F469858

General Info

Members Datasets Scaffolds Average Seq Length
619 268 1238 137

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0149654|Ga0501033_0149654_1055_1555
Length 166
Sequence MLAGGELRHGVHVRRERGSLRRRHETPGDTVISQPIRILIAKVGLDGHDRGAKIVARALRDGGMDVIYTGLHRTPEEVVSAAVQEDVDVIGVSILSGAHMTLLPRILELLRASDAADVLLVAGGVIPDEDVPVLRDSGVAEIFLQETPPAALVARVRDLVETRRAG

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
166 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
167 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
168 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
169 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
189 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
190 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
191 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
192 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
193 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
194 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
195 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
196 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
197 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
222 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.81
Rhizosphere 99.19
Stem 0
Stem Tuber 0
Unclassified 1.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0149654 3300049570 Bacteria 1685
2 JGI26141J51220_1001595 3300003503 Bacteria 1372
3 Ga0065712_10675061 3300005290 Bacteria 557
4 Ga0065715_10234588 3300005293 Bacteria 1201
5 Ga0070676_10000025 3300005328 Bacteria 46204
6 Ga0070676_10011704 3300005328 Bacteria 4776
7 Ga0070690_100133450 3300005330 Bacteria 1679
8 Ga0070670_100038454 3300005331 Bacteria 4114
9 Ga0068869_100000205 3300005334 Bacteria 30762
10 Ga0068869_100027452 3300005334 Bacteria 3969
11 Ga0070680_100002677 3300005336 Bacteria 13202
12 Ga0070680_100133404 3300005336 Bacteria 2079
13 Ga0070682_100000180 3300005337 Bacteria 47178
14 Ga0068868_100073761 3300005338 Bacteria 2725
15 Ga0070660_100000428 3300005339 Bacteria 27846
16 Ga0070689_100158932 3300005340 Bacteria 1826
17 Ga0070689_100434135 3300005340 Bacteria 1115
18 Ga0070691_10004798 3300005341 Bacteria 6156
19 Ga0070691_10046408 3300005341 Bacteria 2063
20 Ga0070691_10064925 3300005341 Bacteria 1762
21 Ga0070691_10709308 3300005341 Bacteria 605
22 Ga0070687_100068462 3300005343 Bacteria 1898
23 Ga0070661_100000822 3300005344 Bacteria 22322
24 Ga0070692_10000133 3300005345 Bacteria 17791
25 Ga0070668_100852858 3300005347 Bacteria 812
26 Ga0070669_100649045 3300005353 Bacteria 888
27 Ga0070671_101016125 3300005355 Bacteria 727
28 Ga0070673_100014726 3300005364 Bacteria 5463
29 Ga0070659_100003379 3300005366 Bacteria 11365
30 Ga0070703_10123293 3300005406 Bacteria 943
31 Ga0070703_10156042 3300005406 Bacteria 862
32 Ga0070713_102330400 3300005436 Bacteria 518
33 Ga0070701_10061719 3300005438 Bacteria 1977
34 Ga0070701_10279822 3300005438 Bacteria 1018
35 Ga0070701_10409444 3300005438 Bacteria 861
36 Ga0070705_100000078 3300005440 Bacteria 53383
37 Ga0070705_100279900 3300005440 Bacteria 1185
38 Ga0070705_100570729 3300005440 Bacteria 870
39 Ga0070700_100020317 3300005441 Bacteria 3845
40 Ga0070694_100000656 3300005444 Bacteria 19138
41 Ga0070694_100002729 3300005444 Bacteria 10474
42 Ga0070694_100023706 3300005444 Bacteria 3951
43 Ga0070694_100092985 3300005444 Bacteria 2119
44 Ga0070694_100514161 3300005444 Bacteria 954
45 Ga0070708_100011090 3300005445 Bacteria 7322
46 Ga0070708_100056325 3300005445 Bacteria 3497
47 Ga0070708_100091473 3300005445 Bacteria 2771
48 Ga0070708_100131402 3300005445 Bacteria 2317
49 Ga0070708_100207098 3300005445 Bacteria 1837
50 Ga0070708_100235322 3300005445 Bacteria 1719
51 Ga0070708_100754913 3300005445 Bacteria 915
52 Ga0070663_100152558 3300005455 Bacteria 1773
53 Ga0070663_100990800 3300005455 Bacteria 730
54 Ga0070662_100753808 3300005457 Bacteria 826
55 Ga0070681_10061725 3300005458 Bacteria 3722
56 Ga0070681_10192940 3300005458 Bacteria 1956
57 Ga0070681_10504015 3300005458 Bacteria 1124
58 Ga0068867_100004170 3300005459 Bacteria 10169
59 Ga0068867_100010785 3300005459 Bacteria 6447
60 Ga0068867_100396359 3300005459 Bacteria 1163
61 Ga0070706_100099348 3300005467 Bacteria 2704
62 Ga0070706_100180428 3300005467 Bacteria 1971
63 Ga0070706_100427321 3300005467 Bacteria 1233
64 Ga0070706_100530460 3300005467 Bacteria 1095
65 Ga0070706_100581227 3300005467 Bacteria 1041
66 Ga0070707_100023174 3300005468 Bacteria 5873
67 Ga0070707_100057153 3300005468 Bacteria 3743
68 Ga0070707_100081846 3300005468 Bacteria 3117
69 Ga0070707_100190765 3300005468 Bacteria 1998
70 Ga0070707_101406691 3300005468 Bacteria 664
71 Ga0070707_101442829 3300005468 Bacteria 655
72 Ga0070698_100002570 3300005471 Bacteria 19982
73 Ga0070698_100013281 3300005471 Bacteria 8716
74 Ga0070698_100142353 3300005471 Bacteria 2349
75 Ga0070698_100193600 3300005471 Bacteria 1970
76 Ga0070698_100651291 3300005471 Bacteria 995
77 Ga0070699_100004138 3300005518 Bacteria 12816
78 Ga0070699_100011799 3300005518 Bacteria 7540
79 Ga0070699_100037436 3300005518 Bacteria 4198
80 Ga0070699_100039547 3300005518 Bacteria 4083
81 Ga0070699_100115835 3300005518 Bacteria 2355
82 Ga0070699_100160585 3300005518 Bacteria 1989
83 Ga0070699_100258733 3300005518 Bacteria 1556
84 Ga0070699_100319318 3300005518 Bacteria 1395
85 Ga0070699_100702458 3300005518 Bacteria 924
86 Ga0070679_100007425 3300005530 Bacteria 10242
87 Ga0070679_100487631 3300005530 Bacteria 1177
88 Ga0070684_101425606 3300005535 Bacteria 652
89 Ga0070697_100003917 3300005536 Bacteria 11435
90 Ga0070697_100040307 3300005536 Bacteria 3778
91 Ga0070697_100041574 3300005536 Bacteria 3721
92 Ga0070697_100043676 3300005536 Bacteria 3630
93 Ga0070697_100119316 3300005536 Bacteria 2205
94 Ga0070697_100206470 3300005536 Bacteria 1671
95 Ga0070697_100226327 3300005536 Bacteria 1594
96 Ga0070697_100435331 3300005536 Bacteria 1141
