F469880

General Info

Members Datasets Scaffolds Average Seq Length
620 376 1240 266

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10004808|JGI25151J46595_100048086
Length 312
Sequence MTCGWPLARFCVPLFRCSVVLLASPSRFPLFLMQNPSPDSSRRRAPDALSVAVPVTPPKAGTQSSFSFKVLTVXIHKGFTFFNRKFILPELREAVRSVGADVVFLQEVTGNHVKHADKFDNYPETPHYEFLADTIWPQFAYGRNAVYTNGHHGNAVLSKFPIVRFENRDVSISGPERRGLLHCELQIPGRSVNVHAICVHLGLMEAHREQQMDMLCDLVRKDIPAHAPVVVAGDFNDWRHRAHARLEKGAELHEVFVQANGKAARTFPARLPLLRLDRIYVRNAIGHAPVVLPLRPWSHLSDHAPLAAEIEL

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
80 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
103 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
112 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
113 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
114 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
117 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
118 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
166 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
173 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
174 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
175 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
176 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
177 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
178 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
179 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
180 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
199 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
200 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
201 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
202 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
203 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
204 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
205 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
208 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
211 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
212 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
213 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
214 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
215 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
216 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
217 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
218 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
219 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
220 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
221 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
222 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
223 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
224 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
225 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
226 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
227 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
228 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
229 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
236 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
237 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
238 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
251 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
256 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
257 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
258 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
261 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
272 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
273 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
282 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
287 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
288 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
289 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
290 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
291 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
294 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
295 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
296 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
299 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
300 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
301 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
302 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
303 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
304 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
305 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
306 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
307 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
308 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
309 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
310 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
311 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
312 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
313 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
314 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
315 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
316 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
317 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
318 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
319 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
320 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
321 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
322 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
323 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
324 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
325 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
326 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
327 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
