670_100234617 3300005331 Bacteria 1597
16 Ga0070666_10100829 3300005335 Bacteria 1990
17 Ga0070682_100000075 3300005337 Bacteria 90547
18 Ga0070682_100000090 3300005337 Bacteria 82642
19 Ga0070682_100029118 3300005337 Bacteria 3324
20 Ga0068868_100002263 3300005338 Bacteria 13307
21 Ga0068868_100058291 3300005338 Bacteria 3052
22 Ga0070660_100130062 3300005339 Bacteria 2014
23 Ga0070660_100214557 3300005339 Bacteria 1563
24 Ga0070691_10000044 3300005341 Bacteria 36029
25 Ga0070661_100000099 3300005344 Bacteria 71115
26 Ga0070668_100007577 3300005347 Bacteria 8057
27 Ga0070669_100141018 3300005353 Bacteria 1858
28 Ga0070675_100000106 3300005354 Bacteria 49336
29 Ga0070674_100000012 3300005356 Bacteria 130773
30 Ga0070674_100000023 3300005356 Bacteria 84887
31 Ga0070674_100038302 3300005356 Bacteria 3230
32 Ga0070673_100086078 3300005364 Bacteria 2560
33 Ga0070688_100221513 3300005365 Bacteria 1333
34 Ga0070659_100002550 3300005366 Bacteria 12957
35 Ga0070714_100097160 3300005435 Bacteria 2589
36 Ga0070713_100000010 3300005436 Bacteria 151790
37 Ga0070701_10146866 3300005438 Bacteria 1354
38 Ga0070711_100000890 3300005439 Bacteria 15699
39 Ga0070711_100023878 3300005439 Bacteria 3982
40 Ga0070711_100111315 3300005439 Bacteria 2010
41 Ga0070705_100045395 3300005440 Bacteria 2528
42 Ga0070700_100083955 3300005441 Unclassified 2063
43 Ga0070700_100121439 3300005441 Bacteria 1751
44 Ga0070663_100003155 3300005455 Bacteria 9451
45 Ga0070678_100011298 3300005456 Bacteria 5502
46 Ga0070678_100027118 3300005456 Bacteria 3885
47 Ga0070678_100289797 3300005456 Unclassified 1387
48 Ga0070662_100000002 3300005457 Bacteria 253208
49 Ga0070662_100151860 3300005457 Bacteria 1804
50 Ga0070681_10056165 3300005458 Bacteria 3919
51 Ga0070681_10285857 3300005458 Bacteria 1560
52 Ga0068867_100023529 3300005459 Bacteria 4410
53 Ga0070685_10001018 3300005466 Bacteria 15078
54 Ga0070685_10003345 3300005466 Bacteria 8161
55 Ga0070685_10042491 3300005466 Bacteria 2594
56 Ga0070679_100000369 3300005530 Bacteria 38264
57 Ga0070684_100020599 3300005535 Bacteria 5469
58 Ga0070684_100025738 3300005535 Bacteria 4948
59 Ga0070684_100085055 3300005535 Bacteria 2805
60 Ga0070684_100110427 3300005535 Bacteria 2465
61 Ga0068853_100064522 3300005539 Bacteria 3176
62 Ga0070672_100000001 3300005543 Bacteria 204624
63 Ga0070695_100031572 3300005545 Bacteria 3306
64 Ga0070696_100093886 3300005546 Bacteria 2140
65 Ga0070693_100000341 3300005547 Bacteria 21257
66 Ga0070665_100000135 3300005548 Bacteria 138925
67 Ga0070665_100041372 3300005548 Bacteria 4631
68 Ga0070665_100058089 3300005548 Bacteria 3878
69 Ga0070665_100180821 3300005548 Bacteria 2110
70 Ga0070704_100015164 3300005549 Bacteria 4834
71 Ga0070704_100209650 3300005549 Bacteria 1578
72 Ga0068855_100134528 3300005563 Bacteria 2821
73 Ga0068855_100296368 3300005563 Bacteria 1792
74 Ga0068855_100504142 3300005563 Bacteria 1315
75 Ga0068854_100000947 3300005578 Bacteria 17454
76 Ga0068856_100036208 3300005614 Bacteria 4838
77 Ga0068856_100039424 3300005614 Bacteria 4638
78 Ga0070702_100104151 3300005615 Bacteria 1746
79 Ga0070702_100117582 3300005615 Bacteria 1659
80 Ga0068852_100001985 3300005616 Bacteria 13958
81 Ga0068866_10000008 3300005718 Bacteria 117658
82 Ga0068866_10000460 3300005718 Bacteria 18634
83 Ga0068851_10003096 3300005834 Bacteria 7366
84 Ga0068863_100000022 3300005841 Bacteria 188278
85 Ga0068863_100084455 3300005841 Bacteria 3009
86 Ga0068863_100312012 3300005841 Bacteria 1527
87 Ga0068858_100000075 3300005842 Bacteria 104349
88 Ga0068858_100003213 3300005842 Bacteria 16316
89 Ga0068860_100010748 3300005843 Bacteria 9034
90 Ga0068860_100237194 3300005843 Bacteria 1773
91 Ga0068862_100001298 3300005844 Bacteria 23354
92 Ga0081455_10020241 3300005937 Bacteria 6272
93 Ga0081455_10025411 3300005937 Bacteria 5468
94 Ga0081455_10026546 3300005937 Bacteria 5323
95 Ga0081455_10052960 3300005937 Bacteria 3470
96 Ga0081538_10000141 3300005981 Bacteria 74085
97 Ga0081538_10000568 3300005981 Bacteria 40894
98 Ga0081538_10005974 3300005981 Bacteria 10836
99 Ga0081538_10023885 3300005981 Bacteria 4376
100 Ga0081540_1002030 3300005983 Bacteria 16890
101 Ga0081539_10000878 3300005985 Bacteria 57633
102 Ga0081539_10001538 3300005985 Bacteria 38558
103 Ga0081539_10009688 3300005985 Bacteria 7978
104 Ga0081539_10017083 3300005985 Bacteria 5122
105 Ga0075365_10000294 3300006038 Bacteria 17330
106 Ga0075365_10005137 3300006038 Bacteria 7029
107 Ga0075365_10012358 3300006038 Bacteria 5068
108 Ga0075365_10079359 3300006038 Bacteria 2221
109 Ga0075365_10085997 3300006038 Bacteria 2136
110 Ga0075365_10208054 3300006038 Bacteria 1371
111 Ga0075363_100124535 3300006048 Bacteria 1442
112 Ga0075364_10085022 3300006051 Bacteria 2095
113 Ga0075364_10149550 3300006051 Bacteria 1573
114 Ga0075364_10156480 3300006051 Unclassified 1537
115 Ga0075364_10183983 3300006051 Bacteria 1414
116 Ga0070715_10000021 3300006163 Bacteria 119283
117 Ga0070712_100015682 3300006175 Bacteria 4884
118 Ga0075367_10120948 3300006178 Bacteria 1613
119 Ga0075367_10207860 3300006178 Bacteria 1224
120 Ga0075370_10043043 3300006353 Unclassified 2552
121 Ga0075428_100168049 3300006844 Unclassified 2379
122 Ga0075428_100197425 3300006844 Bacteria 2176
123 Ga0075428_100197815 3300006844 Bacteria 2174
124 Ga0075430_100171108 3300006846 Bacteria 1807
125 Ga0075431_100000083 3300006847 Bacteria 56463
126 Ga0075431_100059091 3300006847 Bacteria 3957
127 Ga0075433_10026103 3300006852 Bacteria 4942
128 Ga0075433_10036301 3300006852 Bacteria 4245
129 Ga0075433_10312881 3300006852 Bacteria 1390
130 Ga0075434_100066000 3300006871 Bacteria 3604
131 Ga0068865_100000490 3300006881 Bacteria 22178