97 Ga0068853_100000255 3300005539 Bacteria 37353
98 Ga0070695_100001694 3300005545 Bacteria 12419
99 Ga0070695_100030093 3300005545 Bacteria 3378
100 Ga0070695_100054243 3300005545 Bacteria 2579
101 Ga0070695_100081344 3300005545 Bacteria 2143
102 Ga0070696_100001230 3300005546 Bacteria 16617
103 Ga0070696_100095963 3300005546 Bacteria 2118
104 Ga0070696_100200714 3300005546 Bacteria 1489
105 Ga0070696_100482067 3300005546 Bacteria 984
106 Ga0070693_100000163 3300005547 Bacteria 30819
107 Ga0070693_100012218 3300005547 Bacteria 4342
108 Ga0070704_100000731 3300005549 Bacteria 16084
109 Ga0070704_100221928 3300005549 Bacteria 1537
110 Ga0070704_101417181 3300005549 Bacteria 638
111 Ga0068855_100000612 3300005563 Bacteria 43896
112 Ga0070664_100094385 3300005564 Bacteria 2594
113 Ga0068857_100001797 3300005577 Bacteria 17256
114 Ga0068857_100028151 3300005577 Bacteria 4957
115 Ga0068854_100025201 3300005578 Bacteria 4081
116 Ga0068854_100133054 3300005578 Bacteria 1901
117 Ga0068854_100859549 3300005578 Bacteria 795
118 Ga0068856_100000630 3300005614 Bacteria 38381
119 Ga0070702_100040801 3300005615 Bacteria 2599
120 Ga0070702_100194263 3300005615 Bacteria 1338
121 Ga0068852_100118419 3300005616 Bacteria 2420
122 Ga0068859_100001373 3300005617 Bacteria 24750
123 Ga0068859_100565819 3300005617 Bacteria 1231
124 Ga0068859_100571901 3300005617 Bacteria 1224
125 Ga0068866_10099127 3300005718 Bacteria 1604
126 Ga0068861_100037179 3300005719 Bacteria 3619
127 Ga0068870_10000221 3300005840 Bacteria 20755
128 Ga0068870_10026265 3300005840 Bacteria 2902
129 Ga0068863_100022279 3300005841 Bacteria 6048
130 Ga0068858_101536322 3300005842 Bacteria 657
131 Ga0068860_100006069 3300005843 Bacteria 12161
132 Ga0068862_100001036 3300005844 Bacteria 26683
133 Ga0068862_100138891 3300005844 Bacteria 2156
134 Ga0068862_100186520 3300005844 Bacteria 1864
135 Ga0081455_10002783 3300005937 Bacteria 20602
136 Ga0081455_10828678 3300005937 Bacteria 579
137 Ga0070715_10080313 3300006163 Bacteria 1479
138 Ga0070716_100156778 3300006173 Bacteria 1471
139 Ga0070716_100574276 3300006173 Bacteria 844
140 Ga0068871_100300844 3300006358 Bacteria 1408
141 Ga0075428_100146981 3300006844 Bacteria 2562
142 Ga0075430_100006024 3300006846 Bacteria 10227
143 Ga0075430_100090703 3300006846 Bacteria 2556
144 Ga0075430_100097971 3300006846 Bacteria 2450
145 Ga0075431_100000545 3300006847 Bacteria 31644
146 Ga0075431_100014658 3300006847 Bacteria 7931
147 Ga0075431_100030037 3300006847 Bacteria 5596
148 Ga0075431_100037960 3300006847 Bacteria 4959
149 Ga0075431_100161543 3300006847 Bacteria 2303
150 Ga0075431_100605948 3300006847 Bacteria 1079
151 Ga0075431_101372621 3300006847 Bacteria 667
152 Ga0075433_10004845 3300006852 Bacteria 10523
153 Ga0075433_10100818 3300006852 Bacteria 2557
154 Ga0075433_10173881 3300006852 Bacteria 1916
155 Ga0075433_10416632 3300006852 Bacteria 1185
156 Ga0075433_10422885 3300006852 Bacteria 1175
157 Ga0075434_100015216 3300006871 Bacteria 7372
158 Ga0075434_100029618 3300006871 Bacteria 5387
159 Ga0075434_100082923 3300006871 Bacteria 3203
160 Ga0075434_100089103 3300006871 Bacteria 3087
161 Ga0075434_100198110 3300006871 Bacteria 2028
162 Ga0075434_100360388 3300006871 Bacteria 1475
163 Ga0075434_100698760 3300006871 Bacteria 1032
164 Ga0075434_100848119 3300006871 Archaea 929
165 Ga0075429_100052876 3300006880 Bacteria 3533
166 Ga0075429_100069650 3300006880 Bacteria 3063
167 Ga0075429_100181208 3300006880 Bacteria 1846
168 Ga0075429_100799680 3300006880 Bacteria 826
169 Ga0075436_100117044 3300006914 Bacteria 1863
170 Ga0075436_100247907 3300006914 Bacteria 1268
171 Ga0097620_100001373 3300006931 Bacteria 24750
172 Ga0097620_100565730 3300006931 Bacteria 1231
173 Ga0097620_100571910 3300006931 Bacteria 1224
174 Ga0075435_100024469 3300007076 Bacteria 4687
175 Ga0075435_100071470 3300007076 Bacteria 2834
176 Ga0075435_100071626 3300007076 Bacteria 2830
177 Ga0075435_100138485 3300007076 Bacteria 2040
178 Ga0075435_101053728 3300007076 Bacteria 710
179 Ga0099794_10002650 3300007265 Bacteria 6657
180 Ga0099794_10012752 3300007265 Bacteria 3639
181 Ga0099794_10200312 3300007265 Bacteria 1022
182 Ga0099795_10277063 3300007788 Bacteria 731
183 Ga0105245_10134667 3300009098 Bacteria 2321
184 Ga0105245_10216986 3300009098 Bacteria 1844
185 Ga0114129_10004541 3300009147 Bacteria 19592
186 Ga0114129_10014190 3300009147 Bacteria 11352
187 Ga0114129_10043463 3300009147 Bacteria 6321
188 Ga0114129_10125672 3300009147 Bacteria 3526
189 Ga0114129_10169170 3300009147 Bacteria 2981
190 Ga0114129_10349763 3300009147 Bacteria 1958
191 Ga0114129_11479981 3300009147 Bacteria 835
192 Ga0105243_10025283 3300009148 Bacteria 4535
193 Ga0105243_10162738 3300009148 Bacteria 1925
194 Ga0105243_10436877 3300009148 Bacteria 1225
195 Ga0105241_10002642 3300009174 Bacteria 13423
196 Ga0105241_10780781 3300009174 Bacteria 878
197 Ga0105242_10035280 3300009176 Bacteria 4011
198 Ga0105242_10324341 3300009176 Bacteria 1413
199 Ga0105242_10510090 3300009176 Bacteria 1145
200 Ga0105248_10244989 3300009177 Bacteria 2018
201 Ga0105237_10761955 3300009545 Bacteria 974
202 Ga0105237_11083508 3300009545 Bacteria 808
203 Ga0105249_10051030 3300009553 Bacteria 3772
204 Ga0105249_10644916 3300009553 Bacteria 1116
205 Ga0105249_12747594 3300009553 Bacteria 564
206 Ga0105239_10203855 3300010375 Bacteria 2216
207 Ga0105246_10443660 3300011119 Bacteria 1089
208 Ga0105246_10722678 3300011119 Bacteria 875
209 Ga0157373_10000727 3300013100 Bacteria 25722
210 Ga0157369_10007825 3300013105 Bacteria 12301
211 Ga0157378_10316852 3300013297 Bacteria 1514
212 Ga0157372_10009278 3300013307 Bacteria 10464
213 Ga0157372_10531290 3300013307 Bacteria 1371
214 Ga0157375_10182483 3300013308 Bacteria 2251
215 Ga0157375_11546596 3300013308 Bacteria 783
216 Ga0163163_10357266 3300014325 Bacteria 1517
217 Ga0163163_11339994 3300014325 Bacteria 778
218 Ga0157380_10063627 3300014326 Bacteria 2959
