F469859

General Info

Members Datasets Scaffolds Average Seq Length
619 368 1238 225

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0247118|Ga0501070_0247118_411_1211
Length 266
Sequence MHSAATLPLRASPAATICNGVTRIFVVTMIMVWPDRFRTSPVSDTSDAIMLDIQNLTKTYRSAQERIAVLRGACLRVEPGESVALTGESGSGKSTLLHLIAGLDQADSGSIRFEDTEVTGLADRGRATLRRERLGLVFQQFNLIPSLTVADNLAFQARIAGRHDGRWQGELVDRLGLGDVLKRYPEQLSGGQQQRVAIGRALAVRPPLLLADEPTGNLDEATADGVMDLARDLIKRTGCGFLMVTHSARLAATLDRQVRLSAGQIS

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
140 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
159 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
215 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
304 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
305 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
311 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
312 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
313 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
316 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
317 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
318 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
319 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
320 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
321 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
322 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
323 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
324 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
325 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
326 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
327 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
328 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
329 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
330 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
331 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
332 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
333 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
334 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
335 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
336 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
337 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
338 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
339 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
340 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
341 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
342 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
343 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
344 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
345 2791355199
346 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
347 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
348 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
349 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
350 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
351 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
352 2906610324
353 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
354 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
355 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
356 2922425934
357 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
358 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
359 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
360 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
361 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
362 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
363 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
364 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
365 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
366 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
367 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
368 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.13
Metatranscriptomes 0.16
Isolates 4.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.24
Nodule 3.55
Rhizoplane 3.55
Rhizosphere 74.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0247118 3300049586 Bacteria 1460
2 JGI24737J22298_10037506 3300001990 Bacteria 1493
3 JGI25406J46586_10001070 3300003203 Bacteria 12840
4 JGI25404J52841_10005846 3300003659 Bacteria 2551
5 Ga0070683_100039979 3300005329 Bacteria 4309
6 Ga0068869_100645658 3300005334 Bacteria 898
7 Ga0070680_100097862 3300005336 Bacteria 2433
8 Ga0070680_100267135 3300005336 Bacteria 1448
9 Ga0070680_100698008 3300005336 Bacteria 873
10 Ga0070682_100140230 3300005337 Bacteria 1647
11 Ga0070660_100015135 3300005339 Bacteria 5566
12 Ga0070691_10028127 3300005341 Bacteria 2625
13 Ga0070692_10108039 3300005345 Bacteria 1535
14 Ga0070668_100124669 3300005347 Bacteria 2062
15 Ga0070671_100376557 3300005355 Bacteria 1213
16 Ga0070674_100021497 3300005356 Bacteria 4144
17 Ga0070659_100061934 3300005366 Bacteria 2957
18 Ga0070659_100566076 3300005366 Bacteria 974
19 Ga0070709_10000732 3300005434 Bacteria 18548
20 Ga0070709_10068699 3300005434 Bacteria 2280
21 Ga0070709_10123135 3300005434 Bacteria 1761
22 Ga0070709_10489253 3300005434 Bacteria 933
23 Ga0070714_100010788 3300005435 Bacteria 7232
24 Ga0070714_100056936 3300005435 Bacteria 3345
25 Ga0070714_100130000 3300005435 Bacteria 2250
26 Ga0070714_100558377 3300005435 Bacteria 1097
27 Ga0070713_100004657 3300005436 Bacteria 9258
28 Ga0070713_100053012 3300005436 Bacteria 3360
29 Ga0070713_100089395 3300005436 Bacteria 2645
30 Ga0070713_100128305 3300005436 Bacteria 2234
31 Ga0070713_100310531 3300005436 Bacteria 1454
32 Ga0070710_10004377 3300005437 Bacteria 6688
33 Ga0070710_10014128 3300005437 Bacteria 4012
34 Ga0070710_10167727 3300005437 Bacteria 1366
35 Ga0070711_100001113 3300005439 Bacteria 14371
36 Ga0070663_100015495 3300005455 Bacteria 4924
37 Ga0070662_100029453 3300005457 Bacteria 3832
38 Ga0070681_10087866 3300005458 Bacteria 3061
39 Ga0070681_10168780 3300005458 Bacteria 2110
40 Ga0070707_100062897 3300005468 Bacteria 3561
41 Ga0070698_100083348 3300005471 Bacteria 3187