328 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
329 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
330 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
331 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
332 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
333 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
334 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
335 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
336 2643221658 Variovorax sp. Root411 Isolate Unclassified
337 2643221660 Methylibium sp. Root1272 Isolate Unclassified
338 2643221672 Variovorax sp. Root434 Isolate Unclassified
339 2643221683 Variovorax sp. Root473 Isolate Unclassified
340 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
341 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
342 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
343 2738541307 Variovorax sp. GV008 Isolate Unclassified
344 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
345 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
346 2818991446 Variovorax sp. 1180 Isolate Unclassified
347 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
348 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
349 2842677519 Variovorax sp. R-72495 Isolate Unclassified
350 2842733646 Variovorax sp. R-72446 Isolate Unclassified
351 2842747753 Variovorax sp. R-72060 Isolate Unclassified
352 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
353 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
354 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
355 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
356 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
357 2899924645 Variovorax sp. 369 Isolate Unclassified
358 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
359 2904456579 Variovorax sp. 2002 Isolate Unclassified
360 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
361 2928037797 Variovorax sp. 1126 Isolate Unclassified
362 2928044640 Variovorax sp. 1128 Isolate Unclassified
363 2928051484 Variovorax sp. 1133 Isolate Unclassified
364 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
365 2928070936 Variovorax gossypii 1167 Isolate Unclassified
366 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
367 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
368 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
369 2929520902 Variovorax beijingensis 502 Isolate Unclassified
370 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
371 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
372 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
373 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
374 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
375 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
376 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.97
Metatranscriptomes 0.32
Isolates 8.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.61
Nodule 0.81
Rhizoplane 4.03
Rhizosphere 48.23
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10004808 3300003187 Bacteria 7072
2 JGI24741J21665_1006156 3300001915 Bacteria 2440
3 JGI25155J39150_1000009 3300002704 Bacteria 224358
4 JGI25156J39149_1000009 3300002705 Bacteria 224379
5 JGI25154J39366_1000864 3300002738 Bacteria 13101
6 JGI25154J39366_1002691 3300002738 Bacteria 4339
7 JGI25157J39369_1000007 3300002741 Bacteria 224377
8 JGI25159J45721_1000314 3300002987 Bacteria 22609
9 JGI25159J45721_1004735 3300002987 Bacteria 4418
10 JGI25151J46595_10001596 3300003187 Bacteria 15058
11 JGI25151J46595_10006401 3300003187 Bacteria 5919
12 JGI25153J46596_10005472 3300003215 Bacteria 6650
13 rootH1_10067063 3300003316 Bacteria 4038
14 rootH2_10009627 3300003320 Bacteria 1475
15 rootH2_10034396 3300003320 Bacteria 3241
16 rootL2_10008715 3300003322 Bacteria 8273
17 rootH1_10081743 3300003323 Bacteria 3489
18 JGI25160J50197_1000131 3300003354 Bacteria 67778
19 JGI25161J50226_1000009 3300003374 Bacteria 224699
20 Ga0006562J51391_1034746 3300003578 Bacteria 2998
21 Ga0055538_1000042 3300003751 Bacteria 164754
22 Ga0055539_1000055 3300003752 Bacteria 164754
23 Ga0055533_1000067 3300003756 Bacteria 164754
24 Ga0055532_1000053 3300003758 Bacteria 164751
25 Ga0055525_1000103 3300003759 Bacteria 134778
26 Ga0055527_1007239 3300003760 Bacteria 1363
27 Ga0055535_1000133 3300003761 Bacteria 79386
28 Ga0055542_1000003 3300003762 Bacteria 582721
29 Ga0055537_1000531 3300003773 Bacteria 22155
30 Ga0055537_1003327 3300003773 Bacteria 4972
31 Ga0055524_1000745 3300003775 Bacteria 22155
32 Ga0055524_1000767 3300003775 Bacteria 21616
33 Ga0055536_1000720 3300003781 Bacteria 22157
34 Ga0055536_1001424 3300003781 Bacteria 14415
35 Ga0055536_1002250 3300003781 Bacteria 10986
36 Ga0055536_1002738 3300003781 Bacteria 9757
37 Ga0055534_1000945 3300003784 Bacteria 12950
38 Ga0055534_1003354 3300003784 Bacteria 5066
39 Ga0055534_1010245 3300003784 Bacteria 1977
40 Ga0055528_1000781 3300003790 Bacteria 22139
41 Ga0055528_1007163 3300003790 Bacteria 4969
42 Ga0055530_10000155 3300003791 Bacteria 61666
43 Ga0055530_10001037 3300003791 Bacteria 22148
44 Ga0055530_10003752 3300003791 Bacteria 8390
45 Ga0055530_10005730 3300003791 Bacteria 5779
46 Ga0055530_10038202 3300003791 Bacteria 1195
47 Ga0055540_1000093 3300003792 Bacteria 98452
48 Ga0055540_1000741 3300003792 Bacteria 22148
49 Ga0055540_1001063 3300003792 Bacteria 17504
50 Ga0055540_1025407 3300003792 Bacteria 1452
51 Ga0055531_10001021 3300003794 Bacteria 22148
52 Ga0055531_10001290 3300003794 Bacteria 18878
53 Ga0055531_10001334 3300003794 Bacteria 18432
54 Ga0055541_1000042 3300003841 Bacteria 164754
55 Ga0055543_1000122 3300004625 Bacteria 65110
56 Ga0065165_1017299 3300005262 Bacteria 2661
57 Ga0065714_10065214 3300005288 Bacteria 11813
58 Ga0065707_10245734 3300005295 Bacteria 1141
59 Ga0070676_10002485 3300005328 Bacteria 9459
60 Ga0070676_10135645 3300005328 Bacteria 1561