219 Ga0157380_10728842 3300014326 Bacteria 1000
220 Ga0157377_10694372 3300014745 Bacteria 738
221 Ga0207653_10009510 3300025885 Bacteria 3030
222 Ga0207653_10113617 3300025885 Bacteria 969
223 Ga0207642_10139083 3300025899 Bacteria 1278
224 Ga0207688_10085278 3300025901 Bacteria 1809
225 Ga0207647_10031474 3300025904 Bacteria 3414
226 Ga0207685_10141601 3300025905 Bacteria 1079
227 Ga0207645_10000170 3300025907 Bacteria 51882
228 Ga0207645_10043249 3300025907 Bacteria 2883
229 Ga0207643_10000051 3300025908 Bacteria 77737
230 Ga0207684_10003991 3300025910 Bacteria 14116
231 Ga0207684_10026668 3300025910 Bacteria 4925
232 Ga0207684_10057050 3300025910 Bacteria 3313
233 Ga0207684_10066495 3300025910 Bacteria 3061
234 Ga0207684_10111519 3300025910 Bacteria 2341
235 Ga0207684_10253494 3300025910 Bacteria 1518
236 Ga0207684_10522024 3300025910 Bacteria 1017
237 Ga0207684_10522523 3300025910 Bacteria 1017
238 Ga0207654_10001033 3300025911 Bacteria 15228
239 Ga0207707_10000453 3300025912 Bacteria 42710
240 Ga0207707_10097202 3300025912 Bacteria 2573
241 Ga0207707_10225065 3300025912 Bacteria 1633
242 Ga0207707_10971359 3300025912 Bacteria 698
243 Ga0207671_10167952 3300025914 Bacteria 1702
244 Ga0207663_10138435 3300025916 Bacteria 1692
245 Ga0207660_10000203 3300025917 Bacteria 38120
246 Ga0207660_10081436 3300025917 Bacteria 2379
247 Ga0207662_10066768 3300025918 Bacteria 2168
248 Ga0207657_10000357 3300025919 Bacteria 48334
249 Ga0207649_10010062 3300025920 Bacteria 5189
250 Ga0207652_10032750 3300025921 Bacteria 4372
251 Ga0207646_10001207 3300025922 Bacteria 32503
252 Ga0207646_10020502 3300025922 Bacteria 6124
253 Ga0207646_10269445 3300025922 Bacteria 1539
254 Ga0207646_10578114 3300025922 Bacteria 1009
255 Ga0207646_10878232 3300025922 Bacteria 796
256 Ga0207646_11026536 3300025922 Bacteria 728
257 Ga0207681_10033960 3300025923 Bacteria 3350
258 Ga0207650_10016809 3300025925 Bacteria 5117
259 Ga0207687_10215023 3300025927 Bacteria 1510
260 Ga0207700_10626193 3300025928 Bacteria 958
261 Ga0207644_10491855 3300025931 Bacteria 1011
262 Ga0207690_10000611 3300025932 Bacteria 23074
263 Ga0207706_10035870 3300025933 Bacteria 4406
264 Ga0207706_10259629 3300025933 Bacteria 1517
265 Ga0207706_10767628 3300025933 Bacteria 821
266 Ga0207706_10824759 3300025933 Bacteria 787
267 Ga0207686_10327696 3300025934 Bacteria 1146
268 Ga0207709_10020463 3300025935 Bacteria 3733
269 Ga0207709_10105720 3300025935 Bacteria 1871
270 Ga0207670_10392326 3300025936 Bacteria 1108
271 Ga0207670_10673712 3300025936 Bacteria 854
272 Ga0207665_10005953 3300025939 Bacteria 8114
273 Ga0207665_10344901 3300025939 Bacteria 1123
274 Ga0207711_10362074 3300025941 Bacteria 1344
275 Ga0207689_10000296 3300025942 Bacteria 45380
276 Ga0207689_10008186 3300025942 Bacteria 9109
277 Ga0207689_10261093 3300025942 Bacteria 1433
278 Ga0207679_10000233 3300025945 Bacteria 42806
279 Ga0207667_10001733 3300025949 Bacteria 27447
280 Ga0207651_10272224 3300025960 Bacteria 1395
281 Ga0207712_10419101 3300025961 Bacteria 1129
282 Ga0207712_10632541 3300025961 Bacteria 928
283 Ga0207640_10002914 3300025981 Bacteria 9190
284 Ga0207640_10232213 3300025981 Bacteria 1420
285 Ga0207677_10013536 3300026023 Bacteria 4732
286 Ga0207639_10000673 3300026041 Bacteria 23595
287 Ga0207678_10003802 3300026067 Bacteria 13577
288 Ga0207678_10428988 3300026067 Bacteria 1147
289 Ga0207708_10034237 3300026075 Bacteria 3863
290 Ga0207708_10333409 3300026075 Bacteria 1241
291 Ga0207702_10001254 3300026078 Bacteria 25608
292 Ga0207648_10003252 3300026089 Bacteria 17090
293 Ga0207648_10336460 3300026089 Bacteria 1359
294 Ga0207676_10042550 3300026095 Bacteria 3494
295 Ga0207674_10000836 3300026116 Bacteria 40167
296 Ga0207674_10009144 3300026116 Bacteria 11363
297 Ga0207675_100007334 3300026118 Bacteria 10417
298 Ga0207675_100399613 3300026118 Bacteria 1354
299 Ga0207698_10044174 3300026142 Bacteria 3346
300 Ga0209969_1006370 3300027360 Bacteria 1662
301 Ga0209967_1015516 3300027364 Bacteria 1090
302 Ga0209996_1005890 3300027395 Bacteria 1574
303 Ga0209984_1060819 3300027424 Bacteria 559
304 Ga0209995_1001622 3300027471 Bacteria 3495
305 Ga0209999_1047109 3300027543 Bacteria 812
306 Ga0209982_1005033 3300027552 Bacteria 1906
307 Ga0210002_1011346 3300027617 Bacteria 1376
308 Ga0209983_1005137 3300027665 Bacteria 2722
309 Ga0209588_1008161 3300027671 Bacteria 3100
310 Ga0209971_1000060 3300027682 Bacteria 34835
311 Ga0209966_1000312 3300027695 Bacteria 15867
312 Ga0209998_10000006 3300027717 Bacteria 101038
313 Ga0209974_10006984 3300027876 Bacteria 3908
314 Ga0209974_10094618 3300027876 Bacteria 1039
315 Ga0207428_10003162 3300027907 Bacteria 16133
316 Ga0268265_10002892 3300028380 Bacteria 12614
317 Ga0268265_10014365 3300028380 Bacteria 5394
318 Ga0268265_10032541 3300028380 Bacteria 3781
319 Ga0268265_10230034 3300028380 Bacteria 1629
320 Ga0268264_10091495 3300028381 Bacteria 2624
321 Ga0268264_10125040 3300028381 Bacteria 2272
322 Ga0307408_100126830 3300031548 Bacteria 1986
323 Ga0307408_100368521 3300031548 Bacteria 1224
324 Ga0307408_101677178 3300031548 Bacteria 605
325 Ga0307405_10294654 3300031731 Bacteria 1228
326 Ga0307405_10704157 3300031731 Bacteria 837
327 Ga0307405_11084089 3300031731 Bacteria 687
328 Ga0307410_10192193 3300031852 Bacteria 1553
329 Ga0307407_10440465 3300031903 Bacteria 943
330 Ga0307409_100208349 3300031995 Bacteria 1755
331 Ga0307409_100263467 3300031995 Bacteria 1583
332 Ga0307416_100488701 3300032002 Bacteria 1293
333 Ga0307414_11031382 3300032004 Bacteria 758
334 Ga0307414_11086952 3300032004 Bacteria 738
335 Ga0307411_10403184 3300032005 Bacteria 1131
336 Ga0373958_0063145 3300034819 Bacteria 807
337 Ga0373926_0029359 3300035083 Bacteria 1933
338 Ga0373928_0263328 3300035084 Bacteria 517
339 Ga0373940_0001445 3300035088 Bacteria 4300
340 Ga0373949_0137207 3300035090 Bacteria 698
341 Ga0373951_0026697 3300035091 Bacteria 1346