42 Ga0070679_100023653 3300005530 Bacteria 6017
43 Ga0070679_100396250 3300005530 Bacteria 1327
44 Ga0070684_100008002 3300005535 Bacteria 8253
45 Ga0070684_100021034 3300005535 Bacteria 5420
46 Ga0070697_100031162 3300005536 Bacteria 4288
47 Ga0070697_100062812 3300005536 Bacteria 3032
48 Ga0070697_100165141 3300005536 Bacteria 1872
49 Ga0068853_100034017 3300005539 Bacteria 4324
50 Ga0068853_100127126 3300005539 Bacteria 2278
51 Ga0070672_100042288 3300005543 Bacteria 3508
52 Ga0070693_100096847 3300005547 Bacteria 1789
53 Ga0070665_100401617 3300005548 Bacteria 1378
54 Ga0068855_100012487 3300005563 Bacteria 10252
55 Ga0068855_100052929 3300005563 Bacteria 4778
56 Ga0068857_100023914 3300005577 Bacteria 5378
57 Ga0068857_100059405 3300005577 Bacteria 3396
58 Ga0068857_100420465 3300005577 Bacteria 1246
59 Ga0068854_100376662 3300005578 Bacteria 1168
60 Ga0068854_100511060 3300005578 Bacteria 1013
61 Ga0068856_100928639 3300005614 Bacteria 889
62 Ga0070702_100032706 3300005615 Bacteria 2855
63 Ga0068852_100002923 3300005616 Bacteria 11867
64 Ga0068852_100048949 3300005616 Bacteria 3614
65 Ga0068852_100786722 3300005616 Bacteria 965
66 Ga0068859_100132852 3300005617 Bacteria 2561
67 Ga0068866_10026038 3300005718 Bacteria 2757
68 Ga0068861_100031166 3300005719 Bacteria 3914
69 Ga0068860_100000257 3300005843 Bacteria 78468
70 Ga0068862_100177207 3300005844 Bacteria 1912
71 Ga0081455_10010356 3300005937 Bacteria 9474
72 Ga0081455_10088422 3300005937 Bacteria 2517
73 Ga0081540_1006050 3300005983 Bacteria 8898
74 Ga0081540_1006692 3300005983 Bacteria 8337
75 Ga0081540_1040529 3300005983 Bacteria 2427
76 Ga0081539_10000530 3300005985 Bacteria 79454
77 Ga0070717_10168325 3300006028 Bacteria 1905
78 Ga0075365_10027944 3300006038 Bacteria 3593
79 Ga0075368_10029829 3300006042 Bacteria 2110
80 Ga0075364_10225961 3300006051 Bacteria 1271
81 Ga0070715_10157171 3300006163 Bacteria 1120
82 Ga0070716_100009694 3300006173 Bacteria 4806
83 Ga0070716_100012248 3300006173 Bacteria 4343
84 Ga0070716_100537794 3300006173 Bacteria 869
85 Ga0070712_100014993 3300006175 Bacteria 4983
86 Ga0070712_100141682 3300006175 Bacteria 1836
87 Ga0070712_100470155 3300006175 Bacteria 1050
88 Ga0075369_10049606 3300006186 Bacteria 1813
89 Ga0075428_100125716 3300006844 Bacteria 2790
90 Ga0075428_100356015 3300006844 Bacteria 1571
91 Ga0075434_100072646 3300006871 Bacteria 3432
92 Ga0068865_100148872 3300006881 Bacteria 1774
93 Ga0075436_100098286 3300006914 Bacteria 2037
94 Ga0097620_100132852 3300006931 Bacteria 2561
95 Ga0075435_100327410 3300007076 Bacteria 1312
96 Ga0099794_10034843 3300007265 Bacteria 2374
97 Ga0099794_10038540 3300007265 Bacteria 2265
98 Ga0099795_10037570 3300007788 Bacteria 1705
99 Ga0099795_10090904 3300007788 Bacteria 1183
100 Ga0105240_10009432 3300009093 Bacteria 13814
101 Ga0105240_10013377 3300009093 Bacteria 11267
102 Ga0105240_10027328 3300009093 Bacteria 7471
103 Ga0111539_10121973 3300009094 Bacteria 3054
104 Ga0105245_10023002 3300009098 Bacteria 5468
105 Ga0114129_10078084 3300009147 Bacteria 4605
106 Ga0105243_10036413 3300009148 Bacteria 3820
107 Ga0105243_10836287 3300009148 Bacteria 910
108 Ga0105243_11101531 3300009148 Bacteria 802
109 Ga0105241_10141400 3300009174 Bacteria 1960
110 Ga0105248_10008995 3300009177 Bacteria 10981
111 Ga0105248_10175028 3300009177 Bacteria 2419
112 Ga0105237_10005001 3300009545 Bacteria 15097
113 Ga0105237_10012543 3300009545 Bacteria 8927
114 Ga0105238_10011156 3300009551 Bacteria 9037
115 Ga0105238_10472193 3300009551 Bacteria 1253
116 Ga0105249_10032742 3300009553 Bacteria 4704
117 Ga0099796_10044981 3300010159 Bacteria 1511
118 Ga0099796_10078459 3300010159 Bacteria 1206
119 Ga0105239_10004474 3300010375 Bacteria 16696
120 Ga0105239_10819732 3300010375 Bacteria 1066
121 Ga0105239_10968208 3300010375 Bacteria 978
122 Ga0105246_10407952 3300011119 Bacteria 1130
123 Ga0157369_10009146 3300013105 Bacteria 11335
124 Ga0157369_10031113 3300013105 Bacteria 5880
125 Ga0157369_10267128 3300013105 Bacteria 1783
126 Ga0157369_10346000 3300013105 Bacteria 1544
127 Ga0157378_10134227 3300013297 Bacteria 2294
128 Ga0157375_10033840 3300013308 Bacteria 4861
129 Ga0163163_10347324 3300014325 Bacteria 1539
130 Ga0163163_10822047 3300014325 Bacteria 993
131 Ga0157380_10131962 3300014326 Bacteria 2133
132 Ga0157379_10149767 3300014968 Bacteria 2105
133 Ga0157376_10431800 3300014969 Bacteria 1280
134 Ga0163161_10047181 3300017792 Bacteria 3111
135 Ga0163161_10108055 3300017792 Bacteria 2077
136 Ga0163161_10147496 3300017792 Bacteria 1786
137 Ga0213876_10000991 3300021384 Bacteria 18609
138 Ga0213876_10296837 3300021384 Bacteria 859
139 Ga0209148_1009224 3300025254 Bacteria 1934
140 Ga0209233_1002050 3300025261 Bacteria 7637
141 Ga0209233_1004852 3300025261 Bacteria 4528
142 Ga0209455_1005109 3300025272 Bacteria 4129
143 Ga0209455_1012118 3300025272 Bacteria 2082
144 Ga0207656_10062872 3300025321 Bacteria 1633
145 Ga0207692_10000494 3300025898 Bacteria 13955
146 Ga0207692_10042495 3300025898 Bacteria 2257
147 Ga0207710_10006473 3300025900 Bacteria 4997
148 Ga0207688_10130340 3300025901 Bacteria 1474
149 Ga0207685_10069101 3300025905 Bacteria 1425
150 Ga0207699_10004161 3300025906 Bacteria 6928
151 Ga0207699_10015928 3300025906 Bacteria 3920
152 Ga0207645_10065263 3300025907 Bacteria 2326
153 Ga0207654_10203702 3300025911 Bacteria 1304
154 Ga0207707_10043500 3300025912 Bacteria 3918
155 Ga0207707_10058212 3300025912 Bacteria 3363
156 Ga0207695_10020475 3300025913 Bacteria 7574
157 Ga0207695_10028143 3300025913 Bacteria 6240
158 Ga0207671_10145683 3300025914 Bacteria 1827
159 Ga0207693_10007348 3300025915 Bacteria 9061
160 Ga0207693_10054260 3300025915 Bacteria 3144
161 Ga0207663_10000356 3300025916 Bacteria 19925
162 Ga0207663_10056552 3300025916 Bacteria 2467
163 Ga0207660_10026709 3300025917 Bacteria 3933
164 Ga0207660_10166299 3300025917 Bacteria 1705
165 Ga0207660_10236008 3300025917 Bacteria 1439
166 Ga0207657_10006056 3300025919 Bacteria 12577
167 Ga0207657_10117003 3300025919 Bacteria 2195
168 Ga0207649_10417556 3300025920 Bacteria 1007