132 Ga0075436_100135286 3300006914 Bacteria 1730
133 Ga0075435_100121727 3300007076 Bacteria 2178
134 Ga0111539_10011397 3300009094 Bacteria 11161
135 Ga0111539_10092497 3300009094 Bacteria 3554
136 Ga0105245_10000278 3300009098 Bacteria 48473
137 Ga0105245_10000415 3300009098 Bacteria 39764
138 Ga0105245_10010216 3300009098 Bacteria 8174
139 Ga0105245_10236811 3300009098 Bacteria 1768
140 Ga0105245_10507824 3300009098 Bacteria 1222
141 Ga0105247_10000305 3300009101 Bacteria 44071
142 Ga0114129_10011162 3300009147 Bacteria 12806
143 Ga0114129_10038150 3300009147 Bacteria 6780
144 Ga0114129_10069445 3300009147 Bacteria 4911
145 Ga0114129_10376262 3300009147 Bacteria 1876
146 Ga0114129_10555439 3300009147 Bacteria 1492
147 Ga0105243_10038717 3300009148 Bacteria 3714
148 Ga0105242_10000603 3300009176 Bacteria 28175
149 Ga0105242_10003748 3300009176 Bacteria 11810
150 Ga0105248_10000020 3300009177 Bacteria 284637
151 Ga0105238_10000055 3300009551 Bacteria 139232
152 Ga0105238_10451435 3300009551 Bacteria 1282
153 Ga0105249_10000143 3300009553 Bacteria 92539
154 Ga0105249_10023295 3300009553 Bacteria 5555
155 Ga0105249_10068962 3300009553 Bacteria 3263
156 Ga0105249_10093858 3300009553 Bacteria 2812
157 Ga0105249_10207509 3300009553 Unclassified 1920
158 Ga0105239_10101908 3300010375 Bacteria 3177
159 Ga0105239_10220543 3300010375 Bacteria 2127
160 Ga0105246_10165684 3300011119 Bacteria 1688
161 Ga0105246_10223048 3300011119 Bacteria 1479
162 Ga0157370_10018133 3300013104 Bacteria 7086
163 Ga0157370_10056831 3300013104 Bacteria 3723
164 Ga0157370_10102427 3300013104 Bacteria 2681
165 Ga0157369_10000074 3300013105 Bacteria 136668
166 Ga0157374_10012359 3300013296 Bacteria 7428
167 Ga0157378_10005561 3300013297 Bacteria 11033
168 Ga0157378_10079154 3300013297 Bacteria 2967
169 Ga0157372_10026046 3300013307 Bacteria 6361
170 Ga0157375_10009814 3300013308 Bacteria 8416
171 Ga0157375_10053210 3300013308 Bacteria 3982
172 Ga0163163_10041962 3300014325 Bacteria 4477
173 Ga0163163_10087466 3300014325 Bacteria 3126
174 Ga0157380_10000016 3300014326 Bacteria 126029
175 Ga0157379_10317483 3300014968 Bacteria 1422
176 Ga0157376_10379074 3300014969 Bacteria 1362
177 Ga0163161_10000053 3300017792 Bacteria 117408
178 Ga0163161_10026609 3300017792 Bacteria 4097
179 Ga0206356_10481544 3300020070 Bacteria 2461
180 Ga0206350_11586870 3300020080 Bacteria 1301
181 Ga0207656_10000570 3300025321 Bacteria 12237
182 Ga0207682_10000091 3300025893 Bacteria 41479
183 Ga0207642_10000002 3300025899 Bacteria 658166
184 Ga0207642_10000275 3300025899 Bacteria 15398
185 Ga0207642_10125725 3300025899 Bacteria 1330
186 Ga0207710_10000157 3300025900 Bacteria 72764
187 Ga0207688_10032696 3300025901 Bacteria 2876
188 Ga0207680_10024183 3300025903 Bacteria 3330
189 Ga0207685_10000028 3300025905 Bacteria 97935
190 Ga0207707_10031693 3300025912 Bacteria 4627
191 Ga0207693_10001086 3300025915 Bacteria 24419
192 Ga0207693_10095615 3300025915 Bacteria 2329
193 Ga0207693_10334952 3300025915 Bacteria 1184
194 Ga0207663_10000409 3300025916 Bacteria 18629
195 Ga0207657_10168337 3300025919 Bacteria 1776
196 Ga0207649_10000127 3300025920 Bacteria 64603
197 Ga0207652_10000321 3300025921 Bacteria 49720
198 Ga0207681_10119746 3300025923 Bacteria 1929
199 Ga0207694_10000063 3300025924 Bacteria 139700
200 Ga0207650_10080137 3300025925 Bacteria 2475
201 Ga0207659_10000013 3300025926 Bacteria 172742
202 Ga0207687_10000032 3300025927 Bacteria 143196
203 Ga0207687_10000036 3300025927 Bacteria 121934
204 Ga0207687_10157963 3300025927 Bacteria 1737
205 Ga0207687_10233901 3300025927 Bacteria 1453
206 Ga0207700_10000007 3300025928 Bacteria 345720
207 Ga0207664_10075797 3300025929 Bacteria 2721
208 Ga0207664_10083242 3300025929 Bacteria 2608
209 Ga0207690_10007226 3300025932 Bacteria 6595
210 Ga0207690_10031841 3300025932 Bacteria 3379
211 Ga0207706_10000001 3300025933 Bacteria 423014
212 Ga0207706_10018417 3300025933 Bacteria 6284
213 Ga0207706_10062147 3300025933 Bacteria 3289
214 Ga0207686_10000097 3300025934 Bacteria 72219
215 Ga0207686_10000411 3300025934 Bacteria 29706
216 Ga0207669_10000017 3300025937 Bacteria 119878
217 Ga0207669_10000026 3300025937 Bacteria 92199
218 Ga0207669_10074675 3300025937 Bacteria 2145
219 Ga0207704_10000805 3300025938 Bacteria 13852
220 Ga0207665_10074954 3300025939 Bacteria 2317
221 Ga0207691_10000747 3300025940 Bacteria 32117
222 Ga0207711_10000006 3300025941 Bacteria 792692
223 Ga0207689_10072097 3300025942 Bacteria 2837
224 Ga0207661_10005476 3300025944 Bacteria 8952
225 Ga0207661_10008364 3300025944 Bacteria 7391
226 Ga0207661_10009986 3300025944 Bacteria 6821
227 Ga0207661_10013674 3300025944 Bacteria 5926
228 Ga0207661_10118210 3300025944 Bacteria 2253
229 Ga0207661_10441613 3300025944 Bacteria 1184
230 Ga0207661_10539049 3300025944 Bacteria 1068
231 Ga0207667_10306651 3300025949 Bacteria 1622
232 Ga0207667_10491257 3300025949 Bacteria 1245
233 Ga0207651_10000448 3300025960 Bacteria 17432
234 Ga0207712_10000058 3300025961 Bacteria 140948
235 Ga0207712_10016807 3300025961 Bacteria 4744
236 Ga0207668_10016755 3300025972 Bacteria 4581
237 Ga0207668_10113662 3300025972 Bacteria 2036
238 Ga0207658_10011985 3300025986 Bacteria 5913
239 Ga0207677_10000284 3300026023 Bacteria 37886
240 Ga0207677_10001254 3300026023 Bacteria 13667
241 Ga0207703_10000088 3300026035 Bacteria 106080
242 Ga0207703_10000287 3300026035 Bacteria 55757
243 Ga0207703_10044258 3300026035 Bacteria 3577
244 Ga0207639_10014925 3300026041 Bacteria 5472
245 Ga0207639_10172698 3300026041 Bacteria 1832
246 Ga0207678_10001743 3300026067 Bacteria 19907
247 Ga0207708_10031466 3300026075 Bacteria 4027