342 Ga0373952_0169007 3300035092 Bacteria 624
343 Ga0373923_0026197 3300035111 Bacteria 2318
344 Ga0373932_0043535 3300035112 Bacteria 1306
345 Ga0373932_0418697 3300035112 Bacteria 521
346 Ga0373936_0431355 3300035113 Unclassified 608
347 Ga0373941_0138085 3300035115 Bacteria 884
348 Ga0373953_0178699 3300035117 Bacteria 915
349 Ga0373954_0036560 3300035118 Unclassified 2280
350 Ga0373956_0371313 3300035119 Unclassified 682
351 Ga0373960_0385094 3300035121 Bacteria 538
352 Ga0373961_0092475 3300035241 Bacteria 968
353 Ga0373962_0017064 3300035242 Bacteria 1879
354 Ga0373931_0009986 3300035691 Bacteria 4552
355 Ga0373931_0338479 3300035691 Bacteria 939
356 Ga0373931_0649534 3300035691 Bacteria 693
357 Ga0373927_0002662 3300035695 Bacteria 13015
358 Ga0373947_0094567 3300035725 Bacteria 1869
359 Ga0373937_0107616 3300036401 Bacteria 2592
360 Ga0316582_1170762 3300036647 Bacteria 523
361 Ga0373925_0335570 3300037068 Bacteria 1225
362 Ga0242420_016627 3300038996 Bacteria 1283
363 Ga0242420_049629 3300038996 Bacteria 818
364 Ga0242420_080854 3300038996 Bacteria 671
365 Ga0439441_067715 3300042001 Bacteria 761
366 Ga0439448_0003529 3300042005 Bacteria 4339
367 Ga0450919_014539 3300042121 Bacteria 889
368 Ga0450902_018119 3300042137 Bacteria 1153
369 Ga0439458_0155110 3300042157 Bacteria 615
370 Ga0439459_0001209 3300042438 Bacteria 3772
371 Ga0439464_0006796 3300042439 Bacteria 2983
372 Ga0439460_0011704 3300042461 Bacteria 2266
373 Ga0450893_0069739 3300042532 Bacteria 682
374 Ga0451577_0001849 3300042876 Bacteria 26989
375 Ga0451577_0006203 3300042876 Bacteria 11993
376 Ga0451577_0045895 3300042876 Bacteria 3910
377 Ga0451577_0284671 3300042876 Bacteria 1498
378 Ga0451577_1208841 3300042876 Bacteria 674
379 Ga0451577_1344837 3300042876 Bacteria 634
380 Ga0453683_0016419 3300044673 Bacteria 4777
381 Ga0453683_0045587 3300044673 Bacteria 2749
382 Ga0453683_0056973 3300044673 Bacteria 2445
383 Ga0453683_0355306 3300044673 Bacteria 942
384 Ga0453684_0023282 3300044712 Bacteria 9134
385 Ga0453684_0054480 3300044712 Bacteria 5209
386 Ga0453684_0554652 3300044712 Bacteria 1265
387 Ga0466960_0003069 3300044901 Bacteria 6383
388 Ga0451576_0024592 3300045051 Bacteria 6504
389 Ga0451576_0028962 3300045051 Bacteria 5930
390 Ga0451576_0048881 3300045051 Bacteria 4440
391 Ga0451576_0113182 3300045051 Bacteria 2824
392 Ga0451576_0224813 3300045051 Bacteria 1960
393 Ga0451576_1437401 3300045051 Bacteria 717
394 Ga0495580_0014168 3300046472 Bacteria 6055
395 Ga0495580_0111626 3300046472 Bacteria 1899
396 Ga0495580_0362882 3300046472 Bacteria 980
397 Ga0495580_0748528 3300046472 Bacteria 637
398 Ga0495639_0142212 3300046475 Bacteria 1154
399 Ga0495664_0422638 3300046477 Unclassified 799
400 Ga0495584_0288423 3300046491 Bacteria 834
401 Ga0495665_0024426 3300046531 Bacteria 3247
402 Ga0495645_0467641 3300046543 Unclassified 793
403 Ga0495667_0639261 3300046559 Unclassified 661
404 Ga0495634_0617555 3300046642 Unclassified 628
405 Ga0495635_0245388 3300046663 Bacteria 1208
406 Ga0495659_0191122 3300046664 Bacteria 837
407 Ga0495674_0197269 3300047319 Bacteria 1671
408 Ga0495675_0300134 3300047444 Unclassified 954
409 Ga0495684_0141424 3300047471 Bacteria 1804
410 Ga0496102_0010781 3300048905 Bacteria 7871
411 Ga0496107_0670324 3300048910 Bacteria 764
412 Ga0496108_1234191 3300048911 Bacteria 631
413 Ga0496110_1542235 3300048913 Bacteria 574
414 Ga0496112_0170862 3300048915 Bacteria 2139
415 Ga0501292_103270 3300049515 Bacteria 567
416 Ga0501299_159711 3300049522 Bacteria 575
417 Ga0501031_0005375 3300049568 Bacteria 8342
418 Ga0501031_0101748 3300049568 Bacteria 1875
419 Ga0501031_0146869 3300049568 Bacteria 1541
420 Ga0501031_0341284 3300049568 Bacteria 970
421 Ga0501032_0850245 3300049569 Bacteria 575
422 Ga0501033_0005375 3300049570 Bacteria 10150
423 Ga0501033_0031121 3300049570 Bacteria 4012
424 Ga0501033_1014260 3300049570 Bacteria 554
425 Ga0501034_0234985 3300049571 Unclassified 1781
426 Ga0501036_0000146 3300049572 Bacteria 46028
427 Ga0501036_0101892 3300049572 Bacteria 2429
428 Ga0501036_0189248 3300049572 Bacteria 1732
429 Ga0501036_0422683 3300049572 Bacteria 1111
430 Ga0501036_0464140 3300049572 Bacteria 1054
431 Ga0501036_0498789 3300049572 Bacteria 1013
432 Ga0501037_0010082 3300049573 Bacteria 6932
433 Ga0501037_0038927 3300049573 Bacteria 3502
434 Ga0501038_0000983 3300049574 Bacteria 25585
435 Ga0501038_0118241 3300049574 Bacteria 2189
436 Ga0501039_0000223 3300049575 Bacteria 41655
437 Ga0501039_0025015 3300049575 Bacteria 4585
438 Ga0501039_0251693 3300049575 Bacteria 1389
439 Ga0501039_0266358 3300049575 Bacteria 1347
440 Ga0501040_0000373 3300049576 Bacteria 26428
441 Ga0501040_0001289 3300049576 Bacteria 15954
442 Ga0501040_0150913 3300049576 Bacteria 1639
443 Ga0501040_0173671 3300049576 Bacteria 1526
444 Ga0501040_0219686 3300049576 Bacteria 1352
445 Ga0501040_0490831 3300049576 Bacteria 885
446 Ga0501040_0674163 3300049576 Bacteria 747
447 Ga0501041_0000014 3300049577 Bacteria 57214
448 Ga0501041_0002902 3300049577 Bacteria 9823
449 Ga0501041_0006533 3300049577 Bacteria 6829
450 Ga0501041_0063689 3300049577 Bacteria 2258
451 Ga0501041_0163382 3300049577 Bacteria 1392
452 Ga0501042_0000029 3300049578 Bacteria 46395
453 Ga0501042_0003204 3300049578 Bacteria 10226
454 Ga0501042_0022065 3300049578 Bacteria 4444
455 Ga0501042_0198126 3300049578 Bacteria 1448
456 Ga0501042_0201451 3300049578 Bacteria 1435
457 Ga0501042_0648134 3300049578 Bacteria 768
458 Ga0501042_0722615 3300049578 Bacteria 724
459 Ga0501043_0009232 3300049579 Bacteria 7750
460 Ga0501043_0046014 3300049579 Bacteria 3431
461 Ga0501043_0814201 3300049579 Bacteria 675
462 Ga0501043_0844840 3300049579 Bacteria 660
463 Ga0501046_0000544 3300049580 Bacteria 37450
464 Ga0501046_0001711 3300049580 Bacteria 20954
465 Ga0501046_0086321 3300049580 Bacteria 2419
466 Ga0501047_0063964 3300049581 Bacteria 3549
467 Ga0501048_0000167 3300049582 Bacteria 41216