61 Ga0070670_100000686 3300005331 Bacteria 26278
62 Ga0070670_100001050 3300005331 Bacteria 21921
63 Ga0070670_100011859 3300005331 Bacteria 7453
64 Ga0070670_100102973 3300005331 Bacteria 2459
65 Ga0070670_100252756 3300005331 Bacteria 1536
66 Ga0068869_100008447 3300005334 Bacteria 6640
67 Ga0070680_100015910 3300005336 Bacteria 5907
68 Ga0068868_100010456 3300005338 Bacteria 6720
69 Ga0070660_100031508 3300005339 Bacteria 3983
70 Ga0070661_100019013 3300005344 Bacteria 4891
71 Ga0070661_100234577 3300005344 Bacteria 1411
72 Ga0070668_100579186 3300005347 Bacteria 980
73 Ga0070668_100623216 3300005347 Bacteria 946
74 Ga0070669_100022173 3300005353 Bacteria 4542
75 Ga0070675_100026636 3300005354 Bacteria 4641
76 Ga0070675_100269434 3300005354 Bacteria 1494
77 Ga0070675_100276520 3300005354 Bacteria 1475
78 Ga0070675_100352101 3300005354 Bacteria 1306
79 Ga0070671_100007238 3300005355 Bacteria 8873
80 Ga0070674_100035958 3300005356 Bacteria 3321
81 Ga0070674_100262997 3300005356 Bacteria 1360
82 Ga0070674_100265225 3300005356 Bacteria 1355
83 Ga0070673_100009194 3300005364 Bacteria 6624
84 Ga0070659_100019633 3300005366 Bacteria 5126
85 Ga0070659_100027253 3300005366 Bacteria 4401
86 Ga0070667_100054862 3300005367 Bacteria 3365
87 Ga0070708_100582211 3300005445 Bacteria 1055
88 Ga0070663_100424534 3300005455 Bacteria 1091
89 Ga0070662_100040555 3300005457 Bacteria 3316
90 Ga0070662_100192164 3300005457 Bacteria 1615
91 Ga0070681_10088594 3300005458 Bacteria 3046
92 Ga0068867_100000004 3300005459 Bacteria 180739
93 Ga0068867_100005860 3300005459 Bacteria 8715
94 Ga0068867_100179878 3300005459 Bacteria 1681
95 Ga0070706_100004228 3300005467 Bacteria 13936
96 Ga0070707_100025621 3300005468 Bacteria 5598
97 Ga0070698_100136261 3300005471 Bacteria 2409
98 Ga0070679_100023066 3300005530 Bacteria 6088
99 Ga0068853_100020374 3300005539 Bacteria 5515
100 Ga0068853_100075499 3300005539 Bacteria 2942
101 Ga0070672_100026650 3300005543 Bacteria 4305
102 Ga0070665_100265496 3300005548 Bacteria 1718
103 Ga0068855_100010486 3300005563 Bacteria 11177
104 Ga0070664_100021980 3300005564 Bacteria 5261
105 Ga0070664_100031420 3300005564 Bacteria 4437
106 Ga0070664_100282323 3300005564 Bacteria 1497
107 Ga0068857_100038098 3300005577 Bacteria 4258
108 Ga0068854_100036610 3300005578 Bacteria 3442
109 Ga0068854_100246120 3300005578 Bacteria 1426
110 Ga0068852_100020079 3300005616 Bacteria 5306
111 Ga0068852_100202585 3300005616 Bacteria 1878
112 Ga0068851_10001057 3300005834 Bacteria 11919
113 Ga0068870_10019671 3300005840 Bacteria 3278
114 Ga0068862_100009180 3300005844 Bacteria 8192
115 Ga0075365_10077346 3300006038 Bacteria 2248
116 Ga0075365_10177479 3300006038 Bacteria 1488
117 Ga0075364_10028970 3300006051 Bacteria 3548
118 Ga0075364_10131360 3300006051 Bacteria 1681
119 Ga0075362_10111929 3300006177 Bacteria 1285
120 Ga0075362_10206263 3300006177 Bacteria 958
121 Ga0075367_10027470 3300006178 Bacteria 3238
122 Ga0075366_10001013 3300006195 Bacteria 13759
123 Ga0075366_10007139 3300006195 Bacteria 6152
124 Ga0075366_10073824 3300006195 Bacteria 2033
125 Ga0075366_10196083 3300006195 Bacteria 1228
126 Ga0075370_10001864 3300006353 Bacteria 9447
127 Ga0075370_10002054 3300006353 Bacteria 9152
128 Ga0075370_10005780 3300006353 Bacteria 6182
129 Ga0075370_10017703 3300006353 Bacteria 3853
130 Ga0075370_10026714 3300006353 Bacteria 3199
131 Ga0075370_10117912 3300006353 Bacteria 1544
132 Ga0075370_10377238 3300006353 Bacteria 849
133 Ga0068871_100299153 3300006358 Bacteria 1412
134 Ga0079104_1000138 3300006946 Bacteria 103200
135 Ga0099826_10000602 3300006948 Bacteria 18299
136 Ga0105244_10003334 3300009036 Bacteria 11540
137 Ga0105244_10007210 3300009036 Bacteria 7091
138 Ga0105250_10000691 3300009092 Bacteria 21018
139 Ga0105243_10000660 3300009148 Bacteria 34104
140 Ga0105243_10001333 3300009148 Bacteria 22028
141 Ga0105243_10008019 3300009148 Bacteria 8108
142 Ga0105243_10097697 3300009148 Bacteria 2431
143 Ga0105243_10100672 3300009148 Bacteria 2398
144 Ga0105243_10207870 3300009148 Bacteria 1721
145 Ga0105243_10445404 3300009148 Bacteria 1214
146 Ga0105248_10455718 3300009177 Bacteria 1441
147 Ga0105248_10829719 3300009177 Bacteria 1043
148 Ga0105237_10141555 3300009545 Bacteria 2399
149 Ga0105239_10049077 3300010375 Bacteria 4628
150 Ga0157347_1000943 3300012502 Bacteria 2120
151 Ga0157373_10002871 3300013100 Bacteria 13035
152 Ga0157373_10012279 3300013100 Bacteria 6296
153 Ga0157373_10035762 3300013100 Bacteria 3564
154 Ga0157371_10013100 3300013102 Bacteria 6312
155 Ga0157370_10001888 3300013104 Bacteria 25792
156 Ga0157370_10066395 3300013104 Bacteria 3412
157 Ga0157370_10209073 3300013104 Bacteria 1809
158 Ga0157369_10015740 3300013105 Bacteria 8522
159 Ga0163162_10013289 3300013306 Bacteria 8042
160 Ga0163162_10233665 3300013306 Bacteria 1969
161 Ga0163162_10488083 3300013306 Bacteria 1363
162 Ga0157375_10018063 3300013308 Bacteria 6388
163 Ga0163163_10200859 3300014325 Bacteria 2042
164 Ga0157380_10012507 3300014326 Bacteria 6159
165 Ga0182008_10000576 3300014497 Bacteria 27046
166 Ga0182008_10001595 3300014497 Bacteria 15083
167 Ga0182008_10003516 3300014497 Bacteria 9433
168 Ga0182008_10004502 3300014497 Bacteria 8137
169 Ga0182008_10027924 3300014497 Bacteria 2855
170 Ga0157377_10000010 3300014745 Bacteria 380929
171 Ga0157377_10154473 3300014745 Bacteria 1422
172 Ga0182006_1001381 3300015261 Bacteria 14767
173 Ga0182006_1010480 3300015261 Bacteria 4120
174 Ga0182007_10000214 3300015262 Bacteria 38835
175 Ga0182007_10003951 3300015262 Bacteria 6849
176 Ga0183362_10004 3300015683 Bacteria 569303
177 Ga0163161_10146045 3300017792 Bacteria 1794
178 Ga0163161_10270748 3300017792 Bacteria 1329
179 Ga0209435_100008 3300025206 Bacteria 503644
180 Ga0209435_100313 3300025206 Bacteria 11630
181 Ga0209784_100060 3300025224 Bacteria 164838