248 Ga0207708_10042963 3300026075 Bacteria 3444
249 Ga0207702_10007528 3300026078 Bacteria 9285
250 Ga0207641_10000016 3300026088 Bacteria 307363
251 Ga0207641_10030625 3300026088 Bacteria 4457
252 Ga0207641_10345463 3300026088 Bacteria 1417
253 Ga0207648_10004310 3300026089 Bacteria 14650
254 Ga0207676_10000018 3300026095 Bacteria 306375
255 Ga0207683_10019197 3300026121 Bacteria 5837
256 Ga0207683_10130162 3300026121 Bacteria 2263
257 Ga0207698_10000004 3300026142 Bacteria 313614
258 Ga0207698_10133239 3300026142 Bacteria 2127
259 Ga0207428_10030572 3300027907 Bacteria 4452
260 Ga0207428_10206806 3300027907 Bacteria 1476
261 Ga0207428_10210921 3300027907 Bacteria 1459
262 Ga0207428_10211897 3300027907 Bacteria 1455
263 Ga0268266_10000056 3300028379 Bacteria 289176
264 Ga0268266_10000674 3300028379 Bacteria 46135
265 Ga0268266_10015138 3300028379 Bacteria 6623
266 Ga0268266_10015515 3300028379 Bacteria 6535
267 Ga0268266_10109390 3300028379 Bacteria 2447
268 Ga0268265_10014206 3300028380 Bacteria 5423
269 Ga0268264_10009842 3300028381 Bacteria 7914
270 Ga0265337_1000066 3300028556 Bacteria 48673
271 Ga0265326_10000258 3300028558 Bacteria 24473
272 Ga0265319_1000317 3300028563 Bacteria 35915
273 Ga0265322_10000011 3300028654 Bacteria 167597
274 Ga0265336_10010612 3300028666 Bacteria 3153
275 Ga0265338_10007586 3300028800 Bacteria 13402
276 Ga0265324_10001593 3300029957 Bacteria 12632
277 Ga0265324_10033605 3300029957 Bacteria 1789
278 Ga0265320_10000011 3300031240 Bacteria 249534
279 Ga0265325_10025131 3300031241 Bacteria 3235
280 Ga0265329_10023150 3300031242 Bacteria 2071
281 Ga0265331_10011614 3300031250 Bacteria 4816
282 Ga0265327_10000015 3300031251 Bacteria 496677
283 Ga0265314_10000640 3300031711 Bacteria 42944
284 Ga0307410_10024605 3300031852 Bacteria 3765
285 Ga0307407_10010761 3300031903 Bacteria 4327
286 Ga0307409_100051835 3300031995 Bacteria 3142
287 Ga0307409_100141048 3300031995 Bacteria 2077
288 Ga0307416_100024159 3300032002 Bacteria 4429
289 Ga0307414_10048032 3300032004 Bacteria 2942
290 Ga0307411_10210341 3300032005 Bacteria 1501
291 Ga0307415_100002308 3300032126 Bacteria 9461
292 Ga0307415_100011517 3300032126 Bacteria 5067
293 Ga0373943_0112414 3300035170 Bacteria 1438
294 Ga0316574_0021795 3300035398 Bacteria 3808
295 Ga0316574_0046989 3300035398 Unclassified 2678
296 Ga0373937_0004956 3300036401 Bacteria 11321
297 Ga0373937_0030944 3300036401 Bacteria 4847
298 Ga0316584_0007137 3300036712 Bacteria 7617
299 Ga0395900_0009556 3300037418 Bacteria 9943
300 Ga0395900_0079423 3300037418 Bacteria 3371
301 Ga0395900_0160915 3300037418 Bacteria 2290
302 Ga0395900_0164594 3300037418 Bacteria 2261
303 Ga0395900_0225955 3300037418 Bacteria 1885
304 Ga0395898_0002264 3300037466 Bacteria 23336
305 Ga0395898_0008352 3300037466 Bacteria 10948
306 Ga0395898_0010733 3300037466 Bacteria 9569
307 Ga0395898_0076418 3300037466 Bacteria 3234
308 Ga0395905_0036048 3300037471 Bacteria 4645
309 Ga0395905_0071067 3300037471 Bacteria 3263
310 Ga0395905_0194885 3300037471 Unclassified 1900
311 Ga0395901_0008042 3300038443 Bacteria 10652
312 Ga0395901_0017662 3300038443 Bacteria 7282
313 Ga0395901_0073322 3300038443 Bacteria 3570
314 Ga0395901_0207232 3300038443 Bacteria 2053
315 Ga0451853_0614736 3300041512 Unclassified 2306
316 Ga0451853_2510563 3300041512 Bacteria 1549
317 Ga0450920_004565 3300042122 Bacteria 2438
318 Ga0466963_0000017 3300044694 Bacteria 58283
319 Ga0466963_0021887 3300044694 Bacteria 4041
320 Ga0466967_0000001 3300045976 Bacteria 229823
321 Ga0495592_0000261 3300046454 Bacteria 44965
322 Ga0495603_0000098 3300046455 Bacteria 40307
323 Ga0495603_0012212 3300046455 Bacteria 5202
324 Ga0495629_0002184 3300046459 Bacteria 15103
325 Ga0495629_0020308 3300046459 Bacteria 4743
326 Ga0495629_0108082 3300046459 Bacteria 1940
327 Ga0495629_0123573 3300046459 Bacteria 1803
328 Ga0495641_0000312 3300046461 Bacteria 39169
329 Ga0495641_0020331 3300046461 Bacteria 3370
330 Ga0495641_0021579 3300046461 Bacteria 3238
331 Ga0495653_0016285 3300046463 Bacteria 6058
332 Ga0495582_0000001 3300046473 Bacteria 252434
333 Ga0495639_0012010 3300046475 Bacteria 3735
334 Ga0495662_0003997 3300046476 Bacteria 7429
335 Ga0495662_0098696 3300046476 Bacteria 1428
336 Ga0495594_0000030 3300046499 Bacteria 66443
337 Ga0495594_0102028 3300046499 Bacteria 1614
338 Ga0495596_0028153 3300046500 Bacteria 2257
339 Ga0495606_0000040 3300046507 Bacteria 223500
340 Ga0495608_0000007 3300046511 Bacteria 313495
341 Ga0495608_0001909 3300046511 Bacteria 14948
342 Ga0495608_0007743 3300046511 Bacteria 7563
343 Ga0495608_0009516 3300046511 Bacteria 6789
344 Ga0495618_0000014 3300046514 Bacteria 163136
345 Ga0495620_0000139 3300046515 Bacteria 59244
346 Ga0495628_0000679 3300046516 Bacteria 31290
347 Ga0495628_0020312 3300046516 Bacteria 5481
348 Ga0495628_0068421 3300046516 Bacteria 2771
349 Ga0495628_0130454 3300046516 Bacteria 1923
350 Ga0495630_0000014 3300046517 Bacteria 217229
351 Ga0495630_0002438 3300046517 Bacteria 12870
352 Ga0495630_0060815 3300046517 Bacteria 2836
353 Ga0495652_0000037 3300046529 Bacteria 133232
354 Ga0495652_0020278 3300046529 Bacteria 5910
355 Ga0495640_0019044 3300046533 Bacteria 5075
356 Ga0495640_0089749 3300046533 Bacteria 2029
357 Ga0495587_0011600 3300046536 Bacteria 5580
358 Ga0495645_0122413 3300046543 Bacteria 1830
359 Ga0495622_0000080 3300046557 Bacteria 85557
360 Ga0495667_0000020 3300046559 Bacteria 180876
361 Ga0495634_0000028 3300046642 Bacteria 114075
362 Ga0495634_0000293 3300046642 Bacteria 47827
363 Ga0495634_0014587 3300046642 Bacteria 5661
364 Ga0495634_0092022 3300046642 Bacteria 1968
365 Ga0495625_0000409 3300046660 Bacteria 65188