169 Ga0207652_10018674 3300025921 Bacteria 5690
170 Ga0207652_10997065 3300025921 Bacteria 736
171 Ga0207646_10057962 3300025922 Bacteria 3460
172 Ga0207646_10628179 3300025922 Bacteria 963
173 Ga0207694_10015674 3300025924 Bacteria 5717
174 Ga0207687_10050362 3300025927 Bacteria 2899
175 Ga0207700_10037768 3300025928 Bacteria 3500
176 Ga0207700_10336598 3300025928 Bacteria 1311
177 Ga0207700_10429936 3300025928 Bacteria 1161
178 Ga0207664_10001702 3300025929 Bacteria 14493
179 Ga0207664_10309465 3300025929 Bacteria 1391
180 Ga0207706_10359974 3300025933 Bacteria 1264
181 Ga0207686_10345406 3300025934 Bacteria 1119
182 Ga0207669_10005920 3300025937 Bacteria 5536
183 Ga0207704_10027636 3300025938 Bacteria 3134
184 Ga0207665_10033184 3300025939 Bacteria 3420
185 Ga0207665_10560749 3300025939 Bacteria 888
186 Ga0207691_10091254 3300025940 Bacteria 2730
187 Ga0207691_10766584 3300025940 Bacteria 812
188 Ga0207661_10012674 3300025944 Bacteria 6137
189 Ga0207661_10043590 3300025944 Bacteria 3541
190 Ga0207667_10011217 3300025949 Bacteria 10427
191 Ga0207667_10088803 3300025949 Bacteria 3196
192 Ga0207667_10435136 3300025949 Bacteria 1334
193 Ga0207667_10993550 3300025949 Bacteria 827
194 Ga0207668_10137570 3300025972 Bacteria 1874
195 Ga0207668_10234194 3300025972 Bacteria 1482
196 Ga0207677_10019638 3300026023 Bacteria 4087
197 Ga0207703_10389261 3300026035 Bacteria 1291
198 Ga0207639_10015161 3300026041 Bacteria 5430
199 Ga0207678_10073479 3300026067 Bacteria 2930
200 Ga0207678_10432212 3300026067 Bacteria 1143
201 Ga0207708_10023977 3300026075 Bacteria 4614
202 Ga0207702_10000056 3300026078 Bacteria 131186
203 Ga0207641_10008809 3300026088 Bacteria 8334
204 Ga0207648_10058517 3300026089 Bacteria 3361
205 Ga0207674_10018427 3300026116 Bacteria 7587
206 Ga0207674_10619321 3300026116 Bacteria 1045
207 Ga0207698_10032169 3300026142 Bacteria 3797
208 Ga0207698_10093936 3300026142 Bacteria 2464
209 Ga0207698_10810232 3300026142 Bacteria 939
210 Ga0209588_1017686 3300027671 Bacteria 2212
211 Ga0209588_1021532 3300027671 Bacteria 2026
212 Ga0268266_10341939 3300028379 Bacteria 1405
213 Ga0268265_10195946 3300028380 Bacteria 1748
214 Ga0268264_10000049 3300028381 Bacteria 329992
215 Ga0265326_10002792 3300028558 Bacteria 5848
216 Ga0265334_10003782 3300028573 Bacteria 6840
217 Ga0265336_10000430 3300028666 Bacteria 25854
218 Ga0307517_10002211 3300028786 Bacteria 31433
219 Ga0307517_10301388 3300028786 Bacteria 898
220 Ga0307517_10349299 3300028786 Bacteria 804
221 Ga0307515_10338941 3300028794 Bacteria 1157
222 Ga0265338_10000024 3300028800 Bacteria 297778
223 Ga0265324_10031172 3300029957 Bacteria 1868
224 Ga0307511_10100749 3300030521 Bacteria 1898
225 Ga0265330_10008045 3300031235 Bacteria 5103
226 Ga0265330_10013923 3300031235 Bacteria 3739
227 Ga0265330_10033253 3300031235 Bacteria 2307
228 Ga0265332_10011317 3300031238 Bacteria 3967
229 Ga0265328_10146619 3300031239 Bacteria 887
230 Ga0265325_10002005 3300031241 Bacteria 13988
231 Ga0265340_10103774 3300031247 Bacteria 1319
232 Ga0265339_10045819 3300031249 Bacteria 2406
233 Ga0265331_10021452 3300031250 Bacteria 3306
234 Ga0307513_10130648 3300031456 Bacteria 2458
235 Ga0307513_10547723 3300031456 Bacteria 870
236 Ga0307509_10040521 3300031507 Bacteria 5065
237 Ga0307509_10103840 3300031507 Bacteria 2869
238 Ga0307509_10241750 3300031507 Bacteria 1597
239 Ga0307508_10000005 3300031616 Bacteria 286511
240 Ga0307508_10059018 3300031616 Bacteria 3394
241 Ga0265314_10000900 3300031711 Bacteria 35261
242 Ga0265342_10050901 3300031712 Bacteria 2472
243 Ga0265342_10070545 3300031712 Bacteria 2038
244 Ga0265342_10330904 3300031712 Bacteria 796
245 Ga0307516_10013014 3300031730 Bacteria 8910
246 Ga0307516_10118051 3300031730 Bacteria 2447
247 Ga0307516_10245238 3300031730 Bacteria 1488
248 Ga0307416_100174939 3300032002 Bacteria 2004
249 Ga0307415_100160604 3300032126 Bacteria 1741
250 Ga0307507_10006568 3300033179 Bacteria 17727
251 Ga0307510_10020522 3300033180 Bacteria 7720
252 Ga0307510_10068511 3300033180 Bacteria 3560
253 Ga0315911_1000018 3300033442 Bacteria 152089
254 Ga0316215_1001164 3300033544 Bacteria 2550
255 Ga0373934_0006395 3300035086 Bacteria 4370
256 Ga0373940_0020359 3300035088 Bacteria 1685
257 Ga0373944_0055378 3300035089 Bacteria 1259
258 Ga0373952_0067162 3300035092 Bacteria 890
259 Ga0373923_0001363 3300035111 Bacteria 6953
260 Ga0373953_0008643 3300035117 Bacteria 3468
261 Ga0373954_0005748 3300035118 Bacteria 5382
262 Ga0373954_0033492 3300035118 Bacteria 2377
263 Ga0373956_0003734 3300035119 Bacteria 6134
264 Ga0373956_0248536 3300035119 Bacteria 845
265 Ga0373957_0001574 3300035120 Bacteria 6227
266 Ga0373957_0039158 3300035120 Bacteria 1777
267 Ga0373960_0137412 3300035121 Bacteria 825
268 Ga0373946_0002379 3300035171 Bacteria 6653
269 Ga0373946_0054265 3300035171 Bacteria 1686
270 Ga0373955_0003197 3300035172 Bacteria 7172
271 Ga0373955_0033444 3300035172 Bacteria 2708
272 Ga0373924_0002150 3300035410 Bacteria 6599
273 Ga0373924_0294345 3300035410 Bacteria 720
274 Ga0373931_0414396 3300035691 Bacteria 855
275 Ga0373935_0000229 3300035692 Bacteria 27393
276 Ga0373935_0046204 3300035692 Bacteria 2749
277 Ga0373935_0112353 3300035692 Bacteria 1809
278 Ga0373935_0427797 3300035692 Bacteria 954
279 Ga0373927_0000071 3300035695 Bacteria 73794
280 Ga0373927_0004081 3300035695 Bacteria 10306
281 Ga0373927_0035793 3300035695 Bacteria 3229
282 Ga0373927_0063549 3300035695 Bacteria 2387
283 Ga0373927_0146282 3300035695 Bacteria 1547
284 Ga0373927_0164629 3300035695 Bacteria 1453
285 Ga0373927_0466129 3300035695 Bacteria 834
286 Ga0373933_0000114 3300035724 Bacteria 52016
287 Ga0373933_0001425 3300035724 Bacteria 14028
288 Ga0373947_0000540 3300035725 Bacteria 22139
289 Ga0373947_0001708 3300035725 Bacteria 13470
290 Ga0373947_0011676 3300035725 Bacteria 5038
291 Ga0373947_0069223 3300035725 Bacteria 2160
292 Ga0373947_0143608 3300035725 Bacteria 1533
293 Ga0373947_0295532 3300035725 Bacteria 1079
294 Ga0373937_0025351 3300036401 Bacteria 5353
295 Ga0373937_0083156 3300036401 Bacteria 2962
296 Ga0373937_0313318 3300036401 Bacteria 1484