182 Ga0209566_100075 3300025225 Bacteria 164838
183 Ga0209674_100100 3300025226 Bacteria 164838
184 Ga0209672_100719 3300025228 Bacteria 16353
185 Ga0209147_100096 3300025229 Bacteria 164838
186 Ga0209563_100118 3300025230 Bacteria 131627
187 Ga0209437_108097 3300025233 Bacteria 1689
188 Ga0209258_100015 3300025242 Bacteria 706310
189 Ga0209258_100387 3300025242 Bacteria 56263
190 Ga0207425_1001469 3300025245 Bacteria 9819
191 Ga0207425_1011362 3300025245 Bacteria 2128
192 Ga0209646_1000029 3300025246 Bacteria 386414
193 Ga0209646_1000276 3300025246 Bacteria 45523
194 Ga0209026_1000016 3300025250 Bacteria 386457
195 Ga0209677_100057 3300025253 Bacteria 164838
196 Ga0209148_1000028 3300025254 Bacteria 582773
197 Ga0209759_1000016 3300025256 Bacteria 386414
198 Ga0209759_1034851 3300025256 Bacteria 935
199 Ga0209129_1000297 3300025258 Bacteria 46564
200 Ga0209129_1003087 3300025258 Bacteria 7504
201 Ga0209565_1000061 3300025263 Bacteria 185308
202 Ga0209565_1000144 3300025263 Bacteria 99074
203 Ga0209565_1001048 3300025263 Bacteria 13960
204 Ga0209565_1001227 3300025263 Bacteria 12058
205 Ga0209565_1002757 3300025263 Bacteria 6093
206 Ga0209565_1011667 3300025263 Bacteria 2127
207 Ga0209673_1000136 3300025273 Bacteria 159975
208 Ga0209673_1000396 3300025273 Bacteria 77797
209 Ga0209673_1000491 3300025273 Bacteria 65636
210 Ga0209673_1004732 3300025273 Bacteria 7164
211 Ga0209673_1042389 3300025273 Bacteria 1280
212 Ga0209130_1000014 3300025284 Bacteria 412039
213 Ga0209130_1000392 3300025284 Bacteria 47896
214 Ga0209130_1000986 3300025284 Bacteria 22204
215 Ga0209130_1007351 3300025284 Bacteria 3412
216 Ga0209675_1000071 3300025291 Bacteria 168382
217 Ga0209675_1000105 3300025291 Bacteria 121013
218 Ga0209675_1000703 3300025291 Bacteria 23088
219 Ga0209675_1003680 3300025291 Bacteria 7164
220 Ga0209675_1008294 3300025291 Bacteria 3841
221 Ga0209675_1017091 3300025291 Bacteria 2084
222 Ga0209676_1000013 3300025292 Bacteria 816080
223 Ga0209676_1000153 3300025292 Bacteria 166393
224 Ga0209676_1000167 3300025292 Bacteria 156470
225 Ga0209676_1000241 3300025292 Bacteria 117623
226 Ga0209676_1000496 3300025292 Bacteria 63126
227 Ga0209676_1005991 3300025292 Bacteria 6142
228 Ga0209676_1012832 3300025292 Bacteria 3258
229 Ga0209025_1000410 3300025294 Bacteria 86076
230 Ga0209025_1000627 3300025294 Bacteria 62581
231 Ga0209025_1000661 3300025294 Bacteria 59706
232 Ga0209025_1009005 3300025294 Bacteria 7050
233 Ga0209025_1009876 3300025294 Bacteria 6568
234 Ga0209025_1025198 3300025294 Bacteria 3036
235 Ga0209025_1037213 3300025294 Bacteria 2163
236 Ga0209025_1056584 3300025294 Bacteria 1506
237 Ga0209564_1000110 3300025295 Bacteria 212842
238 Ga0209564_1000123 3300025295 Bacteria 202487
239 Ga0209564_1000181 3300025295 Bacteria 151002
240 Ga0209564_1000247 3300025295 Bacteria 116628
241 Ga0209564_1007727 3300025295 Bacteria 5473
242 Ga0209758_1000039 3300025297 Bacteria 428951
243 Ga0209758_1002335 3300025297 Bacteria 19579
244 Ga0209758_1010275 3300025297 Bacteria 5632
245 Ga0209050_1000008 3300025298 Bacteria 1144179
246 Ga0209050_1000015 3300025298 Bacteria 759102
247 Ga0209050_1000285 3300025298 Bacteria 106573
248 Ga0209050_1000484 3300025298 Bacteria 69688
249 Ga0209050_1000665 3300025298 Bacteria 52282
250 Ga0209050_1008965 3300025298 Bacteria 5217
251 Ga0209050_1011384 3300025298 Bacteria 4226
252 Ga0209256_1000039 3300025299 Bacteria 372337
253 Ga0209256_1000074 3300025299 Bacteria 236893
254 Ga0209256_1000082 3300025299 Bacteria 221491
255 Ga0209256_1000627 3300025299 Bacteria 48553
256 Ga0207426_1000112 3300025302 Bacteria 231436
257 Ga0207426_1000121 3300025302 Bacteria 219007
258 Ga0207426_1000242 3300025302 Bacteria 122839
259 Ga0207426_1001759 3300025302 Bacteria 16401
260 Ga0209051_1000004 3300025303 Bacteria 1155596
261 Ga0209051_1000005 3300025303 Bacteria 1142353
262 Ga0209051_1000010 3300025303 Bacteria 641298
263 Ga0209051_1000081 3300025303 Bacteria 195619
264 Ga0209051_1000180 3300025303 Bacteria 113724
265 Ga0209051_1024635 3300025303 Bacteria 2468
266 Ga0209257_1000026 3300025304 Bacteria 723225
267 Ga0209257_1000031 3300025304 Bacteria 688770
268 Ga0209257_1000038 3300025304 Bacteria 609032
269 Ga0209257_1000565 3300025304 Bacteria 62766
270 Ga0209257_1004562 3300025304 Bacteria 10605
271 Ga0209257_1010064 3300025304 Bacteria 4891
272 Ga0209257_1011998 3300025304 Bacteria 4077
273 Ga0207656_10005408 3300025321 Bacteria 4511
274 Ga0207696_1000339 3300025711 Bacteria 48686
275 Ga0207655_1001161 3300025728 Bacteria 25626
276 Ga0207682_10024007 3300025893 Bacteria 2411
277 Ga0207682_10113368 3300025893 Bacteria 1196
278 Ga0207645_10001047 3300025907 Bacteria 22890
279 Ga0207643_10015932 3300025908 Bacteria 4094
280 Ga0207684_10108260 3300025910 Bacteria 2378
281 Ga0207660_10240404 3300025917 Bacteria 1426
282 Ga0207649_10016734 3300025920 Bacteria 4143
283 Ga0207646_10054700 3300025922 Bacteria 3569
284 Ga0207681_10053677 3300025923 Bacteria 2737
285 Ga0207694_10017236 3300025924 Bacteria 5458
286 Ga0207650_10000278 3300025925 Bacteria 53364
287 Ga0207650_10000324 3300025925 Bacteria 46570
288 Ga0207650_10053364 3300025925 Bacteria 2996
289 Ga0207650_10098789 3300025925 Bacteria 2243
290 Ga0207650_10213585 3300025925 Bacteria 1550
291 Ga0207659_10096189 3300025926 Bacteria 2222
292 Ga0207659_10097561 3300025926 Bacteria 2208
293 Ga0207659_10246542 3300025926 Bacteria 1447
294 Ga0207687_10011653 3300025927 Bacteria 5747
295 Ga0207644_10008031 3300025931 Bacteria 6903
296 Ga0207690_10000831 3300025932 Bacteria 19793
297 Ga0207690_10069140 3300025932 Bacteria 2429
298 Ga0207706_10034320 3300025933 Bacteria 4514
299 Ga0207706_10049084 3300025933 Bacteria 3731
300 Ga0207706_10301278 3300025933 Bacteria 1397
301 Ga0207709_10000438 3300025935 Bacteria 39257
302 Ga0207709_10000895 3300025935 Bacteria 22511
303 Ga0207709_10001037 3300025935 Bacteria 20521