366 Ga0495635_0000076 3300046663 Bacteria 61665
367 Ga0495635_0020283 3300046663 Bacteria 4631
368 Ga0495635_0032802 3300046663 Bacteria 3602
369 Ga0495588_0000387 3300046674 Bacteria 25193
370 Ga0495657_0000001 3300046675 Bacteria 445641
371 Ga0495657_0062206 3300046675 Bacteria 2467
372 Ga0495599_0053095 3300046678 Bacteria 2539
373 Ga0495647_0000001 3300046681 Bacteria 222371
374 Ga0495647_0002409 3300046681 Bacteria 5891
375 Ga0495647_0009033 3300046681 Bacteria 3363
376 Ga0495658_0000002 3300046683 Bacteria 309651
377 Ga0495658_0023776 3300046683 Bacteria 3256
378 Ga0495669_0000113 3300046684 Bacteria 52780
379 Ga0495669_0018751 3300046684 Bacteria 2978
380 Ga0495613_0000005 3300046689 Bacteria 222558
381 Ga0495613_0000041 3300046689 Bacteria 130784
382 Ga0495613_0077294 3300046689 Bacteria 2422
383 Ga0495624_0001423 3300046690 Bacteria 18632
384 Ga0495624_0002990 3300046690 Bacteria 12645
385 Ga0495624_0018966 3300046690 Bacteria 4596
386 Ga0495670_0008755 3300046691 Bacteria 4980
387 Ga0495649_0003735 3300046694 Bacteria 10123
388 Ga0495600_0004414 3300046809 Bacteria 8414
389 Ga0495600_0010082 3300046809 Bacteria 5857
390 Ga0495604_0000050 3300047317 Bacteria 108094
391 Ga0495604_0000704 3300047317 Bacteria 28417
392 Ga0495604_0038729 3300047317 Bacteria 3751
393 Ga0495674_0000030 3300047319 Bacteria 115975
394 Ga0495676_0000621 3300047321 Bacteria 29385
395 Ga0495676_0001246 3300047321 Bacteria 21839
396 Ga0495676_0045210 3300047321 Bacteria 3586
397 Ga0495680_0001593 3300047322 Bacteria 24235
398 Ga0495680_0006381 3300047322 Bacteria 10972
399 Ga0495680_0021812 3300047322 Bacteria 5352
400 Ga0495675_0000055 3300047444 Bacteria 77878
401 Ga0495686_0101244 3300047472 Bacteria 1737
402 Ga0495602_0000007 3300048088 Bacteria 273212
403 Ga0495602_0014028 3300048088 Bacteria 8155
404 Ga0495614_0110026 3300048089 Bacteria 1209
405 Ga0496100_0000001 3300048903 Bacteria 530179
406 Ga0496100_0000013 3300048903 Bacteria 177476
407 Ga0496100_0071231 3300048903 Bacteria 2320
408 Ga0496101_0000004 3300048904 Bacteria 331599
409 Ga0496101_0000035 3300048904 Bacteria 177237
410 Ga0496102_0000211 3300048905 Bacteria 77793
411 Ga0496102_0000677 3300048905 Bacteria 34100
412 Ga0496102_0075759 3300048905 Bacteria 3093
413 Ga0496102_0392057 3300048905 Bacteria 1306
414 Ga0496103_0000083 3300048906 Bacteria 108615
415 Ga0496103_0009864 3300048906 Bacteria 5653
416 Ga0496103_0067891 3300048906 Bacteria 2227
417 Ga0496104_0000015 3300048907 Bacteria 374530
418 Ga0496104_0000052 3300048907 Bacteria 137286
419 Ga0496104_0017109 3300048907 Bacteria 6597
420 Ga0496104_0033938 3300048907 Bacteria 4757
421 Ga0496104_0090092 3300048907 Bacteria 2930
422 Ga0496105_0000004 3300048908 Bacteria 475798
423 Ga0496105_0000030 3300048908 Bacteria 137325
424 Ga0496105_0024185 3300048908 Bacteria 4934
425 Ga0496106_0000076 3300048909 Bacteria 79088
426 Ga0496106_0000121 3300048909 Bacteria 59910
427 Ga0496106_0000959 3300048909 Bacteria 21012
428 Ga0496106_0028359 3300048909 Bacteria 4170
429 Ga0496107_0000005 3300048910 Bacteria 281747
430 Ga0496107_0000020 3300048910 Bacteria 148990
431 Ga0496107_0034539 3300048910 Bacteria 3622
432 Ga0496107_0183247 3300048910 Bacteria 1555
433 Ga0496108_0000006 3300048911 Bacteria 469473
434 Ga0496108_0000063 3300048911 Bacteria 118950
435 Ga0496108_0000550 3300048911 Bacteria 29326
436 Ga0496108_0000741 3300048911 Bacteria 25376
437 Ga0496108_0025733 3300048911 Bacteria 4852
438 Ga0496108_0239912 3300048911 Bacteria 1577
439 Ga0496109_0000009 3300048912 Bacteria 236561
440 Ga0496109_0000088 3300048912 Bacteria 94877
441 Ga0496109_0000174 3300048912 Bacteria 63794
442 Ga0496109_0000261 3300048912 Bacteria 50812
443 Ga0496109_0023152 3300048912 Bacteria 5510
444 Ga0496109_0069535 3300048912 Bacteria 3229
445 Ga0496110_0000038 3300048913 Bacteria 64272
446 Ga0496110_0016143 3300048913 Bacteria 6227
447 Ga0496110_0094797 3300048913 Bacteria 2672
448 Ga0496110_0095699 3300048913 Bacteria 2660
449 Ga0496110_0297422 3300048913 Bacteria 1470
450 Ga0496111_0000192 3300048914 Bacteria 28263
451 Ga0496111_0017591 3300048914 Bacteria 4943
452 Ga0496111_0052767 3300048914 Bacteria 2936
453 Ga0496111_0053722 3300048914 Bacteria 2911
454 Ga0496112_0000025 3300048915 Bacteria 146197
455 Ga0496112_0002961 3300048915 Bacteria 13853
456 Ga0496113_0000013 3300048916 Bacteria 81224
457 Ga0496113_0021043 3300048916 Bacteria 4597
458 Ga0496113_0087265 3300048916 Bacteria 2398
459 Ga0496113_0123981 3300048916 Bacteria 2022
460 Ga0496113_0194826 3300048916 Bacteria 1609
461 Ga0496114_0024870 3300048917 Bacteria 4889
462 Ga0496115_0000011 3300048918 Bacteria 222529
463 Ga0496115_0000659 3300048918 Bacteria 25718
464 Ga0496115_0015153 3300048918 Bacteria 5842
465 Ga0496115_0057322 3300048918 Bacteria 3133
466 Ga0496117_0003638 3300048920 Bacteria 17752
467 Ga0496118_0002918 3300048921 Bacteria 22210
468 Ga0496118_0122903 3300048921 Bacteria 1687
469 Ga0496119_0011049 3300048922 Bacteria 7528
470 Ga0496119_0012933 3300048922 Bacteria 6713
471 Ga0496119_0014174 3300048922 Bacteria 6263
472 Ga0496120_0006622 3300048923 Bacteria 8833
473 Ga0496121_0006140 3300048924 Bacteria 15082
474 Ga0496121_0027272 3300048924 Bacteria 5348
475 Ga0496124_0032916 3300048927 Bacteria 4570
476 Ga0496125_0076385 3300048928 Bacteria 2587
477 Ga0496126_0106992 3300048929 Bacteria 2440
478 Ga0501031_0000558 3300049568 Bacteria 21809
479 Ga0501031_0038615 3300049568 Bacteria 3116
480 Ga0501031_0149043 3300049568 Bacteria 1528
481 Ga0501032_0001109 3300049569 Bacteria 21549
482 Ga0501032_0042985 3300049569 Bacteria 3063
483 Ga0501032_0119734 3300049569 Bacteria 1741
484 Ga0501033_0001357 3300049570 Bacteria 21809