297 Ga0372808_002837 3300036459 Bacteria 2053
298 Ga0373925_0011299 3300037068 Bacteria 6478
299 Ga0373925_0015901 3300037068 Bacteria 5445
300 Ga0373925_0024578 3300037068 Bacteria 4399
301 Ga0373925_0025137 3300037068 Bacteria 4349
302 Ga0373925_0039338 3300037068 Bacteria 3499
303 Ga0373925_0154604 3300037068 Bacteria 1803
304 Ga0395899_0092631 3300037312 Bacteria 2188
305 Ga0395900_0003234 3300037418 Bacteria 17637
306 Ga0395900_0131044 3300037418 Bacteria 2570
307 Ga0395900_0430249 3300037418 Bacteria 1279
308 Ga0395898_0003112 3300037466 Bacteria 18739
309 Ga0395905_0059181 3300037471 Bacteria 3582
310 Ga0395905_0319599 3300037471 Bacteria 1442
311 Ga0395901_0052714 3300038443 Bacteria 4228
312 Ga0395901_0234804 3300038443 Bacteria 1914
313 Ga0436365_0650112 3300039437 Bacteria 58550
314 Ga0436365_1026947 3300039437 Bacteria 1223
315 Ga0436360_1193161 3300039438 Bacteria 2031
316 Ga0436362_0790756 3300039453 Bacteria 2420
317 Ga0451795_0646620 3300041456 Bacteria 775
318 Ga0451807_0166552 3300041486 Bacteria 1078
319 Ga0466963_0127118 3300044694 Bacteria 1758
320 Ga0466957_0026692 3300044842 Bacteria 3427
321 Ga0466959_0095788 3300045049 Bacteria 2128
322 Ga0466967_1136960 3300045976 Bacteria 778
323 Ga0495617_004269 3300046452 Bacteria 5219
324 Ga0495592_0011328 3300046454 Bacteria 6745
325 Ga0495592_0035153 3300046454 Bacteria 3775
326 Ga0495603_0000035 3300046455 Bacteria 57510
327 Ga0495603_0012240 3300046455 Bacteria 5196
328 Ga0495603_0214493 3300046455 Bacteria 1111
329 Ga0495629_0000081 3300046459 Bacteria 85305
330 Ga0495629_0002236 3300046459 Bacteria 14921
331 Ga0495629_0043007 3300046459 Bacteria 3173
332 Ga0495629_0419301 3300046459 Bacteria 908
333 Ga0495629_0509716 3300046459 Bacteria 811
334 Ga0495641_0003571 3300046461 Bacteria 11545
335 Ga0495641_0119489 3300046461 Bacteria 1176
336 Ga0495651_0033024 3300046462 Bacteria 4037
337 Ga0495651_0107370 3300046462 Bacteria 2068
338 Ga0495653_0021802 3300046463 Bacteria 5185
339 Ga0495580_0007845 3300046472 Bacteria 8545
340 Ga0495582_0000235 3300046473 Bacteria 30725
341 Ga0495582_0186347 3300046473 Bacteria 1183
342 Ga0495582_0299611 3300046473 Bacteria 924
343 Ga0495639_0000010 3300046475 Bacteria 93685
344 Ga0495639_0008724 3300046475 Bacteria 4348
345 Ga0495662_0003600 3300046476 Bacteria 7816
346 Ga0495662_0110847 3300046476 Bacteria 1345
347 Ga0495664_0003381 3300046477 Bacteria 8667
348 Ga0495664_0127817 3300046477 Bacteria 1538
349 Ga0495664_0195603 3300046477 Bacteria 1226
350 Ga0495594_0045839 3300046499 Bacteria 2401
351 Ga0495606_0231448 3300046507 Bacteria 1035
352 Ga0495608_0037291 3300046511 Bacteria 3268
353 Ga0495608_0095113 3300046511 Bacteria 1925
354 Ga0495610_0044581 3300046512 Bacteria 2201
355 Ga0495618_0029014 3300046514 Bacteria 3450
356 Ga0495618_0072387 3300046514 Bacteria 2193
357 Ga0495618_0193470 3300046514 Bacteria 1289
358 Ga0495628_0018214 3300046516 Bacteria 5822
359 Ga0495628_0050808 3300046516 Bacteria 3279
360 Ga0495630_0003778 3300046517 Bacteria 10573
361 Ga0495630_0021706 3300046517 Bacteria 4741
362 Ga0495630_0142515 3300046517 Bacteria 1823
363 Ga0495632_0160759 3300046519 Bacteria 1035
364 Ga0495644_0016803 3300046523 Bacteria 2800
365 Ga0495648_0005171 3300046524 Bacteria 10917
366 Ga0495648_0118560 3300046524 Bacteria 1427
367 Ga0495666_0041695 3300046526 Bacteria 2222
368 Ga0495666_0046722 3300046526 Bacteria 2086
369 Ga0495652_0023860 3300046529 Bacteria 5418
370 Ga0495652_0027318 3300046529 Bacteria 5029
371 Ga0495652_0413290 3300046529 Bacteria 952
372 Ga0495665_0000005 3300046531 Bacteria 86491
373 Ga0495640_0004314 3300046533 Bacteria 11359
374 Ga0495640_0006942 3300046533 Bacteria 8915
375 Ga0495640_0010386 3300046533 Bacteria 7202
376 Ga0495640_0415723 3300046533 Bacteria 824
377 Ga0495586_0028532 3300046535 Bacteria 2986
378 Ga0495587_0032742 3300046536 Bacteria 3140
379 Ga0495587_0107421 3300046536 Bacteria 1605
380 Ga0495587_0200318 3300046536 Bacteria 1129
381 Ga0495609_0014031 3300046538 Bacteria 3773
382 Ga0495645_0005858 3300046543 Bacteria 8485
383 Ga0495645_0033977 3300046543 Bacteria 3721
384 Ga0495645_0210646 3300046543 Bacteria 1312
385 Ga0495645_0273510 3300046543 Bacteria 1114
386 Ga0495622_0004449 3300046557 Bacteria 6508
387 Ga0495622_0008890 3300046557 Bacteria 4654
388 Ga0495622_0155192 3300046557 Bacteria 1034
389 Ga0495622_0211096 3300046557 Bacteria 862
390 Ga0495667_0020935 3300046559 Bacteria 4412
391 Ga0495667_0030300 3300046559 Bacteria 3636
392 Ga0495667_0042926 3300046559 Bacteria 2998
393 Ga0495667_0277557 3300046559 Bacteria 1064
394 Ga0495656_0023525 3300046615 Bacteria 2425
395 Ga0495656_0060560 3300046615 Bacteria 1650
396 Ga0495668_0012203 3300046616 Bacteria 5106
397 Ga0495668_0034272 3300046616 Bacteria 2849
398 Ga0495634_0000261 3300046642 Bacteria 49735
399 Ga0495634_0021377 3300046642 Bacteria 4575
400 Ga0495634_0037057 3300046642 Bacteria 3333
401 Ga0495634_0174845 3300046642 Bacteria 1348
402 Ga0495611_0210613 3300046648 Bacteria 905
403 Ga0495625_0091563 3300046660 Bacteria 2102
404 Ga0495625_0273812 3300046660 Bacteria 1088
405 Ga0495625_0352933 3300046660 Bacteria 929
406 Ga0495635_0006062 3300046663 Bacteria 8435
407 Ga0495635_0018394 3300046663 Bacteria 4876
408 Ga0495588_0010000 3300046674 Bacteria 4398
409 Ga0495657_0011243 3300046675 Bacteria 6705
410 Ga0495599_0007860 3300046678 Bacteria 6471
411 Ga0495599_0088539 3300046678 Bacteria 1933
412 Ga0495599_0349752 3300046678 Bacteria 886
413 Ga0495623_0067061 3300046679 Bacteria 2240
414 Ga0495623_0069387 3300046679 Bacteria 2197
415 Ga0495623_0415395 3300046679 Bacteria 722
416 Ga0495646_0031838 3300046680 Bacteria 3285
417 Ga0495646_0059190 3300046680 Bacteria 2289
418 Ga0495646_0313745 3300046680 Bacteria 827
419 Ga0495647_0000500 3300046681 Bacteria 11389
420 Ga0495658_0000771 3300046683 Bacteria 17323
421 Ga0495658_0006453 3300046683 Bacteria 5763
422 Ga0495658_0314274 3300046683 Bacteria 992
423 Ga0495669_0010508 3300046684 Bacteria 3912
424 Ga0495613_0006929 3300046689 Bacteria 8453
425 Ga0495613_0015463 3300046689 Bacteria 5674