304 Ga0207709_10001829 3300025935 Bacteria 14203
305 Ga0207709_10044923 3300025935 Bacteria 2672
306 Ga0207709_10275202 3300025935 Bacteria 1241
307 Ga0207669_10042004 3300025937 Bacteria 2666
308 Ga0207691_10037655 3300025940 Bacteria 4478
309 Ga0207691_10561316 3300025940 Bacteria 968
310 Ga0207711_10740164 3300025941 Bacteria 917
311 Ga0207661_10052866 3300025944 Bacteria 3248
312 Ga0207661_10054497 3300025944 Bacteria 3204
313 Ga0207679_10000629 3300025945 Bacteria 23458
314 Ga0207679_10028463 3300025945 Bacteria 3878
315 Ga0207679_10036045 3300025945 Bacteria 3505
316 Ga0207679_10128960 3300025945 Bacteria 2026
317 Ga0207667_10030913 3300025949 Bacteria 5787
318 Ga0207651_10020643 3300025960 Bacteria 3982
319 Ga0207640_10070623 3300025981 Bacteria 2349
320 Ga0207640_10267229 3300025981 Bacteria 1336
321 Ga0207658_10067427 3300025986 Bacteria 2695
322 Ga0207677_10038114 3300026023 Bacteria 3148
323 Ga0207639_10045961 3300026041 Bacteria 3292
324 Ga0207639_10105551 3300026041 Bacteria 2286
325 Ga0207639_10578020 3300026041 Bacteria 1034
326 Ga0207678_10351296 3300026067 Bacteria 1272
327 Ga0207648_10000002 3300026089 Bacteria 307909
328 Ga0207648_10010248 3300026089 Bacteria 8901
329 Ga0207674_10017241 3300026116 Bacteria 7879
330 Ga0207674_10064682 3300026116 Bacteria 3689
331 Ga0207674_10552416 3300026116 Bacteria 1112
332 Ga0207683_10347641 3300026121 Unclassified 1361
333 Ga0209281_1000023 3300027111 Bacteria 519955
334 Ga0209282_1001014 3300027666 Bacteria 14766
335 Ga0209974_10046757 3300027876 Bacteria 1448
336 Ga0268266_10052801 3300028379 Bacteria 3491
337 Ga0268266_10687648 3300028379 Bacteria 986
338 Ga0268265_10013608 3300028380 Bacteria 5532
339 Ga0307517_10009384 3300028786 Bacteria 13860
340 Ga0307517_10061150 3300028786 Bacteria 3569
341 Ga0307515_10000374 3300028794 Bacteria 109304
342 Ga0307515_10000585 3300028794 Bacteria 85580
343 Ga0307515_10004409 3300028794 Bacteria 29143
344 Ga0307515_10086104 3300028794 Bacteria 4010
345 Ga0307515_10101239 3300028794 Bacteria 3480
346 Ga0307515_10169879 3300028794 Bacteria 2179
347 Ga0307515_10249837 3300028794 Bacteria 1528
348 Ga0307511_10126332 3300030521 Bacteria 1559
349 Ga0307512_10042144 3300030522 Bacteria 3784
350 Ga0316177_1125066 3300030731 Bacteria 4050
351 Ga0316176_1125671 3300030732 Bacteria 3639
352 Ga0314311_1145075 3300030733 Bacteria 7382
353 Ga0316178_1137182 3300030735 Bacteria 4608
354 Ga0316180_1140543 3300030736 Bacteria 10132
355 Ga0316183_1031124 3300030742 Bacteria 6967
356 Ga0316181_1056362 3300030744 Bacteria 4614
357 Ga0307513_10000363 3300031456 Bacteria 66311
358 Ga0307513_10002839 3300031456 Bacteria 23740
359 Ga0307513_10020161 3300031456 Bacteria 7911
360 Ga0307513_10022805 3300031456 Bacteria 7346
361 Ga0307513_10034853 3300031456 Bacteria 5640
362 Ga0307513_10177769 3300031456 Bacteria 1996
363 Ga0307509_10218832 3300031507 Bacteria 1720
364 Ga0307408_100006099 3300031548 Bacteria 8014
365 Ga0307508_10001752 3300031616 Bacteria 24086
366 Ga0307508_10001778 3300031616 Bacteria 23959
367 Ga0307514_10003197 3300031649 Bacteria 15995
368 Ga0307514_10034102 3300031649 Bacteria 4057
369 Ga0307514_10088115 3300031649 Bacteria 2272
370 Ga0265342_10104260 3300031712 Bacteria 1612
371 Ga0307516_10000432 3300031730 Bacteria 55006
372 Ga0307516_10007238 3300031730 Bacteria 12786
373 Ga0307516_10007622 3300031730 Bacteria 12398
374 Ga0307516_10174133 3300031730 Bacteria 1890
375 Ga0307516_10187650 3300031730 Bacteria 1796
376 Ga0307516_10195243 3300031730 Bacteria 1747
377 Ga0307405_10192694 3300031731 Bacteria 1473
378 Ga0307405_10654448 3300031731 Bacteria 864
379 Ga0307410_10393811 3300031852 Bacteria 1117
380 Ga0307406_10043596 3300031901 Bacteria 2807
381 Ga0307406_10321785 3300031901 Bacteria 1197
382 Ga0307412_10030876 3300031911 Bacteria 3378
383 Ga0307416_100165913 3300032002 Bacteria 2048
384 Ga0307414_10307651 3300032004 Bacteria 1344
385 Ga0307414_10398417 3300032004 Bacteria 1195
386 Ga0307411_10093870 3300032005 Bacteria 2102
387 Ga0307415_100216161 3300032126 Bacteria 1533
388 Ga0395898_0085604 3300037466 Bacteria 3038
389 Ga0395905_0030319 3300037471 Bacteria 5097
390 Ga0395905_0721785 3300037471 Bacteria 899
391 Ga0439436_0000577 3300041404 Bacteria 9708
392 Ga0439461_0058005 3300041410 Bacteria 874
393 Ga0439466_0005485 3300041411 Bacteria 4844
394 Ga0439466_0043234 3300041411 Bacteria 1497
395 Ga0439465_0004086 3300041413 Bacteria 4745
396 Ga0451797_1402468 3300041453 Bacteria 2799
397 Ga0451795_1609977 3300041456 Bacteria 1867
398 Ga0451798_0974092 3300041458 Bacteria 1197
399 Ga0451802_1291151 3300041460 Bacteria 1754
400 Ga0451807_0945747 3300041486 Bacteria 1052
401 Ga0451833_1449534 3300041491 Bacteria 1008
402 Ga0451851_0502449 3300041507 Bacteria 1955
403 Ga0451853_0849379 3300041512 Bacteria 1095
404 Ga0439431_0009932 3300041997 Bacteria 2155
405 Ga0439431_0022070 3300041997 Bacteria 1532
406 Ga0439445_0010557 3300042004 Bacteria 2189
407 Ga0439449_0013756 3300042007 Bacteria 3045
408 Ga0450911_000269 3300042115 Bacteria 19395
409 Ga0450919_000255 3300042121 Bacteria 6111
410 Ga0450920_023133 3300042122 Bacteria 1204
411 Ga0450921_000010 3300042123 Bacteria 4774
412 Ga0450922_002601 3300042124 Bacteria 1686
413 Ga0450923_009380 3300042125 Bacteria 1710
414 Ga0450890_005365 3300042127 Bacteria 1650
415 Ga0450891_004231 3300042129 Bacteria 1350
416 Ga0450896_007953 3300042133 Bacteria 1466
417 Ga0450906_000177 3300042145 Bacteria 11915
418 Ga0450910_001389 3300042147 Bacteria 3039
419 Ga0450908_000284 3300042184 Bacteria 10029
420 Ga0450909_004267 3300042185 Bacteria 2039
421 Ga0439434_0001778 3300042435 Bacteria 6265
422 Ga0439434_0055081 3300042435 Bacteria 1238
423 Ga0450893_0002079 3300042532 Bacteria 3117
424 Ga0495627_004467 3300046453 Bacteria 5851
425 Ga0495590_0011562 3300046457 Bacteria 3296
426 Ga0495638_0008100 3300046460 Bacteria 7473