468 Ga0501048_0004989 3300049582 Bacteria 10122
469 Ga0501048_1125911 3300049582 Bacteria 565
470 Ga0501048_1143711 3300049582 Bacteria 560
471 Ga0501068_0011732 3300049584 Bacteria 4955
472 Ga0501068_0229756 3300049584 Bacteria 1180
473 Ga0501068_0408836 3300049584 Bacteria 875
474 Ga0501069_0012731 3300049585 Bacteria 4478
475 Ga0501069_0206461 3300049585 Bacteria 1139
476 Ga0501069_0951347 3300049585 Bacteria 524
477 Ga0501070_0013294 3300049586 Bacteria 6942
478 Ga0501070_0205809 3300049586 Bacteria 1616
479 Ga0501071_0000123 3300049587 Bacteria 31110
480 Ga0501071_0053860 3300049587 Bacteria 2902
481 Ga0501071_0082326 3300049587 Bacteria 2357
482 Ga0501071_0109461 3300049587 Bacteria 2041
483 Ga0501071_0189175 3300049587 Bacteria 1543
484 Ga0501071_0199218 3300049587 Bacteria 1504
485 Ga0501071_0223076 3300049587 Bacteria 1419
486 Ga0501071_0394029 3300049587 Bacteria 1057
487 Ga0501071_0870074 3300049587 Bacteria 695
488 Ga0501072_0000091 3300049588 Bacteria 65812
489 Ga0501072_0035233 3300049588 Bacteria 3923
490 Ga0501072_0074417 3300049588 Bacteria 2686
491 Ga0501072_0093129 3300049588 Bacteria 2393
492 Ga0501072_0129735 3300049588 Bacteria 2009
493 Ga0501072_0288655 3300049588 Bacteria 1304
494 Ga0501072_0624117 3300049588 Bacteria 849
495 Ga0501073_0006844 3300049589 Bacteria 8477
496 Ga0501074_0005032 3300049590 Bacteria 9485
497 Ga0501074_0006054 3300049590 Bacteria 8730
498 Ga0501074_0358818 3300049590 Bacteria 1034
499 Ga0501074_0466311 3300049590 Bacteria 895
500 Ga0501075_0000005 3300049591 Bacteria 112003
501 Ga0501075_0006543 3300049591 Bacteria 8025
502 Ga0501075_0021176 3300049591 Bacteria 4738
503 Ga0501075_0066538 3300049591 Bacteria 2719
504 Ga0501075_0206365 3300049591 Bacteria 1499
505 Ga0501075_0374383 3300049591 Bacteria 1085
506 Ga0501076_0000024 3300049592 Bacteria 78719
507 Ga0501076_0027512 3300049592 Bacteria 4409
508 Ga0501076_0049743 3300049592 Bacteria 3316
509 Ga0501076_0060399 3300049592 Bacteria 3016
510 Ga0501076_0063233 3300049592 Bacteria 2949
511 Ga0501076_0231554 3300049592 Bacteria 1510
512 Ga0501076_0340278 3300049592 Bacteria 1231
513 Ga0501077_0000025 3300049593 Bacteria 76265
514 Ga0501077_0061153 3300049593 Bacteria 2390
515 Ga0501077_0104695 3300049593 Bacteria 1793
516 Ga0501077_0282172 3300049593 Bacteria 1057
517 Ga0501077_0331787 3300049593 Bacteria 970
518 Ga0501225_0336962 3300049705 Bacteria 519
519 Ga0501079_0000025 3300049741 Bacteria 62163
520 Ga0501079_0000760 3300049741 Bacteria 21994
521 Ga0501079_0008890 3300049741 Bacteria 7605
522 Ga0501079_0105145 3300049741 Bacteria 2190
523 Ga0501079_0141205 3300049741 Bacteria 1876
524 Ga0501079_0273270 3300049741 Bacteria 1321
525 Ga0501079_0367151 3300049741 Bacteria 1128
526 Ga0501079_0645702 3300049741 Bacteria 833
527 Ga0501079_0702303 3300049741 Bacteria 796
528 Ga0501079_0981790 3300049741 Bacteria 665
529 Ga0501080_0001141 3300049742 Bacteria 21887
530 Ga0501080_0633180 3300049742 Bacteria 947
531 Ga0501080_1223150 3300049742 Bacteria 645
532 Ga0501081_0000007 3300049743 Bacteria 73600
533 Ga0501081_0019125 3300049743 Bacteria 4556
534 Ga0501081_0020663 3300049743 Bacteria 4390
535 Ga0501081_0057687 3300049743 Bacteria 2685
536 Ga0501081_0087750 3300049743 Bacteria 2185
537 Ga0501081_0248486 3300049743 Bacteria 1298
538 Ga0501081_0297579 3300049743 Bacteria 1183
539 Ga0501081_0310626 3300049743 Bacteria 1157
540 Ga0501081_0352133 3300049743 Bacteria 1085
541 Ga0501081_0889834 3300049743 Bacteria 671
542 Ga0501083_0011123 3300049744 Bacteria 6318
543 Ga0501083_0198248 3300049744 Bacteria 1310
544 Ga0501083_0723727 3300049744 Bacteria 647
545 Ga0501035_0002582 3300049822 Bacteria 17689
546 Ga0501044_0892185 3300049823 Archaea 764
547 Ga0501044_1263924 3300049823 Bacteria 605
548 Ga0501045_0000003 3300049824 Bacteria 88725
549 Ga0501045_0000717 3300049824 Bacteria 21085
550 Ga0501045_0032051 3300049824 Bacteria 3807
551 Ga0501045_0151748 3300049824 Bacteria 1724
552 Ga0501045_0298344 3300049824 Bacteria 1199
553 nmdc:mga05p37_213226_c1 3300050507 Bacteria 2333
554 nmdc:mga05p37_219186_c1 3300050507 Bacteria 2297
555 nmdc:mga05p37_30934_c1 3300050507 Bacteria 6535
556 nmdc:mga05p37_372580_c1 3300050507 Bacteria 1675
557 nmdc:mga05p37_37320_c1 3300050507 Bacteria 5957
558 nmdc:mga05p37_506035_c1 3300050507 Bacteria 1385
559 nmdc:mga05p37_6819_c1 3300050507 Bacteria 13458
560 nmdc:mga05p37_7414_c1 3300050507 Bacteria 12942
561 nmdc:mga09592_10601_c1 3300050508 Bacteria 7504
562 nmdc:mga09592_163585_c1 3300050508 Bacteria 1923
563 nmdc:mga09592_648166_c1 3300050508 Bacteria 902
564 nmdc:mga0qj67_180393_c1 3300050509 Bacteria 1715
565 nmdc:mga0qj67_478812_c1 3300050509 Bacteria 1002
566 nmdc:mga06r32_194954_c1 3300050510 Bacteria 2013
567 nmdc:mga06r32_381000_c1 3300050510 Bacteria 1393
568 nmdc:mga06r32_44114_c1 3300050510 Bacteria 4245
569 nmdc:mga06r32_44537_c1 3300050510 Bacteria 4226
570 nmdc:mga06r32_543614_c1 3300050510 Bacteria 1136
571 nmdc:mga08y16_2190_c1 3300050511 Bacteria 20049
572 nmdc:mga0n895_1127572_c1 3300050512 Bacteria 761
573 nmdc:mga0n895_17203_c1 3300050512 Bacteria 6662
574 nmdc:mga0n895_2180639_c1 3300050512 Bacteria 510
575 nmdc:mga0n895_232505_c1 3300050512 Bacteria 1871
576 nmdc:mga0n895_295787_c1 3300050512 Bacteria 1641
577 nmdc:mga0n895_39410_c1 3300050512 Bacteria 4584
578 nmdc:mga0n895_628725_c1 3300050512 Bacteria 1074
579 nmdc:mga0n895_678508_c1 3300050512 Bacteria 1027
580 nmdc:mga0n895_855732_c1 3300050512 Bacteria 897
581 nmdc:mga0rr50_10901_c1 3300050513 Bacteria 5796
582 nmdc:mga0rr50_15502_c1 3300050513 Bacteria 5033
583 nmdc:mga0rr50_471419_c1 3300050513 Unclassified 1066
584 nmdc:mga0rr50_58883_c1 3300050513 Bacteria 2881
585 nmdc:mga08x19_1162248_c1 3300050514 Bacteria 547
586 nmdc:mga08x19_677641_c1 3300050514 Bacteria 732
587 nmdc:mga08x19_78596_c1 3300050514 Bacteria 2163
588 nmdc:mga0a205_1779_c1 3300050515 Bacteria 18627
589 nmdc:mga0a205_182435_c2 3300050515 Bacteria 1357