426 Ga0495613_0032505 3300046689 Bacteria 3877
427 Ga0495624_0001342 3300046690 Bacteria 19226
428 Ga0495624_0215228 3300046690 Bacteria 1165
429 Ga0495624_0276473 3300046690 Bacteria 1014
430 Ga0495589_0268182 3300046794 Bacteria 795
431 Ga0495600_0032744 3300046809 Bacteria 3373
432 Ga0495600_0059504 3300046809 Bacteria 2495
433 Ga0495600_0148292 3300046809 Bacteria 1520
434 Ga0495660_0220297 3300046810 Bacteria 895
435 Ga0495581_0000018 3300047315 Bacteria 58791
436 Ga0495581_0016589 3300047315 Bacteria 4280
437 Ga0495604_0045914 3300047317 Bacteria 3407
438 Ga0495604_0073781 3300047317 Bacteria 2574
439 Ga0495604_0211974 3300047317 Bacteria 1338
440 Ga0495674_0000134 3300047319 Bacteria 56618
441 Ga0495674_0252255 3300047319 Bacteria 1452
442 Ga0495672_0008522 3300047320 Bacteria 7550
443 Ga0495676_0034073 3300047321 Bacteria 4276
444 Ga0495676_0347515 3300047321 Bacteria 992
445 Ga0495680_0031781 3300047322 Bacteria 4292
446 Ga0495675_0016169 3300047444 Bacteria 4718
447 Ga0495685_042713 3300047447 Bacteria 1547
448 Ga0495684_0013146 3300047471 Bacteria 6387
449 Ga0495684_0035829 3300047471 Bacteria 3805
450 Ga0495686_0237691 3300047472 Bacteria 1029
451 Ga0495593_0000072 3300047673 Bacteria 43039
452 Ga0495593_0000594 3300047673 Bacteria 20595
453 Ga0495593_0032448 3300047673 Bacteria 2847
454 Ga0495593_0103318 3300047673 Bacteria 1460
455 Ga0495593_0251518 3300047673 Bacteria 885
456 Ga0496101_0187462 3300048904 Bacteria 1595
457 Ga0496102_0407294 3300048905 Bacteria 1278
458 Ga0496102_0860033 3300048905 Bacteria 829
459 Ga0496103_0029706 3300048906 Bacteria 3323
460 Ga0496106_0007422 3300048909 Bacteria 8101
461 Ga0496106_0101809 3300048909 Bacteria 2228
462 Ga0496106_0252906 3300048909 Bacteria 1409
463 Ga0496106_0488955 3300048909 Bacteria 989
464 Ga0496107_0029943 3300048910 Bacteria 3877
465 Ga0496107_0274032 3300048910 Bacteria 1256
466 Ga0496108_0438969 3300048911 Bacteria 1140
467 Ga0496110_0477090 3300048913 Bacteria 1136
468 Ga0496112_0075692 3300048915 Bacteria 3329
469 Ga0496114_0106185 3300048917 Bacteria 2403
470 Ga0496114_0291857 3300048917 Bacteria 1439
471 Ga0496114_0403821 3300048917 Bacteria 1210
472 Ga0496115_0017903 3300048918 Bacteria 5428
473 Ga0496115_0045996 3300048918 Bacteria 3486
474 Ga0496115_0248022 3300048918 Bacteria 1467
475 Ga0496115_0436732 3300048918 Bacteria 1059
476 Ga0496116_0305297 3300048919 Bacteria 755
477 Ga0496117_0037310 3300048920 Bacteria 3622
478 Ga0496117_0037409 3300048920 Bacteria 3615
479 Ga0496118_0003042 3300048921 Bacteria 21608
480 Ga0496118_0035533 3300048921 Bacteria 4044
481 Ga0496120_0091510 3300048923 Bacteria 1624
482 Ga0496121_0000091 3300048924 Bacteria 216685
483 Ga0496121_0000716 3300048924 Bacteria 61451
484 Ga0496121_0005545 3300048924 Bacteria 16120
485 Ga0496121_0019090 3300048924 Bacteria 6876
486 Ga0496121_0040476 3300048924 Bacteria 4087
487 Ga0496121_0041274 3300048924 Bacteria 4035
488 Ga0496121_0353043 3300048924 Bacteria 979
489 Ga0496121_0553768 3300048924 Bacteria 719
490 Ga0496124_0012598 3300048927 Bacteria 8323
491 Ga0496124_0257753 3300048927 Bacteria 1286
492 Ga0496125_0000048 3300048928 Bacteria 290651
493 Ga0496125_0000746 3300048928 Bacteria 53671
494 Ga0496125_0013770 3300048928 Bacteria 7926
495 Ga0496126_0004591 3300048929 Bacteria 16376
496 Ga0496126_0005693 3300048929 Bacteria 14121
497 Ga0496126_0021180 3300048929 Bacteria 6357
498 Ga0496126_0061520 3300048929 Bacteria 3372
499 Ga0496126_0129801 3300048929 Bacteria 2179
500 Ga0496126_0174464 3300048929 Bacteria 1829
501 Ga0495682_0134228 3300049460 Bacteria 885
502 Ga0501031_0096761 3300049568 Bacteria 1926
503 Ga0501032_0031733 3300049569 Bacteria 3621
504 Ga0501032_0215846 3300049569 Bacteria 1249
505 Ga0501033_0068962 3300049570 Bacteria 2599
506 Ga0501034_0454308 3300049571 Bacteria 1198
507 Ga0501036_0070794 3300049572 Bacteria 2949
508 Ga0501036_0310787 3300049572 Bacteria 1318
509 Ga0501037_0014354 3300049573 Bacteria 5833
510 Ga0501037_0192717 3300049573 Bacteria 1442
511 Ga0501038_0000621 3300049574 Bacteria 31613
512 Ga0501038_0086836 3300049574 Bacteria 2627
513 Ga0501038_0199039 3300049574 Bacteria 1608
514 Ga0501039_0096527 3300049575 Bacteria 2304
515 Ga0501040_0043042 3300049576 Bacteria 3077
516 Ga0501042_0098853 3300049578 Bacteria 2098
517 Ga0501043_0090823 3300049579 Bacteria 2401
518 Ga0501043_0269462 3300049579 Bacteria 1307
519 Ga0501046_0025427 3300049580 Bacteria 4845
520 Ga0501047_0112228 3300049581 Bacteria 2608
521 Ga0501047_0305411 3300049581 Bacteria 1433
522 Ga0501048_0036430 3300049582 Bacteria 3536
523 Ga0501067_0087347 3300049583 Bacteria 1730
524 Ga0501068_0168483 3300049584 Bacteria 1381
525 Ga0501071_0631393 3300049587 Bacteria 824
526 Ga0501072_0177268 3300049588 Bacteria 1700
527 Ga0501073_0098838 3300049589 Bacteria 2026
528 Ga0501074_0017150 3300049590 Bacteria 5253
529 Ga0501077_0093609 3300049593 Bacteria 1905
530 Ga0501079_0018245 3300049741 Bacteria 5360
531 Ga0501080_0524744 3300049742 Bacteria 1056
532 Ga0501083_0024395 3300049744 Bacteria 4189
533 Ga0501035_0125732 3300049822 Bacteria 2238
534 Ga0501044_0008922 3300049823 Bacteria 10959
535 Ga0501044_0494047 3300049823 Bacteria 1125
536 Ga0501045_0139799 3300049824 Bacteria 1800
537 nmdc:mga03n38_12566_c1 3300050490 Bacteria 3190
538 nmdc:mga06z11_303276_c1 3300050494 Bacteria 950
539 nmdc:mga06z11_320653_c1 3300050494 Bacteria 924
540 nmdc:mga04h51_48535_c1 3300050495 Bacteria 1415
541 nmdc:mga0n895_128691_c1 3300050512 Bacteria 2556
542 nmdc:mga0n895_134642_c1 3300050512 Bacteria 2497
543 nmdc:mga0rr50_370536_c1 3300050513 Bacteria 1206
544 nmdc:mga08x19_85407_c1 3300050514 Bacteria 2077
545 Ga0495601_0034250 3300053077 Bacteria 3167
546 Ga0495612_0011133 3300053078 Bacteria 3631
547 Ga0495612_0109356 3300053078 Bacteria 1182
548 Ga0500610_0100392 3300053079 Bacteria 1498
549 Ga0500635_0001063 3300053080 Bacteria 6566
550 Ga0500635_0001671 3300053080 Bacteria 5362
551 Ga0500635_0012384 3300053080 Bacteria 2448
552 Ga0495595_0000449 3300053084 Bacteria 15558
553 Ga0495619_0020998 3300053085 Bacteria 4165
554 Ga0500643_095976 3300053087 Bacteria 806