427 Ga0495638_0156897 3300046460 Bacteria 1316
428 Ga0495639_0003270 3300046475 Bacteria 7037
429 Ga0495583_0001282 3300046506 Bacteria 26263
430 Ga0495610_0004885 3300046512 Bacteria 9745
431 Ga0495610_0066383 3300046512 Bacteria 1699
432 Ga0495616_0001568 3300046513 Bacteria 15754
433 Ga0495620_0003841 3300046515 Bacteria 8563
434 Ga0495631_0000004 3300046518 Bacteria 159706
435 Ga0495632_0001652 3300046519 Bacteria 18276
436 Ga0495632_0104152 3300046519 Bacteria 1336
437 Ga0495632_0105328 3300046519 Bacteria 1327
438 Ga0495637_0012316 3300046520 Bacteria 4095
439 Ga0495654_0003251 3300046530 Bacteria 10025
440 Ga0495654_0003266 3300046530 Bacteria 9999
441 Ga0495654_0003434 3300046530 Bacteria 9712
442 Ga0495586_0256543 3300046535 Bacteria 998
443 Ga0495609_0104177 3300046538 Bacteria 1228
444 Ga0495621_0002367 3300046539 Bacteria 5067
445 Ga0495621_0003922 3300046539 Bacteria 4135
446 Ga0495621_0014308 3300046539 Bacteria 2509
447 Ga0495621_0022691 3300046539 Bacteria 2083
448 Ga0495656_0007178 3300046615 Bacteria 3932
449 Ga0495668_0036801 3300046616 Bacteria 2741
450 Ga0495668_0086498 3300046616 Bacteria 1719
451 Ga0495625_0001405 3300046660 Bacteria 29481
452 Ga0495588_0003846 3300046674 Bacteria 6580
453 Ga0495588_0016176 3300046674 Bacteria 3602
454 Ga0495588_0034944 3300046674 Bacteria 2545
455 Ga0495658_0018269 3300046683 Bacteria 3642
456 Ga0495624_0024245 3300046690 Bacteria 3994
457 Ga0495670_0058771 3300046691 Bacteria 1930
458 Ga0495671_0001138 3300046692 Bacteria 18320
459 Ga0495649_0005163 3300046694 Bacteria 8372
460 Ga0495660_0035915 3300046810 Bacteria 2766
461 Ga0495660_0044478 3300046810 Bacteria 2442
462 Ga0495660_0076794 3300046810 Bacteria 1759
463 Ga0495604_0422391 3300047317 Bacteria 875
464 Ga0495676_0077602 3300047321 Bacteria 2532
465 Ga0495687_001439 3300047443 Bacteria 21864
466 Ga0495677_0072579 3300047445 Bacteria 1284
467 Ga0495681_0040262 3300047470 Bacteria 2277
468 Ga0495686_0001324 3300047472 Bacteria 27731
469 Ga0495686_0115323 3300047472 Bacteria 1607
470 Ga0495593_0000598 3300047673 Bacteria 20528
471 Ga0495614_0049802 3300048089 Bacteria 1795
472 Ga0495614_0086853 3300048089 Bacteria 1358
473 Ga0495615_0008575 3300048090 Bacteria 1982
474 Ga0496100_0004722 3300048903 Bacteria 7264
475 Ga0496101_0040256 3300048904 Bacteria 3328
476 Ga0496102_0000706 3300048905 Bacteria 33087
477 Ga0496102_0003775 3300048905 Bacteria 12805
478 Ga0496102_0012945 3300048905 Bacteria 7224
479 Ga0496103_0015323 3300048906 Bacteria 4560
480 Ga0496103_0099165 3300048906 Bacteria 1843
481 Ga0496104_0004468 3300048907 Bacteria 12184
482 Ga0496105_0016042 3300048908 Bacteria 5975
483 Ga0496107_0041542 3300048910 Bacteria 3302
484 Ga0496109_0202561 3300048912 Bacteria 1866
485 Ga0496114_0101262 3300048917 Bacteria 2459
486 Ga0496114_0171631 3300048917 Bacteria 1890
487 Ga0496114_0233896 3300048917 Bacteria 1615
488 Ga0496117_0004392 3300048920 Bacteria 15622
489 Ga0496118_0008367 3300048921 Bacteria 10701
490 Ga0496118_0023238 3300048921 Bacteria 5390
491 Ga0496118_0045244 3300048921 Bacteria 3438
492 Ga0496119_0053573 3300048922 Bacteria 2463
493 Ga0496121_0006359 3300048924 Bacteria 14720
494 Ga0496121_0030332 3300048924 Bacteria 4967
495 Ga0496122_0035479 3300048925 Bacteria 4056
496 Ga0496122_0072657 3300048925 Bacteria 2444
497 Ga0496122_0090371 3300048925 Bacteria 2090
498 Ga0496123_0048696 3300048926 Bacteria 2848
499 Ga0496123_0099622 3300048926 Bacteria 1696
500 Ga0496124_0010062 3300048927 Bacteria 9648
501 Ga0496124_0010612 3300048927 Bacteria 9309
502 Ga0496125_0013523 3300048928 Bacteria 8019
503 Ga0496125_0019514 3300048928 Bacteria 6391
504 Ga0496125_0026306 3300048928 Bacteria 5306
505 Ga0496126_0012012 3300048929 Bacteria 8899
506 Ga0496126_0098644 3300048929 Bacteria 2559
507 Ga0501308_007473 3300049128 Bacteria 1145
508 Ga0495678_063637 3300049459 Bacteria 1377
509 Ga0501043_0000071 3300049579 Bacteria 89105
510 Ga0501046_0000311 3300049580 Bacteria 48905
511 Ga0501047_0000087 3300049581 Bacteria 117516
512 Ga0501048_0000226 3300049582 Bacteria 37156
513 Ga0501248_005014 3300049678 Bacteria 1025
514 Ga0501249_001626 3300049679 Bacteria 4593
515 Ga0501225_0001971 3300049705 Bacteria 6413
516 Ga0501241_022096 3300049758 Bacteria 1174
517 Ga0501262_003655 3300049759 Bacteria 1771
518 Ga0501265_011992 3300049762 Bacteria 1076
519 Ga0501045_0009015 3300049824 Bacteria 6969
520 nmdc:mga03683_169068_c1 3300050489 Bacteria 993
521 nmdc:mga03683_21935_c1 3300050489 Bacteria 2469
522 nmdc:mga03683_3922_c1 3300050489 Bacteria 4866
523 nmdc:mga03n38_193078_c1 3300050490 Bacteria 1050
524 nmdc:mga03n38_70880_c1 3300050490 Bacteria 1613
525 nmdc:mga0k408_52510_c1 3300050493 Bacteria 2362
526 nmdc:mga0k408_76349_c1 3300050493 Bacteria 1958
527 nmdc:mga06z11_113638_c1 3300050494 Bacteria 1502
528 nmdc:mga07m45_1068_c1 3300050496 Bacteria 12200
529 nmdc:mga07m45_127127_c1 3300050496 Bacteria 1474
530 nmdc:mga07m45_1331_c1 3300050496 Bacteria 11255
531 nmdc:mga07m45_13831_c1 3300050496 Bacteria 4288
532 nmdc:mga07m45_51509_c1 3300050496 Bacteria 2322
533 nmdc:mga07m45_59709_c1 3300050496 Bacteria 2158
534 nmdc:mga0sz30_19810_c1 3300050516 Bacteria 2707
535 Ga0500610_0000623 3300053079 Bacteria 10848
536 Ga0500610_0022859 3300053079 Bacteria 3088
537 Ga0500644_0015506 3300053088 Bacteria 2175
538 Ga0500651_0000079 3300053093 Bacteria 62532
539 Ga0500651_0004907 3300053093 Bacteria 7566
540 Ga0500566_0002061 3300053094 Bacteria 11875
541 Ga0500562_032310 3300053108 Bacteria 1381
542 Ga0500569_035346 3300053109 Bacteria 1432
543 Ga0500571_000018 3300053110 Bacteria 61068
544 Ga0500593_000059 3300053117 Bacteria 40547
545 Ga0500593_012853 3300053117 Bacteria 3560
546 Ga0500594_0004945 3300053118 Bacteria 2946
547 Ga0500597_021070 3300053120 Bacteria 2569
548 Ga0500655_000774 3300053133 Bacteria 6296
549 Ga0500658_0000057 3300053134 Bacteria 55697