485 Ga0501033_0187683 3300049570 Bacteria 1480
486 Ga0501034_0001826 3300049571 Bacteria 27013
487 Ga0501034_0016651 3300049571 Bacteria 7537
488 Ga0501034_0116104 3300049571 Bacteria 2665
489 Ga0501034_0183278 3300049571 Bacteria 2058
490 Ga0501036_0054524 3300049572 Bacteria 3386
491 Ga0501036_0220543 3300049572 Bacteria 1592
492 Ga0501037_0000896 3300049573 Bacteria 22215
493 Ga0501038_0001454 3300049574 Bacteria 21766
494 Ga0501038_0029547 3300049574 Bacteria 4855
495 Ga0501038_0125559 3300049574 Bacteria 2112
496 Ga0501039_0024460 3300049575 Bacteria 4639
497 Ga0501039_0041002 3300049575 Bacteria 3574
498 Ga0501039_0068274 3300049575 Bacteria 2760
499 Ga0501039_0075108 3300049575 Bacteria 2627
500 Ga0501039_0206148 3300049575 Unclassified 1546
501 Ga0501040_0029714 3300049576 Bacteria 3689
502 Ga0501040_0162426 3300049576 Bacteria 1579
503 Ga0501041_0020228 3300049577 Bacteria 3977
504 Ga0501041_0040363 3300049577 Bacteria 2832
505 Ga0501042_0016774 3300049578 Bacteria 5036
506 Ga0501042_0048645 3300049578 Bacteria 3023
507 Ga0501042_0057878 3300049578 Bacteria 2766
508 Ga0501042_0410202 3300049578 Bacteria 982
509 Ga0501043_0001315 3300049579 Bacteria 21712
510 Ga0501043_0066247 3300049579 Bacteria 2836
511 Ga0501043_0087187 3300049579 Bacteria 2453
512 Ga0501046_0001583 3300049580 Bacteria 21765
513 Ga0501046_0020434 3300049580 Bacteria 5476
514 Ga0501047_0035520 3300049581 Bacteria 4815
515 Ga0501048_0000914 3300049582 Bacteria 21758
516 Ga0501048_0026831 3300049582 Bacteria 4192
517 Ga0501048_0032516 3300049582 Bacteria 3769
518 Ga0501068_0046321 3300049584 Bacteria 2622
519 Ga0501068_0061344 3300049584 Bacteria 2285
520 Ga0501068_0203089 3300049584 Bacteria 1257
521 Ga0501069_0026586 3300049585 Bacteria 3169
522 Ga0501069_0037660 3300049585 Bacteria 2669
523 Ga0501070_0001344 3300049586 Bacteria 22000
524 Ga0501070_0034184 3300049586 Bacteria 4252
525 Ga0501070_0059040 3300049586 Bacteria 3180
526 Ga0501071_0172196 3300049587 Bacteria 1620
527 Ga0501072_0020240 3300049588 Bacteria 5154
528 Ga0501072_0025046 3300049588 Bacteria 4645
529 Ga0501072_0138433 3300049588 Bacteria 1941
530 Ga0501072_0279931 3300049588 Unclassified 1327
531 Ga0501073_0020432 3300049589 Bacteria 4776
532 Ga0501074_0017639 3300049590 Bacteria 5185
533 Ga0501074_0048576 3300049590 Bacteria 3065
534 Ga0501075_0002912 3300049591 Bacteria 11484
535 Ga0501075_0004099 3300049591 Bacteria 9846
536 Ga0501075_0063182 3300049591 Bacteria 2791
537 Ga0501075_0071487 3300049591 Bacteria 2623
538 Ga0501075_0084059 3300049591 Bacteria 2410
539 Ga0501076_0014421 3300049592 Bacteria 5952
540 Ga0501076_0076893 3300049592 Bacteria 2677
541 Ga0501076_0246996 3300049592 Bacteria 1460
542 Ga0501077_0012254 3300049593 Bacteria 5369
543 Ga0501077_0047966 3300049593 Bacteria 2713
544 Ga0501079_0007813 3300049741 Bacteria 8098
545 Ga0501079_0015854 3300049741 Bacteria 5758
546 Ga0501079_0030879 3300049741 Bacteria 4117
547 Ga0501079_0038916 3300049741 Bacteria 3667
548 Ga0501079_0199900 3300049741 Bacteria 1561
549 Ga0501080_0062484 3300049742 Bacteria 3466
550 Ga0501080_0070687 3300049742 Bacteria 3246
551 Ga0501081_0026645 3300049743 Bacteria 3899
552 Ga0501081_0041862 3300049743 Bacteria 3139
553 Ga0501081_0054710 3300049743 Bacteria 2757
554 Ga0501083_0000952 3300049744 Bacteria 19139
555 Ga0501083_0013734 3300049744 Bacteria 5664
556 Ga0501083_0015580 3300049744 Bacteria 5322
557 Ga0501083_0022693 3300049744 Bacteria 4354
558 Ga0501083_0048421 3300049744 Bacteria 2869
559 Ga0501035_0001491 3300049822 Bacteria 23985
560 Ga0501035_0028283 3300049822 Bacteria 5118
561 Ga0501044_0002295 3300049823 Bacteria 21790
562 Ga0501044_0041785 3300049823 Bacteria 4772
563 Ga0501044_0074043 3300049823 Bacteria 3461
564 Ga0501044_0103861 3300049823 Bacteria 2856
565 Ga0501044_0117853 3300049823 Bacteria 2658
566 Ga0501045_0007862 3300049824 Bacteria 7422
567 nmdc:mga00v17_15439_c2 3300050491 Bacteria 3074
568 nmdc:mga00v17_34999_c1 3300050491 Bacteria 2986
569 nmdc:mga00v17_94333_c1 3300050491 Bacteria 1883
570 nmdc:mga0yw44_2497_c1 3300050492 Bacteria 7870
571 nmdc:mga0yw44_35377_c1 3300050492 Bacteria 2935
572 nmdc:mga0yw44_39381_c1 3300050492 Bacteria 2802
573 nmdc:mga0yw44_48124_c1 3300050492 Bacteria 2570
574 nmdc:mga06z11_134684_c1 3300050494 Bacteria 1391
575 nmdc:mga05p37_107099_c1 3300050507 Bacteria 3439
576 nmdc:mga05p37_118300_c1 3300050507 Bacteria 3256
577 nmdc:mga05p37_33282_c1 3300050507 Bacteria 6312
578 nmdc:mga05p37_49759_c1 3300050507 Bacteria 5155
579 nmdc:mga06r32_49570_c1 3300050510 Bacteria 4016
580 nmdc:mga08y16_10273_c1 3300050511 Bacteria 9824
581 nmdc:mga08y16_28191_c1 3300050511 Bacteria 5919
582 nmdc:mga08y16_300379_c1 3300050511 Bacteria 1655
583 nmdc:mga08y16_60961_c1 3300050511 Bacteria 3939
584 nmdc:mga0rr50_88107_c1 3300050513 Bacteria 2410
585 nmdc:mga0a205_16260_c1 3300050515 Bacteria 6967
586 nmdc:mga0a205_43_c2 3300050515 Bacteria 18020
587 nmdc:mga0a205_54292_c1 3300050515 Bacteria 3868
588 Ga0495601_0000060 3300053077 Bacteria 60600
589 Ga0495601_0011214 3300053077 Bacteria 5353
590 Ga0495601_0062210 3300053077 Bacteria 2370
591 Ga0495601_0110935 3300053077 Bacteria 1777
592 Ga0495612_0000460 3300053078 Bacteria 16359
593 Ga0495612_0001300 3300053078 Bacteria 10304
594 Ga0495612_0010250 3300053078 Bacteria 3790
595 Ga0495612_0062145 3300053078 Bacteria 1548
596 Ga0495655_0000002 3300053083 Bacteria 312752
597 Ga0495595_0000002 3300053084 Bacteria 445641
598 Ga0495595_0020183 3300053084 Bacteria 2898
599 Ga0495619_0000008 3300053085 Bacteria 305999
600 Ga0495619_0000047 3300053085 Bacteria 102152
601 Ga0495619_0000095 3300053085 Bacteria 66204
602 Ga0495619_0000217 3300053085 Bacteria 41863