555 Ga0500651_0028614 3300053093 Bacteria 3504
556 Ga0500566_0000065 3300053094 Bacteria 50325
557 Ga0500566_0073701 3300053094 Bacteria 1913
558 Ga0500554_000253 3300053102 Bacteria 11538
559 Ga0500562_039128 3300053108 Bacteria 1260
560 Ga0500572_004849 3300053111 Bacteria 3047
561 Ga0500595_000253 3300053119 Bacteria 35306
562 Ga0500595_002443 3300053119 Bacteria 9214
563 Ga0500595_007200 3300053119 Bacteria 4635
564 Ga0500595_019169 3300053119 Bacteria 2487
565 Ga0500595_091501 3300053119 Bacteria 880
566 Ga0500608_018508 3300053122 Bacteria 3179
567 Ga0500658_0139657 3300053134 Bacteria 1086
568 Ga0500559_0068320 3300053136 Bacteria 1596
569 Ga0500561_0023415 3300053137 Bacteria 1480
570 Ga0500573_0090793 3300053140 Bacteria 1725
571 Ga0500577_0000112 3300053142 Bacteria 19856
572 Ga0500590_045923 3300053148 Bacteria 2235
573 Ga0500590_088033 3300053148 Bacteria 1513
574 Ga0500603_000158 3300053150 Bacteria 16730
575 Ga0500603_008705 3300053150 Bacteria 2258
576 Ga0500630_124419 3300053159 Bacteria 1136
577 Ga0500638_017919 3300053162 Bacteria 3296
578 Ga0500638_110194 3300053162 Bacteria 1272
579 Ga0500636_0041245 3300053177 Bacteria 2730
580 Ga0500636_0088678 3300053177 Bacteria 1774
581 Ga0500636_0346668 3300053177 Bacteria 710
582 Ga0500637_0000157 3300053178 Bacteria 24963
583 Ga0500637_0040903 3300053178 Bacteria 2619
584 Ga0500570_105258 3300053724 Bacteria 1168
585 Ga0500596_001862 3300053735 Bacteria 4240
586 Ga0500596_001994 3300053735 Bacteria 4086
587 Ga0500661_000942 3300055283 Bacteria 5444
588 2513658214 2513237096 Bacteria 8722461
589 2513677508 2513237098 Bacteria 9902361
590 2513862956 2513237137 Bacteria 9558895
591 2513920294 2513237145 Bacteria 8979722
592 2517889286 2517572143 Bacteria 9484767
593 2524470334 2524023210 Bacteria 9029266
594 2723842008 2721755755 Bacteria 8322773
595 2793070943 2791355197 Bacteria 8420563
596 2793077443
597 2885377931 2885374607 Bacteria 8927485
598 2885392420 2885383462 Bacteria 9473874
599 2889035093 2889033259 Bacteria 9099371
600 2903750243 2903748898 Bacteria 9972761
601 2903773116 2903768456 Bacteria 9749579
602 2904692521 2904690495 Bacteria 9412302
603 2906613240
604 2906635470 2906635258 Bacteria 8601019
605 2906668601 2906660503 Bacteria 8595048
606 2908756789 2908756301 Bacteria 8864324
607 2922433736
608 2935634779 2935630451 Bacteria 8169952
609 2941511891 2941507105 Bacteria 8166816
610 2941519593 2941515067 Bacteria 8166720
611 2941527715 2941523033 Bacteria 8169134
612 8006935774 8006933436 Bacteria 10410654
613 8006968294 8006964411 Bacteria 8966052
614 8006975693 8006973647 Bacteria 10679141
615 8006985971 8006984368 Bacteria 9651211
616 8007000224 8006994254 Bacteria 8309700
617 8019563020 8019555841 Bacteria 9642137
618 8019573098 8019565922 Bacteria 9639779
619 8056685160 8056681323 Bacteria 8472857
620 Ga0501070_0247118
621 JGI24737J22298_10037506
622 JGI25406J46586_10001070
623 JGI25404J52841_10005846
624 Ga0070683_100039979
625 Ga0068869_100645658
626 Ga0070680_100097862
627 Ga0070680_100267135
628 Ga0070680_100698008
629 Ga0070682_100140230
630 Ga0070660_100015135
631 Ga0070691_10028127
632 Ga0070692_10108039
633 Ga0070668_100124669
634 Ga0070671_100376557
635 Ga0070674_100021497
636 Ga0070659_100061934
637 Ga0070659_100566076
638 Ga0070709_10000732
639 Ga0070709_10068699
640 Ga0070709_10123135
641 Ga0070709_10489253
642 Ga0070714_100010788
643 Ga0070714_100056936
644 Ga0070714_100130000
645 Ga0070714_100558377
646 Ga0070713_100004657
647 Ga0070713_100053012
648 Ga0070713_100089395
649 Ga0070713_100128305
650 Ga0070713_100310531
651 Ga0070710_10004377
652 Ga0070710_10014128
653 Ga0070710_10167727
654 Ga0070711_100001113
655 Ga0070663_100015495
656 Ga0070662_100029453
657 Ga0070681_10087866
658 Ga0070681_10168780
659 Ga0070707_100062897
660 Ga0070698_100083348
661 Ga0070679_100023653
662 Ga0070679_100396250
663 Ga0070684_100008002
664 Ga0070684_100021034
665 Ga0070697_100031162
666 Ga0070697_100062812
667 Ga0070697_100165141
668 Ga0068853_100034017
669 Ga0068853_100127126
670 Ga0070672_100042288
671 Ga0070693_100096847
672 Ga0070665_100401617
673 Ga0068855_100012487
674 Ga0068855_100052929
675 Ga0068857_100023914
676 Ga0068857_100059405
677 Ga0068857_100420465
678 Ga0068854_100376662
679 Ga0068854_100511060
680 Ga0068856_100928639
681 Ga0070702_100032706
682 Ga0068852_100002923
683 Ga0068852_100048949
684 Ga0068852_100786722
685 Ga0068859_100132852
686 Ga0068866_10026038
687 Ga0068861_100031166
688 Ga0068860_100000257
689 Ga0068862_100177207
690 Ga0081455_10010356
691 Ga0081455_10088422
692 Ga0081540_1006050
693 Ga0081540_1006692
694 Ga0081540_1040529
695 Ga0081539_10000530
696 Ga0070717_10168325
697 Ga0075365_10027944
698 Ga0075368_10029829
699 Ga0075364_10225961
700 Ga0070715_10157171
701 Ga0070716_100009694
702 Ga0070716_100012248
703 Ga0070716_100537794
704 Ga0070712_100014993
705 Ga0070712_100141682
706 Ga0070712_100470155
707 Ga0075369_10049606
708 Ga0075428_100125716
709 Ga0075428_100356015
710 Ga0075434_100072646
711 Ga0068865_100148872
712 Ga0075436_100098286
713 Ga0097620_100132852
714 Ga0075435_100327410
715 Ga0099794_10034843
716 Ga0099794_10038540
717 Ga0099795_10037570
718 Ga0099795_10090904
719 Ga0105240_10009432
720 Ga0105240_10013377
721 Ga0105240_10027328
722 Ga0111539_10121973
723 Ga0105245_10023002
724 Ga0114129_10078084
725 Ga0105243_10036413
726 Ga0105243_10836287
727 Ga0105243_11101531
728 Ga0105241_10141400
729 Ga0105248_10008995
730 Ga0105248_10175028
731 Ga0105237_10005001
732 Ga0105237_10012543
733 Ga0105238_10011156
734 Ga0105238_10472193
735 Ga0105249_10032742
736 Ga0099796_10044981
737 Ga0099796_10078459
738 Ga0105239_10004474
739 Ga0105239_10819732
740 Ga0105239_10968208
741 Ga0105246_10407952
742 Ga0157369_10009146
743 Ga0157369_10031113
744 Ga0157369_10267128
745 Ga0157369_10346000
746 Ga0157378_10134227
747 Ga0157375_10033840
748 Ga0163163_10347324
749 Ga0163163_10822047
750 Ga0157380_10131962
751 Ga0157379_10149767
752 Ga0157376_10431800
753 Ga0163161_10047181
754 Ga0163161_10108055
755 Ga0163161_10147496
756 Ga0213876_10000991