590 nmdc:mga0a205_262615_c1 3300050515 Bacteria 1604
591 nmdc:mga0a205_5773_c1 3300050515 Bacteria 11158
592 nmdc:mga0a205_653556_c1 3300050515 Bacteria 903
593 nmdc:mga0a205_740416_c1 3300050515 Bacteria 832
594 nmdc:mga0a205_8715_c1 3300050515 Bacteria 9238
595 Ga0501084_0000398 3300054114 Bacteria 33453
596 Ga0501084_0002865 3300054114 Bacteria 13943
597 Ga0501084_0030896 3300054114 Bacteria 4478
598 Ga0501084_0663789 3300054114 Bacteria 880
599 Ga0590071_027846 3300059421 Bacteria 1342
600 Ga0590077_068774 3300059426 Bacteria 807
601 Ga0501082_0000062 3300060353 Bacteria 77313
602 Ga0501082_0015483 3300060353 Bacteria 6564
603 Ga0501082_0024763 3300060353 Bacteria 5174
604 Ga0501082_0046990 3300060353 Bacteria 3720
605 Ga0501082_0056125 3300060353 Bacteria 3392
606 Ga0501082_0129223 3300060353 Bacteria 2192
607 Ga0501082_0246933 3300060353 Bacteria 1553
608 Ga0501082_1135048 3300060353 Bacteria 683
609 Ga0501082_1441947 3300060353 Bacteria 601
610 Ga0530510_0000062 3300061734 Bacteria 52768
611 Ga0530510_0004377 3300061734 Bacteria 9774
612 Ga0530510_0009989 3300061734 Bacteria 6659
613 Ga0530510_0014717 3300061734 Bacteria 5523
614 Ga0530510_0026226 3300061734 Bacteria 4169
615 Ga0530510_0188734 3300061734 Bacteria 1530
616 Ga0530510_0209667 3300061734 Bacteria 1448
617 Ga0530510_0457301 3300061734 Bacteria 965
618 Ga0530510_0579831 3300061734 Bacteria 853
619 Ga0530510_1004391 3300061734 Bacteria 638
620 Ga0501033_0149654
621 JGI26141J51220_1001595
622 Ga0065712_10675061
623 Ga0065715_10234588
624 Ga0070676_10000025
625 Ga0070676_10011704
626 Ga0070690_100133450
627 Ga0070670_100038454
628 Ga0068869_100000205
629 Ga0068869_100027452
630 Ga0070680_100002677
631 Ga0070680_100133404
632 Ga0070682_100000180
633 Ga0068868_100073761
634 Ga0070660_100000428
635 Ga0070689_100158932
636 Ga0070689_100434135
637 Ga0070691_10004798
638 Ga0070691_10046408
639 Ga0070691_10064925
640 Ga0070691_10709308
641 Ga0070687_100068462
642 Ga0070661_100000822
643 Ga0070692_10000133
644 Ga0070668_100852858
645 Ga0070669_100649045
646 Ga0070671_101016125
647 Ga0070673_100014726
648 Ga0070659_100003379
649 Ga0070703_10123293
650 Ga0070703_10156042
651 Ga0070713_102330400
652 Ga0070701_10061719
653 Ga0070701_10279822
654 Ga0070701_10409444
655 Ga0070705_100000078
656 Ga0070705_100279900
657 Ga0070705_100570729
658 Ga0070700_100020317
659 Ga0070694_100000656
660 Ga0070694_100002729
661 Ga0070694_100023706
662 Ga0070694_100092985
663 Ga0070694_100514161
664 Ga0070708_100011090
665 Ga0070708_100056325
666 Ga0070708_100091473
667 Ga0070708_100131402
668 Ga0070708_100207098
669 Ga0070708_100235322
670 Ga0070708_100754913
671 Ga0070663_100152558
672 Ga0070663_100990800
673 Ga0070662_100753808
674 Ga0070681_10061725
675 Ga0070681_10192940
676 Ga0070681_10504015
677 Ga0068867_100004170
678 Ga0068867_100010785
679 Ga0068867_100396359
680 Ga0070706_100099348
681 Ga0070706_100180428
682 Ga0070706_100427321
683 Ga0070706_100530460
684 Ga0070706_100581227
685 Ga0070707_100023174
686 Ga0070707_100057153
687 Ga0070707_100081846
688 Ga0070707_100190765
689 Ga0070707_101406691
690 Ga0070707_101442829
691 Ga0070698_100002570
692 Ga0070698_100013281
693 Ga0070698_100142353
694 Ga0070698_100193600
695 Ga0070698_100651291
696 Ga0070699_100004138
697 Ga0070699_100011799
698 Ga0070699_100037436
699 Ga0070699_100039547
700 Ga0070699_100115835
701 Ga0070699_100160585
702 Ga0070699_100258733
703 Ga0070699_100319318
704 Ga0070699_100702458
705 Ga0070679_100007425
706 Ga0070679_100487631
707 Ga0070684_101425606
708 Ga0070697_100003917
709 Ga0070697_100040307
710 Ga0070697_100041574
711 Ga0070697_100043676
712 Ga0070697_100119316
713 Ga0070697_100206470
714 Ga0070697_100226327
715 Ga0070697_100435331
716 Ga0068853_100000255
717 Ga0070695_100001694
718 Ga0070695_100030093
719 Ga0070695_100054243
720 Ga0070695_100081344
721 Ga0070696_100001230
722 Ga0070696_100095963
723 Ga0070696_100200714
724 Ga0070696_100482067
725 Ga0070693_100000163
726 Ga0070693_100012218
727 Ga0070704_100000731
728 Ga0070704_100221928
729 Ga0070704_101417181
730 Ga0068855_100000612
731 Ga0070664_100094385
732 Ga0068857_100001797
733 Ga0068857_100028151
734 Ga0068854_100025201
735 Ga0068854_100133054
736 Ga0068854_100859549
737 Ga0068856_100000630
738 Ga0070702_100040801
739 Ga0070702_100194263
740 Ga0068852_100118419
741 Ga0068859_100001373
742 Ga0068859_100565819
743 Ga0068859_100571901
744 Ga0068866_10099127
745 Ga0068861_100037179
746 Ga0068870_10000221
747 Ga0068870_10026265
748 Ga0068863_100022279
749 Ga0068858_101536322
750 Ga0068860_100006069
751 Ga0068862_100001036
752 Ga0068862_100138891
753 Ga0068862_100186520
754 Ga0081455_10002783
755 Ga0081455_10828678
756 Ga0070715_10080313
757 Ga0070716_100156778
758 Ga0070716_100574276
759 Ga0068871_100300844
760 Ga0075428_100146981
761 Ga0075430_100006024
762 Ga0075430_100090703
763 Ga0075430_100097971
764 Ga0075431_100000545
765 Ga0075431_100014658
766 Ga0075431_100030037
767 Ga0075431_100037960
768 Ga0075431_100161543
769 Ga0075431_100605948
770 Ga0075431_101372621
771 Ga0075433_10004845
772 Ga0075433_10100818
773 Ga0075433_10173881
774 Ga0075433_10416632
775 Ga0075433_10422885
776 Ga0075434_100015216
777 Ga0075434_100029618
778 Ga0075434_100082923
779 Ga0075434_100089103
780 Ga0075434_100198110
781 Ga0075434_100360388
782 Ga0075434_100698760
783 Ga0075434_100848119
784 Ga0075429_100052876
785 Ga0075429_100069650
786 Ga0075429_100181208
787 Ga0075429_100799680
788 Ga0075436_100117044
789 Ga0075436_100247907
790 Ga0097620_100001373
791 Ga0097620_100565730
792 Ga0097620_100571910
793 Ga0075435_100024469
794 Ga0075435_100071470
795 Ga0075435_100071626
796 Ga0075435_100138485
797 Ga0075435_101053728
798 Ga0099794_10002650
799 Ga0099794_10012752
800 Ga0099794_10200312
801 Ga0099795_10277063
802 Ga0105245_10134667
803 Ga0105245_10216986
804 Ga0114129_10004541
805 Ga0114129_10014190
806 Ga0114129_10043463