603 Ga0495619_0000449 3300053085 Bacteria 27774
604 Ga0495619_0004492 3300053085 Bacteria 8909
605 Ga0495619_0009944 3300053085 Bacteria 5990
606 Ga0495619_0018739 3300053085 Bacteria 4394
607 Ga0500566_0014438 3300053094 Bacteria 4644
608 Ga0500641_0004522 3300053096 Bacteria 4915
609 Ga0500614_001518 3300053123 Bacteria 5521
610 Ga0500628_000001 3300053129 Bacteria 564074
611 Ga0500658_0035405 3300053134 Bacteria 1976
612 Ga0501084_0031833 3300054114 Bacteria 4410
613 Ga0501084_0145166 3300054114 Bacteria 1998
614 Ga0501084_0157538 3300054114 Unclassified 1915
615 Ga0501084_0278060 3300054114 Bacteria 1413
616 Ga0501082_0015127 3300060353 Bacteria 6648
617 Ga0501082_0026442 3300060353 Bacteria 5001
618 Ga0501082_0117553 3300060353 Bacteria 2303
619 Ga0530510_0010490 3300061734 Bacteria 6496
620 Ga0495686_0106794
621 JGI24746J21847_1000448
622 JGI24740J21852_10005544
623 JGI24748J21848_1000245
624 JGI24034J26672_10000228
625 JGI25406J46586_10013325
626 JGI25406J46586_10032267
627 JGI25407J50210_10006700
628 Ga0070683_100036528
629 Ga0070683_100040913
630 Ga0070683_100064408
631 Ga0070683_100080858
632 Ga0070683_100095602
633 Ga0070683_100317814
634 Ga0070670_100234617
635 Ga0070666_10100829
636 Ga0070682_100000075
637 Ga0070682_100000090
638 Ga0070682_100029118
639 Ga0068868_100002263
640 Ga0068868_100058291
641 Ga0070660_100130062
642 Ga0070660_100214557
643 Ga0070691_10000044
644 Ga0070661_100000099
645 Ga0070668_100007577
646 Ga0070669_100141018
647 Ga0070675_100000106
648 Ga0070674_100000012
649 Ga0070674_100000023
650 Ga0070674_100038302
651 Ga0070673_100086078
652 Ga0070688_100221513
653 Ga0070659_100002550
654 Ga0070714_100097160
655 Ga0070713_100000010
656 Ga0070701_10146866
657 Ga0070711_100000890
658 Ga0070711_100023878
659 Ga0070711_100111315
660 Ga0070705_100045395
661 Ga0070700_100083955
662 Ga0070700_100121439
663 Ga0070663_100003155
664 Ga0070678_100011298
665 Ga0070678_100027118
666 Ga0070678_100289797
667 Ga0070662_100000002
668 Ga0070662_100151860
669 Ga0070681_10056165
670 Ga0070681_10285857
671 Ga0068867_100023529
672 Ga0070685_10001018
673 Ga0070685_10003345
674 Ga0070685_10042491
675 Ga0070679_100000369
676 Ga0070684_100020599
677 Ga0070684_100025738
678 Ga0070684_100085055
679 Ga0070684_100110427
680 Ga0068853_100064522
681 Ga0070672_100000001
682 Ga0070695_100031572
683 Ga0070696_100093886
684 Ga0070693_100000341
685 Ga0070665_100000135
686 Ga0070665_100041372
687 Ga0070665_100058089
688 Ga0070665_100180821
689 Ga0070704_100015164
690 Ga0070704_100209650
691 Ga0068855_100134528
692 Ga0068855_100296368
693 Ga0068855_100504142
694 Ga0068854_100000947
695 Ga0068856_100036208
696 Ga0068856_100039424
697 Ga0070702_100104151
698 Ga0070702_100117582
699 Ga0068852_100001985
700 Ga0068866_10000008
701 Ga0068866_10000460
702 Ga0068851_10003096
703 Ga0068863_100000022
704 Ga0068863_100084455
705 Ga0068863_100312012
706 Ga0068858_100000075
707 Ga0068858_100003213
708 Ga0068860_100010748
709 Ga0068860_100237194
710 Ga0068862_100001298
711 Ga0081455_10020241
712 Ga0081455_10025411
713 Ga0081455_10026546
714 Ga0081455_10052960
715 Ga0081538_10000141
716 Ga0081538_10000568
717 Ga0081538_10005974
718 Ga0081538_10023885
719 Ga0081540_1002030
720 Ga0081539_10000878
721 Ga0081539_10001538
722 Ga0081539_10009688
723 Ga0081539_10017083
724 Ga0075365_10000294
725 Ga0075365_10005137
726 Ga0075365_10012358
727 Ga0075365_10079359
728 Ga0075365_10085997
729 Ga0075365_10208054
730 Ga0075363_100124535
731 Ga0075364_10085022
732 Ga0075364_10149550
733 Ga0075364_10156480
734 Ga0075364_10183983
735 Ga0070715_10000021
736 Ga0070712_100015682
737 Ga0075367_10120948
738 Ga0075367_10207860
739 Ga0075370_10043043
740 Ga0075428_100168049
741 Ga0075428_100197425
742 Ga0075428_100197815
743 Ga0075430_100171108
744 Ga0075431_100000083
745 Ga0075431_100059091
746 Ga0075433_10026103
747 Ga0075433_10036301
748 Ga0075433_10312881
749 Ga0075434_100066000
750 Ga0068865_100000490
751 Ga0075436_100135286
752 Ga0075435_100121727
753 Ga0111539_10011397
754 Ga0111539_10092497
755 Ga0105245_10000278
756 Ga0105245_10000415
757 Ga0105245_10010216
758 Ga0105245_10236811
759 Ga0105245_10507824
760 Ga0105247_10000305
761 Ga0114129_10011162
762 Ga0114129_10038150
763 Ga0114129_10069445
764 Ga0114129_10376262
765 Ga0114129_10555439
766 Ga0105243_10038717
767 Ga0105242_10000603
768 Ga0105242_10003748
769 Ga0105248_10000020
770 Ga0105238_10000055
771 Ga0105238_10451435
772 Ga0105249_10000143
773 Ga0105249_10023295
774 Ga0105249_10068962
775 Ga0105249_10093858
776 Ga0105249_10207509
777 Ga0105239_10101908
778 Ga0105239_10220543
779 Ga0105246_10165684
780 Ga0105246_10223048
781 Ga0157370_10018133
782 Ga0157370_10056831
783 Ga0157370_10102427
784 Ga0157369_10000074
785 Ga0157374_10012359
786 Ga0157378_10005561
787 Ga0157378_10079154
788 Ga0157372_10026046
789 Ga0157375_10009814
790 Ga0157375_10053210
791 Ga0163163_10041962
792 Ga0163163_10087466
793 Ga0157380_10000016
794 Ga0157379_10317483
795 Ga0157376_10379074
796 Ga0163161_10000053
797 Ga0163161_10026609
798 Ga0206356_10481544
799 Ga0206350_11586870
800 Ga0207656_10000570
801 Ga0207682_10000091
802 Ga0207642_10000002
803 Ga0207642_10000275
804 Ga0207642_10125725
805 Ga0207710_10000157
806 Ga0207688_10032696
807 Ga0207680_10024183
808 Ga0207685_10000028
809 Ga0207707_10031693
810 Ga0207693_10001086
811 Ga0207693_10095615
812 Ga0207693_10334952
813 Ga0207663_10000409
814 Ga0207657_10168337
815 Ga0207649_10000127
816 Ga0207652_10000321
817 Ga0207681_10119746
818 Ga0207694_10000063
819 Ga0207650_10080137
820 Ga0207659_10000013
821 Ga0207687_10000032
822 Ga0207687_10000036
823 Ga0207687_10157963
824 Ga0207687_10233901