757 Ga0213876_10296837
758 Ga0209148_1009224
759 Ga0209233_1002050
760 Ga0209233_1004852
761 Ga0209455_1005109
762 Ga0209455_1012118
763 Ga0207656_10062872
764 Ga0207692_10000494
765 Ga0207692_10042495
766 Ga0207710_10006473
767 Ga0207688_10130340
768 Ga0207685_10069101
769 Ga0207699_10004161
770 Ga0207699_10015928
771 Ga0207645_10065263
772 Ga0207654_10203702
773 Ga0207707_10043500
774 Ga0207707_10058212
775 Ga0207695_10020475
776 Ga0207695_10028143
777 Ga0207671_10145683
778 Ga0207693_10007348
779 Ga0207693_10054260
780 Ga0207663_10000356
781 Ga0207663_10056552
782 Ga0207660_10026709
783 Ga0207660_10166299
784 Ga0207660_10236008
785 Ga0207657_10006056
786 Ga0207657_10117003
787 Ga0207649_10417556
788 Ga0207652_10018674
789 Ga0207652_10997065
790 Ga0207646_10057962
791 Ga0207646_10628179
792 Ga0207694_10015674
793 Ga0207687_10050362
794 Ga0207700_10037768
795 Ga0207700_10336598
796 Ga0207700_10429936
797 Ga0207664_10001702
798 Ga0207664_10309465
799 Ga0207706_10359974
800 Ga0207686_10345406
801 Ga0207669_10005920
802 Ga0207704_10027636
803 Ga0207665_10033184
804 Ga0207665_10560749
805 Ga0207691_10091254
806 Ga0207691_10766584
807 Ga0207661_10012674
808 Ga0207661_10043590
809 Ga0207667_10011217
810 Ga0207667_10088803
811 Ga0207667_10435136
812 Ga0207667_10993550
813 Ga0207668_10137570
814 Ga0207668_10234194
815 Ga0207677_10019638
816 Ga0207703_10389261
817 Ga0207639_10015161
818 Ga0207678_10073479
819 Ga0207678_10432212
820 Ga0207708_10023977
821 Ga0207702_10000056
822 Ga0207641_10008809
823 Ga0207648_10058517
824 Ga0207674_10018427
825 Ga0207674_10619321
826 Ga0207698_10032169
827 Ga0207698_10093936
828 Ga0207698_10810232
829 Ga0209588_1017686
830 Ga0209588_1021532
831 Ga0268266_10341939
832 Ga0268265_10195946
833 Ga0268264_10000049
834 Ga0265326_10002792
835 Ga0265334_10003782
836 Ga0265336_10000430
837 Ga0307517_10002211
838 Ga0307517_10301388
839 Ga0307517_10349299
840 Ga0307515_10338941
841 Ga0265338_10000024
842 Ga0265324_10031172
843 Ga0307511_10100749
844 Ga0265330_10008045
845 Ga0265330_10013923
846 Ga0265330_10033253
847 Ga0265332_10011317
848 Ga0265328_10146619
849 Ga0265325_10002005
850 Ga0265340_10103774
851 Ga0265339_10045819
852 Ga0265331_10021452
853 Ga0307513_10130648
854 Ga0307513_10547723
855 Ga0307509_10040521
856 Ga0307509_10103840
857 Ga0307509_10241750
858 Ga0307508_10000005
859 Ga0307508_10059018
860 Ga0265314_10000900
861 Ga0265342_10050901
862 Ga0265342_10070545
863 Ga0265342_10330904
864 Ga0307516_10013014
865 Ga0307516_10118051
866 Ga0307516_10245238
867 Ga0307416_100174939
868 Ga0307415_100160604
869 Ga0307507_10006568
870 Ga0307510_10020522
871 Ga0307510_10068511
872 Ga0315911_1000018
873 Ga0316215_1001164
874 Ga0373934_0006395
875 Ga0373940_0020359
876 Ga0373944_0055378
877 Ga0373952_0067162
878 Ga0373923_0001363
879 Ga0373953_0008643
880 Ga0373954_0005748
881 Ga0373954_0033492
882 Ga0373956_0003734
883 Ga0373956_0248536
884 Ga0373957_0001574
885 Ga0373957_0039158
886 Ga0373960_0137412
887 Ga0373946_0002379
888 Ga0373946_0054265
889 Ga0373955_0003197
890 Ga0373955_0033444
891 Ga0373924_0002150
892 Ga0373924_0294345
893 Ga0373931_0414396
894 Ga0373935_0000229
895 Ga0373935_0046204
896 Ga0373935_0112353
897 Ga0373935_0427797
898 Ga0373927_0000071
899 Ga0373927_0004081
900 Ga0373927_0035793
901 Ga0373927_0063549
902 Ga0373927_0146282
903 Ga0373927_0164629
904 Ga0373927_0466129
905 Ga0373933_0000114
906 Ga0373933_0001425
907 Ga0373947_0000540
908 Ga0373947_0001708
909 Ga0373947_0011676
910 Ga0373947_0069223
911 Ga0373947_0143608
912 Ga0373947_0295532
913 Ga0373937_0025351
914 Ga0373937_0083156
915 Ga0373937_0313318
916 Ga0372808_002837
917 Ga0373925_0011299
918 Ga0373925_0015901
919 Ga0373925_0024578
920 Ga0373925_0025137
921 Ga0373925_0039338
922 Ga0373925_0154604
923 Ga0395899_0092631
924 Ga0395900_0003234
925 Ga0395900_0131044
926 Ga0395900_0430249
927 Ga0395898_0003112
928 Ga0395905_0059181
929 Ga0395905_0319599
930 Ga0395901_0052714
931 Ga0395901_0234804
932 Ga0436365_0650112
933 Ga0436365_1026947
934 Ga0436360_1193161
935 Ga0436362_0790756
936 Ga0451795_0646620
937 Ga0451807_0166552
938 Ga0466963_0127118
939 Ga0466957_0026692
940 Ga0466959_0095788
941 Ga0466967_1136960
942 Ga0495617_004269
943 Ga0495592_0011328
944 Ga0495592_0035153
945 Ga0495603_0000035
946 Ga0495603_0012240
947 Ga0495603_0214493
948 Ga0495629_0000081
949 Ga0495629_0002236
950 Ga0495629_0043007
951 Ga0495629_0419301
952 Ga0495629_0509716
953 Ga0495641_0003571
954 Ga0495641_0119489
955 Ga0495651_0033024
956 Ga0495651_0107370
957 Ga0495653_0021802
958 Ga0495580_0007845
959 Ga0495582_0000235
960 Ga0495582_0186347
961 Ga0495582_0299611
962 Ga0495639_0000010
963 Ga0495639_0008724
964 Ga0495662_0003600
965 Ga0495662_0110847
966 Ga0495664_0003381
967 Ga0495664_0127817
968 Ga0495664_0195603
969 Ga0495594_0045839
970 Ga0495606_0231448
971 Ga0495608_0037291
972 Ga0495608_0095113
973 Ga0495610_0044581
974 Ga0495618_0029014
975 Ga0495618_0072387
976 Ga0495618_0193470
977 Ga0495628_0018214
978 Ga0495628_0050808
979 Ga0495630_0003778
980 Ga0495630_0021706
981 Ga0495630_0142515
982 Ga0495632_0160759
983 Ga0495644_0016803
984 Ga0495648_0005171
985 Ga0495648_0118560
986 Ga0495666_0041695
987 Ga0495666_0046722
988 Ga0495652_0023860
989 Ga0495652_0027318
990 Ga0495652_0413290
991 Ga0495665_0000005
992 Ga0495640_0004314
993 Ga0495640_0006942
994 Ga0495640_0010386
995 Ga0495640_0415723
996 Ga0495586_0028532
997 Ga0495587_0032742
998 Ga0495587_0107421
999 Ga0495587_0200318
1000 Ga0495609_0014031
1001 Ga0495645_0005858
1002 Ga0495645_0033977
1003 Ga0495645_0210646
1004 Ga0495645_0273510
1005 Ga0495622_0004449
1006 Ga0495622_0008890
1007 Ga0495622_0155192
1008 Ga0495622_0211096
1009 Ga0495667_0020935
1010 Ga0495667_0030300
1011 Ga0495667_0042926
1012 Ga0495667_0277557
1013 Ga0495656_0023525
1014 Ga0495656_0060560
1015 Ga0495668_0012203
1016 Ga0495668_0034272
1017 Ga0495634_0000261
1018 Ga0495634_0021377
1019 Ga0495634_0037057
1020 Ga0495634_0174845
1021 Ga0495611_0210613
1022 Ga0495625_0091563
1023 Ga0495625_0273812
1024 Ga0495625_0352933
1025 Ga0495635_0006062
1026 Ga0495635_0018394