807 Ga0114129_10125672
808 Ga0114129_10169170
809 Ga0114129_10349763
810 Ga0114129_11479981
811 Ga0105243_10025283
812 Ga0105243_10162738
813 Ga0105243_10436877
814 Ga0105241_10002642
815 Ga0105241_10780781
816 Ga0105242_10035280
817 Ga0105242_10324341
818 Ga0105242_10510090
819 Ga0105248_10244989
820 Ga0105237_10761955
821 Ga0105237_11083508
822 Ga0105249_10051030
823 Ga0105249_10644916
824 Ga0105249_12747594
825 Ga0105239_10203855
826 Ga0105246_10443660
827 Ga0105246_10722678
828 Ga0157373_10000727
829 Ga0157369_10007825
830 Ga0157378_10316852
831 Ga0157372_10009278
832 Ga0157372_10531290
833 Ga0157375_10182483
834 Ga0157375_11546596
835 Ga0163163_10357266
836 Ga0163163_11339994
837 Ga0157380_10063627
838 Ga0157380_10728842
839 Ga0157377_10694372
840 Ga0207653_10009510
841 Ga0207653_10113617
842 Ga0207642_10139083
843 Ga0207688_10085278
844 Ga0207647_10031474
845 Ga0207685_10141601
846 Ga0207645_10000170
847 Ga0207645_10043249
848 Ga0207643_10000051
849 Ga0207684_10003991
850 Ga0207684_10026668
851 Ga0207684_10057050
852 Ga0207684_10066495
853 Ga0207684_10111519
854 Ga0207684_10253494
855 Ga0207684_10522024
856 Ga0207684_10522523
857 Ga0207654_10001033
858 Ga0207707_10000453
859 Ga0207707_10097202
860 Ga0207707_10225065
861 Ga0207707_10971359
862 Ga0207671_10167952
863 Ga0207663_10138435
864 Ga0207660_10000203
865 Ga0207660_10081436
866 Ga0207662_10066768
867 Ga0207657_10000357
868 Ga0207649_10010062
869 Ga0207652_10032750
870 Ga0207646_10001207
871 Ga0207646_10020502
872 Ga0207646_10269445
873 Ga0207646_10578114
874 Ga0207646_10878232
875 Ga0207646_11026536
876 Ga0207681_10033960
877 Ga0207650_10016809
878 Ga0207687_10215023
879 Ga0207700_10626193
880 Ga0207644_10491855
881 Ga0207690_10000611
882 Ga0207706_10035870
883 Ga0207706_10259629
884 Ga0207706_10767628
885 Ga0207706_10824759
886 Ga0207686_10327696
887 Ga0207709_10020463
888 Ga0207709_10105720
889 Ga0207670_10392326
890 Ga0207670_10673712
891 Ga0207665_10005953
892 Ga0207665_10344901
893 Ga0207711_10362074
894 Ga0207689_10000296
895 Ga0207689_10008186
896 Ga0207689_10261093
897 Ga0207679_10000233
898 Ga0207667_10001733
899 Ga0207651_10272224
900 Ga0207712_10419101
901 Ga0207712_10632541
902 Ga0207640_10002914
903 Ga0207640_10232213
904 Ga0207677_10013536
905 Ga0207639_10000673
906 Ga0207678_10003802
907 Ga0207678_10428988
908 Ga0207708_10034237
909 Ga0207708_10333409
910 Ga0207702_10001254
911 Ga0207648_10003252
912 Ga0207648_10336460
913 Ga0207676_10042550
914 Ga0207674_10000836
915 Ga0207674_10009144
916 Ga0207675_100007334
917 Ga0207675_100399613
918 Ga0207698_10044174
919 Ga0209969_1006370
920 Ga0209967_1015516
921 Ga0209996_1005890
922 Ga0209984_1060819
923 Ga0209995_1001622
924 Ga0209999_1047109
925 Ga0209982_1005033
926 Ga0210002_1011346
927 Ga0209983_1005137
928 Ga0209588_1008161
929 Ga0209971_1000060
930 Ga0209966_1000312
931 Ga0209998_10000006
932 Ga0209974_10006984
933 Ga0209974_10094618
934 Ga0207428_10003162
935 Ga0268265_10002892
936 Ga0268265_10014365
937 Ga0268265_10032541
938 Ga0268265_10230034
939 Ga0268264_10091495
940 Ga0268264_10125040
941 Ga0307408_100126830
942 Ga0307408_100368521
943 Ga0307408_101677178
944 Ga0307405_10294654
945 Ga0307405_10704157
946 Ga0307405_11084089
947 Ga0307410_10192193
948 Ga0307407_10440465
949 Ga0307409_100208349
950 Ga0307409_100263467
951 Ga0307416_100488701
952 Ga0307414_11031382
953 Ga0307414_11086952
954 Ga0307411_10403184
955 Ga0373958_0063145
956 Ga0373926_0029359
957 Ga0373928_0263328
958 Ga0373940_0001445
959 Ga0373949_0137207
960 Ga0373951_0026697
961 Ga0373952_0169007
962 Ga0373923_0026197
963 Ga0373932_0043535
964 Ga0373932_0418697
965 Ga0373936_0431355
966 Ga0373941_0138085
967 Ga0373953_0178699
968 Ga0373954_0036560
969 Ga0373956_0371313
970 Ga0373960_0385094
971 Ga0373961_0092475
972 Ga0373962_0017064
973 Ga0373931_0009986
974 Ga0373931_0338479
975 Ga0373931_0649534
976 Ga0373927_0002662
977 Ga0373947_0094567
978 Ga0373937_0107616
979 Ga0316582_1170762
980 Ga0373925_0335570
981 Ga0242420_016627
982 Ga0242420_049629
983 Ga0242420_080854
984 Ga0439441_067715
985 Ga0439448_0003529
986 Ga0450919_014539
987 Ga0450902_018119
988 Ga0439458_0155110
989 Ga0439459_0001209
990 Ga0439464_0006796
991 Ga0439460_0011704
992 Ga0450893_0069739
993 Ga0451577_0001849
994 Ga0451577_0006203
995 Ga0451577_0045895
996 Ga0451577_0284671
997 Ga0451577_1208841
998 Ga0451577_1344837
999 Ga0453683_0016419
1000 Ga0453683_0045587
1001 Ga0453683_0056973
1002 Ga0453683_0355306
1003 Ga0453684_0023282
1004 Ga0453684_0054480
1005 Ga0453684_0554652
1006 Ga0466960_0003069
1007 Ga0451576_0024592
1008 Ga0451576_0028962
1009 Ga0451576_0048881
1010 Ga0451576_0113182
1011 Ga0451576_0224813
1012 Ga0451576_1437401
1013 Ga0495580_0014168
1014 Ga0495580_0111626
1015 Ga0495580_0362882
1016 Ga0495580_0748528
1017 Ga0495639_0142212
1018 Ga0495664_0422638
1019 Ga0495584_0288423
1020 Ga0495665_0024426
1021 Ga0495645_0467641
1022 Ga0495667_0639261
1023 Ga0495634_0617555
1024 Ga0495635_0245388
1025 Ga0495659_0191122
1026 Ga0495674_0197269
1027 Ga0495675_0300134
1028 Ga0495684_0141424
1029 Ga0496102_0010781
1030 Ga0496107_0670324
1031 Ga0496108_1234191
1032 Ga0496110_1542235
1033 Ga0496112_0170862
1034 Ga0501292_103270
1035 Ga0501299_159711
1036 Ga0501031_0005375
1037 Ga0501031_0101748
1038 Ga0501031_0146869
1039 Ga0501031_0341284
1040 Ga0501032_0850245
1041 Ga0501033_0005375
1042 Ga0501033_0031121
1043 Ga0501033_1014260
1044 Ga0501034_0234985
1045 Ga0501036_0000146
1046 Ga0501036_0101892
1047 Ga0501036_0189248
1048 Ga0501036_0422683
1049 Ga0501036_0464140
1050 Ga0501036_0498789
1051 Ga0501037_0010082
1052 Ga0501037_0038927
1053 Ga0501038_0000983
1054 Ga0501038_0118241
1055 Ga0501039_0000223
1056 Ga0501039_0025015
1057 Ga0501039_0251693
1058 Ga0501039_0266358
1059 Ga0501040_0000373
1060 Ga0501040_0001289
1061 Ga0501040_0150913
1062 Ga0501040_0173671
1063 Ga0501040_0219686
1064 Ga0501040_0490831
1065 Ga0501040_0674163
1066 Ga0501041_0000014