825 Ga0207700_10000007
826 Ga0207664_10075797
827 Ga0207664_10083242
828 Ga0207690_10007226
829 Ga0207690_10031841
830 Ga0207706_10000001
831 Ga0207706_10018417
832 Ga0207706_10062147
833 Ga0207686_10000097
834 Ga0207686_10000411
835 Ga0207669_10000017
836 Ga0207669_10000026
837 Ga0207669_10074675
838 Ga0207704_10000805
839 Ga0207665_10074954
840 Ga0207691_10000747
841 Ga0207711_10000006
842 Ga0207689_10072097
843 Ga0207661_10005476
844 Ga0207661_10008364
845 Ga0207661_10009986
846 Ga0207661_10013674
847 Ga0207661_10118210
848 Ga0207661_10441613
849 Ga0207661_10539049
850 Ga0207667_10306651
851 Ga0207667_10491257
852 Ga0207651_10000448
853 Ga0207712_10000058
854 Ga0207712_10016807
855 Ga0207668_10016755
856 Ga0207668_10113662
857 Ga0207658_10011985
858 Ga0207677_10000284
859 Ga0207677_10001254
860 Ga0207703_10000088
861 Ga0207703_10000287
862 Ga0207703_10044258
863 Ga0207639_10014925
864 Ga0207639_10172698
865 Ga0207678_10001743
866 Ga0207708_10031466
867 Ga0207708_10042963
868 Ga0207702_10007528
869 Ga0207641_10000016
870 Ga0207641_10030625
871 Ga0207641_10345463
872 Ga0207648_10004310
873 Ga0207676_10000018
874 Ga0207683_10019197
875 Ga0207683_10130162
876 Ga0207698_10000004
877 Ga0207698_10133239
878 Ga0207428_10030572
879 Ga0207428_10206806
880 Ga0207428_10210921
881 Ga0207428_10211897
882 Ga0268266_10000056
883 Ga0268266_10000674
884 Ga0268266_10015138
885 Ga0268266_10015515
886 Ga0268266_10109390
887 Ga0268265_10014206
888 Ga0268264_10009842
889 Ga0265337_1000066
890 Ga0265326_10000258
891 Ga0265319_1000317
892 Ga0265322_10000011
893 Ga0265336_10010612
894 Ga0265338_10007586
895 Ga0265324_10001593
896 Ga0265324_10033605
897 Ga0265320_10000011
898 Ga0265325_10025131
899 Ga0265329_10023150
900 Ga0265331_10011614
901 Ga0265327_10000015
902 Ga0265314_10000640
903 Ga0307410_10024605
904 Ga0307407_10010761
905 Ga0307409_100051835
906 Ga0307409_100141048
907 Ga0307416_100024159
908 Ga0307414_10048032
909 Ga0307411_10210341
910 Ga0307415_100002308
911 Ga0307415_100011517
912 Ga0373943_0112414
913 Ga0316574_0021795
914 Ga0316574_0046989
915 Ga0373937_0004956
916 Ga0373937_0030944
917 Ga0316584_0007137
918 Ga0395900_0009556
919 Ga0395900_0079423
920 Ga0395900_0160915
921 Ga0395900_0164594
922 Ga0395900_0225955
923 Ga0395898_0002264
924 Ga0395898_0008352
925 Ga0395898_0010733
926 Ga0395898_0076418
927 Ga0395905_0036048
928 Ga0395905_0071067
929 Ga0395905_0194885
930 Ga0395901_0008042
931 Ga0395901_0017662
932 Ga0395901_0073322
933 Ga0395901_0207232
934 Ga0451853_0614736
935 Ga0451853_2510563
936 Ga0450920_004565
937 Ga0466963_0000017
938 Ga0466963_0021887
939 Ga0466967_0000001
940 Ga0495592_0000261
941 Ga0495603_0000098
942 Ga0495603_0012212
943 Ga0495629_0002184
944 Ga0495629_0020308
945 Ga0495629_0108082
946 Ga0495629_0123573
947 Ga0495641_0000312
948 Ga0495641_0020331
949 Ga0495641_0021579
950 Ga0495653_0016285
951 Ga0495582_0000001
952 Ga0495639_0012010
953 Ga0495662_0003997
954 Ga0495662_0098696
955 Ga0495594_0000030
956 Ga0495594_0102028
957 Ga0495596_0028153
958 Ga0495606_0000040
959 Ga0495608_0000007
960 Ga0495608_0001909
961 Ga0495608_0007743
962 Ga0495608_0009516
963 Ga0495618_0000014
964 Ga0495620_0000139
965 Ga0495628_0000679
966 Ga0495628_0020312
967 Ga0495628_0068421
968 Ga0495628_0130454
969 Ga0495630_0000014
970 Ga0495630_0002438
971 Ga0495630_0060815
972 Ga0495652_0000037
973 Ga0495652_0020278
974 Ga0495640_0019044
975 Ga0495640_0089749
976 Ga0495587_0011600
977 Ga0495645_0122413
978 Ga0495622_0000080
979 Ga0495667_0000020
980 Ga0495634_0000028
981 Ga0495634_0000293
982 Ga0495634_0014587
983 Ga0495634_0092022
984 Ga0495625_0000409
985 Ga0495635_0000076
986 Ga0495635_0020283
987 Ga0495635_0032802
988 Ga0495588_0000387
989 Ga0495657_0000001
990 Ga0495657_0062206
991 Ga0495599_0053095
992 Ga0495647_0000001
993 Ga0495647_0002409
994 Ga0495647_0009033
995 Ga0495658_0000002
996 Ga0495658_0023776
997 Ga0495669_0000113
998 Ga0495669_0018751
999 Ga0495613_0000005
1000 Ga0495613_0000041
1001 Ga0495613_0077294
1002 Ga0495624_0001423
1003 Ga0495624_0002990
1004 Ga0495624_0018966
1005 Ga0495670_0008755
1006 Ga0495649_0003735
1007 Ga0495600_0004414
1008 Ga0495600_0010082
1009 Ga0495604_0000050
1010 Ga0495604_0000704
1011 Ga0495604_0038729
1012 Ga0495674_0000030
1013 Ga0495676_0000621
1014 Ga0495676_0001246
1015 Ga0495676_0045210
1016 Ga0495680_0001593
1017 Ga0495680_0006381
1018 Ga0495680_0021812
1019 Ga0495675_0000055
1020 Ga0495686_0101244
1021 Ga0495602_0000007
1022 Ga0495602_0014028
1023 Ga0495614_0110026
1024 Ga0496100_0000001
1025 Ga0496100_0000013
1026 Ga0496100_0071231
1027 Ga0496101_0000004
1028 Ga0496101_0000035
1029 Ga0496102_0000211
1030 Ga0496102_0000677
1031 Ga0496102_0075759
1032 Ga0496102_0392057
1033 Ga0496103_0000083
1034 Ga0496103_0009864
1035 Ga0496103_0067891
1036 Ga0496104_0000015
1037 Ga0496104_0000052
1038 Ga0496104_0017109
1039 Ga0496104_0033938
1040 Ga0496104_0090092
1041 Ga0496105_0000004
1042 Ga0496105_0000030
1043 Ga0496105_0024185
1044 Ga0496106_0000076
1045 Ga0496106_0000121
1046 Ga0496106_0000959
1047 Ga0496106_0028359
1048 Ga0496107_0000005
1049 Ga0496107_0000020
1050 Ga0496107_0034539
1051 Ga0496107_0183247
1052 Ga0496108_0000006
1053 Ga0496108_0000063
1054 Ga0496108_0000550
1055 Ga0496108_0000741
1056 Ga0496108_0025733
1057 Ga0496108_0239912
1058 Ga0496109_0000009
1059 Ga0496109_0000088
1060 Ga0496109_0000174
1061 Ga0496109_0000261
1062 Ga0496109_0023152
1063 Ga0496109_0069535
1064 Ga0496110_0000038
1065 Ga0496110_0016143
1066 Ga0496110_0094797
1067 Ga0496110_0095699
1068 Ga0496110_0297422
1069 Ga0496111_0000192
1070 Ga0496111_0017591
1071 Ga0496111_0052767
1072 Ga0496111_0053722
1073 Ga0496112_0000025
1074 Ga0496112_0002961