1027 Ga0495588_0010000
1028 Ga0495657_0011243
1029 Ga0495599_0007860
1030 Ga0495599_0088539
1031 Ga0495599_0349752
1032 Ga0495623_0067061
1033 Ga0495623_0069387
1034 Ga0495623_0415395
1035 Ga0495646_0031838
1036 Ga0495646_0059190
1037 Ga0495646_0313745
1038 Ga0495647_0000500
1039 Ga0495658_0000771
1040 Ga0495658_0006453
1041 Ga0495658_0314274
1042 Ga0495669_0010508
1043 Ga0495613_0006929
1044 Ga0495613_0015463
1045 Ga0495613_0032505
1046 Ga0495624_0001342
1047 Ga0495624_0215228
1048 Ga0495624_0276473
1049 Ga0495589_0268182
1050 Ga0495600_0032744
1051 Ga0495600_0059504
1052 Ga0495600_0148292
1053 Ga0495660_0220297
1054 Ga0495581_0000018
1055 Ga0495581_0016589
1056 Ga0495604_0045914
1057 Ga0495604_0073781
1058 Ga0495604_0211974
1059 Ga0495674_0000134
1060 Ga0495674_0252255
1061 Ga0495672_0008522
1062 Ga0495676_0034073
1063 Ga0495676_0347515
1064 Ga0495680_0031781
1065 Ga0495675_0016169
1066 Ga0495685_042713
1067 Ga0495684_0013146
1068 Ga0495684_0035829
1069 Ga0495686_0237691
1070 Ga0495593_0000072
1071 Ga0495593_0000594
1072 Ga0495593_0032448
1073 Ga0495593_0103318
1074 Ga0495593_0251518
1075 Ga0496101_0187462
1076 Ga0496102_0407294
1077 Ga0496102_0860033
1078 Ga0496103_0029706
1079 Ga0496106_0007422
1080 Ga0496106_0101809
1081 Ga0496106_0252906
1082 Ga0496106_0488955
1083 Ga0496107_0029943
1084 Ga0496107_0274032
1085 Ga0496108_0438969
1086 Ga0496110_0477090
1087 Ga0496112_0075692
1088 Ga0496114_0106185
1089 Ga0496114_0291857
1090 Ga0496114_0403821
1091 Ga0496115_0017903
1092 Ga0496115_0045996
1093 Ga0496115_0248022
1094 Ga0496115_0436732
1095 Ga0496116_0305297
1096 Ga0496117_0037310
1097 Ga0496117_0037409
1098 Ga0496118_0003042
1099 Ga0496118_0035533
1100 Ga0496120_0091510
1101 Ga0496121_0000091
1102 Ga0496121_0000716
1103 Ga0496121_0005545
1104 Ga0496121_0019090
1105 Ga0496121_0040476
1106 Ga0496121_0041274
1107 Ga0496121_0353043
1108 Ga0496121_0553768
1109 Ga0496124_0012598
1110 Ga0496124_0257753
1111 Ga0496125_0000048
1112 Ga0496125_0000746
1113 Ga0496125_0013770
1114 Ga0496126_0004591
1115 Ga0496126_0005693
1116 Ga0496126_0021180
1117 Ga0496126_0061520
1118 Ga0496126_0129801
1119 Ga0496126_0174464
1120 Ga0495682_0134228
1121 Ga0501031_0096761
1122 Ga0501032_0031733
1123 Ga0501032_0215846
1124 Ga0501033_0068962
1125 Ga0501034_0454308
1126 Ga0501036_0070794
1127 Ga0501036_0310787
1128 Ga0501037_0014354
1129 Ga0501037_0192717
1130 Ga0501038_0000621
1131 Ga0501038_0086836
1132 Ga0501038_0199039
1133 Ga0501039_0096527
1134 Ga0501040_0043042
1135 Ga0501042_0098853
1136 Ga0501043_0090823
1137 Ga0501043_0269462
1138 Ga0501046_0025427
1139 Ga0501047_0112228
1140 Ga0501047_0305411
1141 Ga0501048_0036430
1142 Ga0501067_0087347
1143 Ga0501068_0168483
1144 Ga0501071_0631393
1145 Ga0501072_0177268
1146 Ga0501073_0098838
1147 Ga0501074_0017150
1148 Ga0501077_0093609
1149 Ga0501079_0018245
1150 Ga0501080_0524744
1151 Ga0501083_0024395
1152 Ga0501035_0125732
1153 Ga0501044_0008922
1154 Ga0501044_0494047
1155 Ga0501045_0139799
1156 nmdc:mga03n38_12566_c1
1157 nmdc:mga06z11_303276_c1
1158 nmdc:mga06z11_320653_c1
1159 nmdc:mga04h51_48535_c1
1160 nmdc:mga0n895_128691_c1
1161 nmdc:mga0n895_134642_c1
1162 nmdc:mga0rr50_370536_c1
1163 nmdc:mga08x19_85407_c1
1164 Ga0495601_0034250
1165 Ga0495612_0011133
1166 Ga0495612_0109356
1167 Ga0500610_0100392
1168 Ga0500635_0001063
1169 Ga0500635_0001671
1170 Ga0500635_0012384
1171 Ga0495595_0000449
1172 Ga0495619_0020998
1173 Ga0500643_095976
1174 Ga0500651_0028614
1175 Ga0500566_0000065
1176 Ga0500566_0073701
1177 Ga0500554_000253
1178 Ga0500562_039128
1179 Ga0500572_004849
1180 Ga0500595_000253
1181 Ga0500595_002443
1182 Ga0500595_007200
1183 Ga0500595_019169
1184 Ga0500595_091501
1185 Ga0500608_018508
1186 Ga0500658_0139657
1187 Ga0500559_0068320
1188 Ga0500561_0023415
1189 Ga0500573_0090793
1190 Ga0500577_0000112
1191 Ga0500590_045923
1192 Ga0500590_088033
1193 Ga0500603_000158
1194 Ga0500603_008705
1195 Ga0500630_124419
1196 Ga0500638_017919
1197 Ga0500638_110194
1198 Ga0500636_0041245
1199 Ga0500636_0088678
1200 Ga0500636_0346668
1201 Ga0500637_0000157
1202 Ga0500637_0040903
1203 Ga0500570_105258
1204 Ga0500596_001862
1205 Ga0500596_001994
1206 Ga0500661_000942
1207 2513658214
1208 2513677508
1209 2513862956
1210 2513920294
1211 2517889286
1212 2524470334
1213 2723842008
1214 2793070943
1215 2793077443
1216 2885377931
1217 2885392420
1218 2889035093
1219 2903750243
1220 2903773116
1221 2904692521
1222 2906613240
1223 2906635470
1224 2906668601
1225 2908756789
1226 2922433736
1227 2935634779
1228 2941511891
1229 2941519593
1230 2941527715
1231 8006935774
1232 8006968294
1233 8006975693
1234 8006985971
1235 8007000224
1236 8019563020
1237 8019573098
1238 8056685160

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

70

216

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9391 7 243
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9384 5 226
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9366 5 226
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9343 5 243
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9279 4 223
ID Description Score Start End Superfamily
4ymtJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.939 7 243 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.936 3 230 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9354 4 243 3.40.50.300
af_Q9VDR4_1380_1622_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9338 5 227 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9335 7 227 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2N3CF17-F1-model_v4 ABC transporter ATP-binding protein 0.9476 1 225 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A4V2YIE4-F1-model_v4 ATP-binding cassette domain-containing protein 0.9472 4 226 GO:0005524
GO:0016887
GO:0043215
GO:0046677
GO:1900753
AF-A0A6P0JTR8-F1-model_v4 ABC transporter ATP-binding protein 0.946 5 226 GO:0005524
GO:0016887
AF-A0A844W1P5-F1-model_v4 deleted 0.9438 7 222
AF-A0A4Y3RI34-F1-model_v4 Daunorubicin resistance protein DrrA family ABC transporter ATP-binding protein 0.943 3 226 GO:0005524
GO:0016887
GO:0043215
GO:0046677
GO:1900753

Map