1067 Ga0501041_0002902
1068 Ga0501041_0006533
1069 Ga0501041_0063689
1070 Ga0501041_0163382
1071 Ga0501042_0000029
1072 Ga0501042_0003204
1073 Ga0501042_0022065
1074 Ga0501042_0198126
1075 Ga0501042_0201451
1076 Ga0501042_0648134
1077 Ga0501042_0722615
1078 Ga0501043_0009232
1079 Ga0501043_0046014
1080 Ga0501043_0814201
1081 Ga0501043_0844840
1082 Ga0501046_0000544
1083 Ga0501046_0001711
1084 Ga0501046_0086321
1085 Ga0501047_0063964
1086 Ga0501048_0000167
1087 Ga0501048_0004989
1088 Ga0501048_1125911
1089 Ga0501048_1143711
1090 Ga0501068_0011732
1091 Ga0501068_0229756
1092 Ga0501068_0408836
1093 Ga0501069_0012731
1094 Ga0501069_0206461
1095 Ga0501069_0951347
1096 Ga0501070_0013294
1097 Ga0501070_0205809
1098 Ga0501071_0000123
1099 Ga0501071_0053860
1100 Ga0501071_0082326
1101 Ga0501071_0109461
1102 Ga0501071_0189175
1103 Ga0501071_0199218
1104 Ga0501071_0223076
1105 Ga0501071_0394029
1106 Ga0501071_0870074
1107 Ga0501072_0000091
1108 Ga0501072_0035233
1109 Ga0501072_0074417
1110 Ga0501072_0093129
1111 Ga0501072_0129735
1112 Ga0501072_0288655
1113 Ga0501072_0624117
1114 Ga0501073_0006844
1115 Ga0501074_0005032
1116 Ga0501074_0006054
1117 Ga0501074_0358818
1118 Ga0501074_0466311
1119 Ga0501075_0000005
1120 Ga0501075_0006543
1121 Ga0501075_0021176
1122 Ga0501075_0066538
1123 Ga0501075_0206365
1124 Ga0501075_0374383
1125 Ga0501076_0000024
1126 Ga0501076_0027512
1127 Ga0501076_0049743
1128 Ga0501076_0060399
1129 Ga0501076_0063233
1130 Ga0501076_0231554
1131 Ga0501076_0340278
1132 Ga0501077_0000025
1133 Ga0501077_0061153
1134 Ga0501077_0104695
1135 Ga0501077_0282172
1136 Ga0501077_0331787
1137 Ga0501225_0336962
1138 Ga0501079_0000025
1139 Ga0501079_0000760
1140 Ga0501079_0008890
1141 Ga0501079_0105145
1142 Ga0501079_0141205
1143 Ga0501079_0273270
1144 Ga0501079_0367151
1145 Ga0501079_0645702
1146 Ga0501079_0702303
1147 Ga0501079_0981790
1148 Ga0501080_0001141
1149 Ga0501080_0633180
1150 Ga0501080_1223150
1151 Ga0501081_0000007
1152 Ga0501081_0019125
1153 Ga0501081_0020663
1154 Ga0501081_0057687
1155 Ga0501081_0087750
1156 Ga0501081_0248486
1157 Ga0501081_0297579
1158 Ga0501081_0310626
1159 Ga0501081_0352133
1160 Ga0501081_0889834
1161 Ga0501083_0011123
1162 Ga0501083_0198248
1163 Ga0501083_0723727
1164 Ga0501035_0002582
1165 Ga0501044_0892185
1166 Ga0501044_1263924
1167 Ga0501045_0000003
1168 Ga0501045_0000717
1169 Ga0501045_0032051
1170 Ga0501045_0151748
1171 Ga0501045_0298344
1172 nmdc:mga05p37_213226_c1
1173 nmdc:mga05p37_219186_c1
1174 nmdc:mga05p37_30934_c1
1175 nmdc:mga05p37_372580_c1
1176 nmdc:mga05p37_37320_c1
1177 nmdc:mga05p37_506035_c1
1178 nmdc:mga05p37_6819_c1
1179 nmdc:mga05p37_7414_c1
1180 nmdc:mga09592_10601_c1
1181 nmdc:mga09592_163585_c1
1182 nmdc:mga09592_648166_c1
1183 nmdc:mga0qj67_180393_c1
1184 nmdc:mga0qj67_478812_c1
1185 nmdc:mga06r32_194954_c1
1186 nmdc:mga06r32_381000_c1
1187 nmdc:mga06r32_44114_c1
1188 nmdc:mga06r32_44537_c1
1189 nmdc:mga06r32_543614_c1
1190 nmdc:mga08y16_2190_c1
1191 nmdc:mga0n895_1127572_c1
1192 nmdc:mga0n895_17203_c1
1193 nmdc:mga0n895_2180639_c1
1194 nmdc:mga0n895_232505_c1
1195 nmdc:mga0n895_295787_c1
1196 nmdc:mga0n895_39410_c1
1197 nmdc:mga0n895_628725_c1
1198 nmdc:mga0n895_678508_c1
1199 nmdc:mga0n895_855732_c1
1200 nmdc:mga0rr50_10901_c1
1201 nmdc:mga0rr50_15502_c1
1202 nmdc:mga0rr50_471419_c1
1203 nmdc:mga0rr50_58883_c1
1204 nmdc:mga08x19_1162248_c1
1205 nmdc:mga08x19_677641_c1
1206 nmdc:mga08x19_78596_c1
1207 nmdc:mga0a205_1779_c1
1208 nmdc:mga0a205_182435_c2
1209 nmdc:mga0a205_262615_c1
1210 nmdc:mga0a205_5773_c1
1211 nmdc:mga0a205_653556_c1
1212 nmdc:mga0a205_740416_c1
1213 nmdc:mga0a205_8715_c1
1214 Ga0501084_0000398
1215 Ga0501084_0002865
1216 Ga0501084_0030896
1217 Ga0501084_0663789
1218 Ga0590071_027846
1219 Ga0590077_068774
1220 Ga0501082_0000062
1221 Ga0501082_0015483
1222 Ga0501082_0024763
1223 Ga0501082_0046990
1224 Ga0501082_0056125
1225 Ga0501082_0129223
1226 Ga0501082_0246933
1227 Ga0501082_1135048
1228 Ga0501082_1441947
1229 Ga0530510_0000062
1230 Ga0530510_0004377
1231 Ga0530510_0009989
1232 Ga0530510_0014717
1233 Ga0530510_0026226
1234 Ga0530510_0188734
1235 Ga0530510_0209667
1236 Ga0530510_0457301
1237 Ga0530510_0579831
1238 Ga0530510_1004391

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02310

B12-binding

B12 binding domain

36

154

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r3u-assembly1.cif.gz_C crystal structure of 2-hydroxyisobutyryl-coa mutase 0.981 5 132
2xiq-assembly1.cif.gz_A crystal structure of human methylmalonyl-coa mutase in complex with adenosylcobalamin and malonyl-coa 0.9778 6 130
8dyl-assembly1.cif.gz_B crystal structure of human methylmalonyl-coa mutase bound to aquocobalamin 0.9772 4 130
6oxc-assembly1.cif.gz_A structure of mycobacterium tuberculosis methylmalonyl-coa mutase with adenosyl cobalamin 0.966 7 130
4r3u-assembly1.cif.gz_C crystal structure of 2-hydroxyisobutyryl-coa mutase 0.9516 5 132
ID Description Score Start End Superfamily
4r3uD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9794 5 131 3.40.50.280
af_A4I2L1_581_723_3.40.50.280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9786 7 132 3.40.50.280
4r3uD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9571 5 131 3.40.50.280
af_A4I2L1_581_723_3.40.50.280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9078 7 132 3.40.50.280
4jgiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.8888 4 128 3.40.50.280
ID Description Score Start End GO Terms
AF-A0A2V8I2J3-F1-model_v4 Methylmalonyl-CoA mutase 0.988 4 130 GO:0016853
GO:0031419
GO:0046872
AF-A0A7V3RWE8-F1-model_v4 Cobalamin B12-binding domain-containing protein 0.9866 3 131 GO:0016853
GO:0031419
GO:0046872
AF-A0A1Q7Y4E5-F1-model_v4 Methylmalonyl-CoA mutase 0.9859 2 135 GO:0016853
GO:0031419
GO:0046872
AF-A0A831Y7U5-F1-model_v4 Cobalamin B12-binding domain-containing protein 0.9838 6 128 GO:0016853
GO:0031419
GO:0046872
AF-A0A6N9F9N7-F1-model_v4 deleted 0.9826 1 130

Map