1075 Ga0496113_0000013
1076 Ga0496113_0021043
1077 Ga0496113_0087265
1078 Ga0496113_0123981
1079 Ga0496113_0194826
1080 Ga0496114_0024870
1081 Ga0496115_0000011
1082 Ga0496115_0000659
1083 Ga0496115_0015153
1084 Ga0496115_0057322
1085 Ga0496117_0003638
1086 Ga0496118_0002918
1087 Ga0496118_0122903
1088 Ga0496119_0011049
1089 Ga0496119_0012933
1090 Ga0496119_0014174
1091 Ga0496120_0006622
1092 Ga0496121_0006140
1093 Ga0496121_0027272
1094 Ga0496124_0032916
1095 Ga0496125_0076385
1096 Ga0496126_0106992
1097 Ga0501031_0000558
1098 Ga0501031_0038615
1099 Ga0501031_0149043
1100 Ga0501032_0001109
1101 Ga0501032_0042985
1102 Ga0501032_0119734
1103 Ga0501033_0001357
1104 Ga0501033_0187683
1105 Ga0501034_0001826
1106 Ga0501034_0016651
1107 Ga0501034_0116104
1108 Ga0501034_0183278
1109 Ga0501036_0054524
1110 Ga0501036_0220543
1111 Ga0501037_0000896
1112 Ga0501038_0001454
1113 Ga0501038_0029547
1114 Ga0501038_0125559
1115 Ga0501039_0024460
1116 Ga0501039_0041002
1117 Ga0501039_0068274
1118 Ga0501039_0075108
1119 Ga0501039_0206148
1120 Ga0501040_0029714
1121 Ga0501040_0162426
1122 Ga0501041_0020228
1123 Ga0501041_0040363
1124 Ga0501042_0016774
1125 Ga0501042_0048645
1126 Ga0501042_0057878
1127 Ga0501042_0410202
1128 Ga0501043_0001315
1129 Ga0501043_0066247
1130 Ga0501043_0087187
1131 Ga0501046_0001583
1132 Ga0501046_0020434
1133 Ga0501047_0035520
1134 Ga0501048_0000914
1135 Ga0501048_0026831
1136 Ga0501048_0032516
1137 Ga0501068_0046321
1138 Ga0501068_0061344
1139 Ga0501068_0203089
1140 Ga0501069_0026586
1141 Ga0501069_0037660
1142 Ga0501070_0001344
1143 Ga0501070_0034184
1144 Ga0501070_0059040
1145 Ga0501071_0172196
1146 Ga0501072_0020240
1147 Ga0501072_0025046
1148 Ga0501072_0138433
1149 Ga0501072_0279931
1150 Ga0501073_0020432
1151 Ga0501074_0017639
1152 Ga0501074_0048576
1153 Ga0501075_0002912
1154 Ga0501075_0004099
1155 Ga0501075_0063182
1156 Ga0501075_0071487
1157 Ga0501075_0084059
1158 Ga0501076_0014421
1159 Ga0501076_0076893
1160 Ga0501076_0246996
1161 Ga0501077_0012254
1162 Ga0501077_0047966
1163 Ga0501079_0007813
1164 Ga0501079_0015854
1165 Ga0501079_0030879
1166 Ga0501079_0038916
1167 Ga0501079_0199900
1168 Ga0501080_0062484
1169 Ga0501080_0070687
1170 Ga0501081_0026645
1171 Ga0501081_0041862
1172 Ga0501081_0054710
1173 Ga0501083_0000952
1174 Ga0501083_0013734
1175 Ga0501083_0015580
1176 Ga0501083_0022693
1177 Ga0501083_0048421
1178 Ga0501035_0001491
1179 Ga0501035_0028283
1180 Ga0501044_0002295
1181 Ga0501044_0041785
1182 Ga0501044_0074043
1183 Ga0501044_0103861
1184 Ga0501044_0117853
1185 Ga0501045_0007862
1186 nmdc:mga00v17_15439_c2
1187 nmdc:mga00v17_34999_c1
1188 nmdc:mga00v17_94333_c1
1189 nmdc:mga0yw44_2497_c1
1190 nmdc:mga0yw44_35377_c1
1191 nmdc:mga0yw44_39381_c1
1192 nmdc:mga0yw44_48124_c1
1193 nmdc:mga06z11_134684_c1
1194 nmdc:mga05p37_107099_c1
1195 nmdc:mga05p37_118300_c1
1196 nmdc:mga05p37_33282_c1
1197 nmdc:mga05p37_49759_c1
1198 nmdc:mga06r32_49570_c1
1199 nmdc:mga08y16_10273_c1
1200 nmdc:mga08y16_28191_c1
1201 nmdc:mga08y16_300379_c1
1202 nmdc:mga08y16_60961_c1
1203 nmdc:mga0rr50_88107_c1
1204 nmdc:mga0a205_16260_c1
1205 nmdc:mga0a205_43_c2
1206 nmdc:mga0a205_54292_c1
1207 Ga0495601_0000060
1208 Ga0495601_0011214
1209 Ga0495601_0062210
1210 Ga0495601_0110935
1211 Ga0495612_0000460
1212 Ga0495612_0001300
1213 Ga0495612_0010250
1214 Ga0495612_0062145
1215 Ga0495655_0000002
1216 Ga0495595_0000002
1217 Ga0495595_0020183
1218 Ga0495619_0000008
1219 Ga0495619_0000047
1220 Ga0495619_0000095
1221 Ga0495619_0000217
1222 Ga0495619_0000449
1223 Ga0495619_0004492
1224 Ga0495619_0009944
1225 Ga0495619_0018739
1226 Ga0500566_0014438
1227 Ga0500641_0004522
1228 Ga0500614_001518
1229 Ga0500628_000001
1230 Ga0500658_0035405
1231 Ga0501084_0031833
1232 Ga0501084_0145166
1233 Ga0501084_0157538
1234 Ga0501084_0278060
1235 Ga0501082_0015127
1236 Ga0501082_0026442
1237 Ga0501082_0117553
1238 Ga0530510_0010490

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01368

DHH

DHH family

42

184

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o25-assembly1.cif.gz_A structure of wildtype t.maritima pde (tm1595) in ligand-free state 0.9243 11 331
5o25-assembly1.cif.gz_A structure of wildtype t.maritima pde (tm1595) in ligand-free state 0.9078 11 331
5jju-assembly1.cif.gz_B crystal structure of rv2837c complexed with 5'-papa and 5'-amp 0.9045 11 334
5jju-assembly1.cif.gz_B crystal structure of rv2837c complexed with 5'-papa and 5'-amp 0.886 11 334
1sw5-assembly4.cif.gz_D crystal structure of prox from archeoglobus fulgidus in the ligand free form 0.8828 23 57
ID Description Score Start End Superfamily
af_Q2FXM3_201_313_3.10.310.30 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.9117 214 329 3.10.310.30
4py9A02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8943 210 330 3.10.310.30
4ls9B01 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core);inorganic pyrophosphatase (n-terminal core) 0.8942 16 203 3.90.1640.10
5ippA02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8838 214 331 3.10.310.30
af_Q2FXM3_201_313_3.10.310.30 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8743 214 329 3.10.310.30
ID Description Score Start End GO Terms
AF-A0A7X9GBH0-F1-model_v4 Bifunctional oligoribonuclease/PAP phosphatase NrnA 0.9545 208 332 GO:0003676
AF-K1YU68-F1-model_v4 DDH domain-containing protein 0.9474 11 299
AF-A0A1V5JR62-F1-model_v4 Bifunctional oligoribonuclease and PAP phosphatase NrnA (EC 3.1.-.-) 0.9474 210 331 GO:0003676
GO:0016787
AF-A0A3A0G8D8-F1-model_v4 Bifunctional oligoribonuclease/PAP phosphatase NrnA 0.9437 118 330 GO:0003676
AF-A0A7X9GBH0-F1-model_v4 Bifunctional oligoribonuclease/PAP phosphatase NrnA 0.9395 208 332 GO:0003676

Map