550 Ga0500658_0000456 3300053134 Bacteria 17434
551 Ga0500559_0006069 3300053136 Bacteria 5478
552 Ga0500559_0015915 3300053136 Bacteria 3175
553 Ga0500568_0035770 3300053139 Bacteria 2024
554 Ga0500568_0101380 3300053139 Bacteria 1080
555 Ga0500574_031600 3300053141 Bacteria 1427
556 Ga0500586_057179 3300053145 Bacteria 1353
557 Ga0500616_0020477 3300053153 Bacteria 3715
558 Ga0500619_000101 3300053154 Bacteria 22906
559 Ga0500627_0006385 3300053158 Bacteria 4012
560 Ga0500634_0060278 3300053161 Bacteria 2015
561 Ga0500634_0113864 3300053161 Bacteria 1329
562 Ga0500638_004202 3300053162 Bacteria 5498
563 Ga0500645_000346 3300053730 Bacteria 33036
564 Ga0500645_005051 3300053730 Bacteria 4932
565 Ga0500661_011135 3300055283 Bacteria 1630
566 Ga0590075_019775 3300059424 Bacteria 1673
567 2511242693 2511231002 Bacteria 5042903
568 2513229861 2513020051 Bacteria 6053213
569 2597866252 2597489888 Bacteria 6179543
570 2597872087 2597489889 Bacteria 6297495
571 2599509739 2599185189 Bacteria 5862825
572 2599621515 2599185214 Bacteria 8209958
573 2599670801 2599185226 Bacteria 8233575
574 2599679291 2599185227 Bacteria 8246414
575 2599691026 2599185229 Bacteria 8216126
576 2599951889 2599185303 Bacteria 6512725
577 2601693811 2600255296 Bacteria 5784754
578 2643870802 2643221571 Bacteria 6228673
579 2644244966 2643221644 Bacteria 6865017
580 2644327268 2643221658 Bacteria 6064537
581 2644339564 2643221660 Bacteria 4208257
582 2644401872 2643221672 Bacteria 6322190
583 2644465713 2643221683 Bacteria 5749203
584 2644621310 2643221713 Bacteria 6554480
585 2677899051 2675903420 Bacteria 6247433
586 2723250988 2721755607 Bacteria 5841722
587 2738883563 2738541307 Bacteria 8606193
588 2808977468 2808606385 Bacteria 6711065
589 2808992874 2808606388 Bacteria 6706662
590 2819597681 2818991446 Bacteria 7757362
591 2831268673 2831265667 Bacteria 7184833
592 2838058103 2838054893 Bacteria 7451788
593 2842682554 2842677519 Bacteria 5615038
594 2842737192 2842733646 Bacteria 5716726
595 2842750432 2842747753 Bacteria 5578255
596 2842829022 2842826826 Bacteria 5974129
597 2842840539 2842837860 Bacteria 6066181
598 2852618030 2852612431 Bacteria 6885235
599 2852673088 2852667396 Bacteria 6885555
600 2860872649 2860867994 Bacteria 5645326
601 2899929100 2899924645 Bacteria 7487985
602 2904451346 2904449895 Bacteria 6927402
603 2904458208 2904456579 Bacteria 6819253
604 2919466667 2919462493 Bacteria 5817112
605 2928040465 2928037797 Bacteria 7273642
606 2928046786 2928044640 Bacteria 7271509
607 2928058025 2928051484 Bacteria 7773759
608 2928067634 2928064002 Bacteria 7419480
609 2928072173 2928070936 Bacteria 8062541
610 2928085381 2928084124 Bacteria 7159212
611 2928116691 2928115317 Bacteria 6477646
612 2929160217 2929160207 Bacteria 9075316
613 2929526177 2929520902 Bacteria 6765052
614 2945950731 2945945610 Bacteria 5951079
615 2945974643 2945972063 Bacteria 6086495
616 2946033253 2946027586 Bacteria 6049274
617 2947234041 2947233263 Bacteria 6439278
618 8054352897 8054347763 Bacteria 5901107
619 8054508536 8054503363 Bacteria 6101651
620 8056151871 8056148874 Bacteria 6479865
621 JGI25151J46595_10004808
622 JGI24741J21665_1006156
623 JGI25155J39150_1000009
624 JGI25156J39149_1000009
625 JGI25154J39366_1000864
626 JGI25154J39366_1002691
627 JGI25157J39369_1000007
628 JGI25159J45721_1000314
629 JGI25159J45721_1004735
630 JGI25151J46595_10001596
631 JGI25151J46595_10006401
632 JGI25153J46596_10005472
633 rootH1_10067063
634 rootH2_10009627
635 rootH2_10034396
636 rootL2_10008715
637 rootH1_10081743
638 JGI25160J50197_1000131
639 JGI25161J50226_1000009
640 Ga0006562J51391_1034746
641 Ga0055538_1000042
642 Ga0055539_1000055
643 Ga0055533_1000067
644 Ga0055532_1000053
645 Ga0055525_1000103
646 Ga0055527_1007239
647 Ga0055535_1000133
648 Ga0055542_1000003
649 Ga0055537_1000531
650 Ga0055537_1003327
651 Ga0055524_1000745
652 Ga0055524_1000767
653 Ga0055536_1000720
654 Ga0055536_1001424
655 Ga0055536_1002250
656 Ga0055536_1002738
657 Ga0055534_1000945
658 Ga0055534_1003354
659 Ga0055534_1010245
660 Ga0055528_1000781
661 Ga0055528_1007163
662 Ga0055530_10000155
663 Ga0055530_10001037
664 Ga0055530_10003752
665 Ga0055530_10005730
666 Ga0055530_10038202
667 Ga0055540_1000093
668 Ga0055540_1000741
669 Ga0055540_1001063
670 Ga0055540_1025407
671 Ga0055531_10001021
672 Ga0055531_10001290
673 Ga0055531_10001334
674 Ga0055541_1000042
675 Ga0055543_1000122
676 Ga0065165_1017299
677 Ga0065714_10065214
678 Ga0065707_10245734
679 Ga0070676_10002485
680 Ga0070676_10135645
681 Ga0070670_100000686
682 Ga0070670_100001050
683 Ga0070670_100011859
684 Ga0070670_100102973
685 Ga0070670_100252756
686 Ga0068869_100008447
687 Ga0070680_100015910
688 Ga0068868_100010456
689 Ga0070660_100031508
690 Ga0070661_100019013
691 Ga0070661_100234577
692 Ga0070668_100579186
693 Ga0070668_100623216
694 Ga0070669_100022173
695 Ga0070675_100026636
696 Ga0070675_100269434
697 Ga0070675_100276520
698 Ga0070675_100352101
699 Ga0070671_100007238
700 Ga0070674_100035958
701 Ga0070674_100262997
702 Ga0070674_100265225
703 Ga0070673_100009194
704 Ga0070659_100019633
705 Ga0070659_100027253
706 Ga0070667_100054862
707 Ga0070708_100582211
708 Ga0070663_100424534
709 Ga0070662_100040555
710 Ga0070662_100192164
711 Ga0070681_10088594
712 Ga0068867_100000004
713 Ga0068867_100005860
714 Ga0068867_100179878
715 Ga0070706_100004228
716 Ga0070707_100025621
717 Ga0070698_100136261
718 Ga0070679_100023066
719 Ga0068853_100020374
720 Ga0068853_100075499
721 Ga0070672_100026650
722 Ga0070665_100265496
723 Ga0068855_100010486
724 Ga0070664_100021980
725 Ga0070664_100031420
726 Ga0070664_100282323
727 Ga0068857_100038098
728 Ga0068854_100036610
729 Ga0068854_100246120
730 Ga0068852_100020079
731 Ga0068852_100202585
732 Ga0068851_10001057
733 Ga0068870_10019671
734 Ga0068862_100009180
735 Ga0075365_10077346
736 Ga0075365_10177479
737 Ga0075364_10028970
738 Ga0075364_10131360
739 Ga0075362_10111929
740 Ga0075362_10206263
741 Ga0075367_10027470
742 Ga0075366_10001013
743 Ga0075366_10007139
744 Ga0075366_10073824
745 Ga0075366_10196083
746 Ga0075370_10001864
747 Ga0075370_10002054
748 Ga0075370_10005780
749 Ga0075370_10017703
750 Ga0075370_10026714
751 Ga0075370_10117912
752 Ga0075370_10377238
753 Ga0068871_100299153
754 Ga0079104_1000138
755 Ga0099826_10000602
756 Ga0105244_10003334
757 Ga0105244_10007210
758 Ga0105250_10000691
759 Ga0105243_10000660
760 Ga0105243_10001333
761 Ga0105243_10008019
762 Ga0105243_10097697
763 Ga0105243_10100672
764 Ga0105243_10207870
765 Ga0105243_10445404
766 Ga0105248_10455718
767 Ga0105248_10829719
768 Ga0105237_10141555
769 Ga0105239_10049077
770 Ga0157347_1000943
771 Ga0157373_10002871
772 Ga0157373_10012279
773 Ga0157373_10035762
774 Ga0157371_10013100
775 Ga0157370_10001888
776 Ga0157370_10066395
777 Ga0157370_10209073
778 Ga0157369_10015740
779 Ga0163162_10013289
780 Ga0163162_10233665
781 Ga0163162_10488083
782 Ga0157375_10018063
783 Ga0163163_10200859
784 Ga0157380_10012507
785 Ga0182008_10000576
786 Ga0182008_10001595
787 Ga0182008_10003516
788 Ga0182008_10004502
789 Ga0182008_10027924
790 Ga0157377_10000010
791 Ga0157377_10154473
792 Ga0182006_1001381
793 Ga0182006_1010480
794 Ga0182007_10000214
795 Ga0182007_10003951
796 Ga0183362_10004
797 Ga0163161_10146045
798 Ga0163161_10270748
799 Ga0209435_100008
800 Ga0209435_100313
801 Ga0209784_100060
802 Ga0209566_100075
803 Ga0209674_100100
804 Ga0209672_100719
805 Ga0209147_100096
806 Ga0209563_100118
807 Ga0209437_108097
808 Ga0209258_100015
809 Ga0209258_100387
810 Ga0207425_1001469
811 Ga0207425_1011362
812 Ga0209646_1000029
813 Ga0209646_1000276
814 Ga0209026_1000016
815 Ga0209677_100057
816 Ga0209148_1000028
817 Ga0209759_1000016
818 Ga0209759_1034851
819 Ga0209129_1000297
820 Ga0209129_1003087
821 Ga0209565_1000061
822 Ga0209565_1000144
823 Ga0209565_1001048
824 Ga0209565_1001227
825 Ga0209565_1002757
826 Ga0209565_1011667
827 Ga0209673_1000136
828 Ga0209673_1000396
829 Ga0209673_1000491
830 Ga0209673_1004732
831 Ga0209673_1042389
832 Ga0209130_1000014
833 Ga0209130_1000392
834 Ga0209130_1000986
835 Ga0209130_1007351
836 Ga0209675_1000071
837 Ga0209675_1000105
838 Ga0209675_1000703
839 Ga0209675_1003680
840 Ga0209675_1008294
841 Ga0209675_1017091
842 Ga0209676_1000013
843 Ga0209676_1000153
844 Ga0209676_1000167
845 Ga0209676_1000241
846 Ga0209676_1000496
847 Ga0209676_1005991
848 Ga0209676_1012832
849 Ga0209025_1000410
850 Ga0209025_1000627
851 Ga0209025_1000661
852 Ga0209025_1009005
853 Ga0209025_1009876
854 Ga0209025_1025198
855 Ga0209025_1037213
856 Ga0209025_1056584
857 Ga0209564_1000110
858 Ga0209564_1000123
859 Ga0209564_1000181
860 Ga0209564_1000247
861 Ga0209564_1007727
862 Ga0209758_1000039
863 Ga0209758_1002335
864 Ga0209758_1010275
865 Ga0209050_1000008
866 Ga0209050_1000015
867 Ga0209050_1000285
868 Ga0209050_1000484
869 Ga0209050_1000665
870 Ga0209050_1008965
871 Ga0209050_1011384
872 Ga0209256_1000039
873 Ga0209256_1000074
874 Ga0209256_1000082
875 Ga0209256_1000627
876 Ga0207426_1000112
877 Ga0207426_1000121
878 Ga0207426_1000242
879 Ga0207426_1001759
880 Ga0209051_1000004
881 Ga0209051_1000005
882 Ga0209051_1000010
883 Ga0209051_1000081
884 Ga0209051_1000180
885 Ga0209051_1024635
886 Ga0209257_1000026
887 Ga0209257_1000031
888 Ga0209257_1000038
889 Ga0209257_1000565
890 Ga0209257_1004562
891 Ga0209257_1010064
892 Ga0209257_1011998
893 Ga0207656_10005408
894 Ga0207696_1000339
895 Ga0207655_1001161
896 Ga0207682_10024007
897 Ga0207682_10113368
898 Ga0207645_10001047
899 Ga0207643_10015932
900 Ga0207684_10108260
901 Ga0207660_10240404
902 Ga0207649_10016734
903 Ga0207646_10054700
904 Ga0207681_10053677
905 Ga0207694_10017236
906 Ga0207650_10000278
907 Ga0207650_10000324
908 Ga0207650_10053364
909 Ga0207650_10098789
910 Ga0207650_10213585
911 Ga0207659_10096189
912 Ga0207659_10097561
913 Ga0207659_10246542
914 Ga0207687_10011653
915 Ga0207644_10008031
916 Ga0207690_10000831
917 Ga0207690_10069140
918 Ga0207706_10034320
919 Ga0207706_10049084
920 Ga0207706_10301278
921 Ga0207709_10000438
922 Ga0207709_10000895
923 Ga0207709_10001037
924 Ga0207709_10001829
925 Ga0207709_10044923
926 Ga0207709_10275202
927 Ga0207669_10042004
928 Ga0207691_10037655
929 Ga0207691_10561316
930 Ga0207711_10740164
931 Ga0207661_10052866
932 Ga0207661_10054497
933 Ga0207679_10000629
934 Ga0207679_10028463
935 Ga0207679_10036045
936 Ga0207679_10128960
937 Ga0207667_10030913
938 Ga0207651_10020643
939 Ga0207640_10070623
940 Ga0207640_10267229
941 Ga0207658_10067427
942 Ga0207677_10038114
943 Ga0207639_10045961
944 Ga0207639_10105551
945 Ga0207639_10578020
946 Ga0207678_10351296
947 Ga0207648_10000002
948 Ga0207648_10010248
949 Ga0207674_10017241
950 Ga0207674_10064682
951 Ga0207674_10552416
952 Ga0207683_10347641
953 Ga0209281_1000023
954 Ga0209282_1001014
955 Ga0209974_10046757
956 Ga0268266_10052801
957 Ga0268266_10687648
958 Ga0268265_10013608
959 Ga0307517_10009384
960 Ga0307517_10061150
961 Ga0307515_10000374
962 Ga0307515_10000585
963 Ga0307515_10004409
964 Ga0307515_10086104
965 Ga0307515_10101239
966 Ga0307515_10169879
967 Ga0307515_10249837
968 Ga0307511_10126332
969 Ga0307512_10042144
970 Ga0316177_1125066
971 Ga0316176_1125671
972 Ga0314311_1145075
973 Ga0316178_1137182
974 Ga0316180_1140543
975 Ga0316183_1031124
976 Ga0316181_1056362
977 Ga0307513_10000363
978 Ga0307513_10002839
979 Ga0307513_10020161
980 Ga0307513_10022805
981 Ga0307513_10034853
982 Ga0307513_10177769
983 Ga0307509_10218832
984 Ga0307408_100006099
985 Ga0307508_10001752
986 Ga0307508_10001778
987 Ga0307514_10003197
988 Ga0307514_10034102
989 Ga0307514_10088115
990 Ga0265342_10104260
991 Ga0307516_10000432
992 Ga0307516_10007238
993 Ga0307516_10007622
994 Ga0307516_10174133
995 Ga0307516_10187650
996 Ga0307516_10195243
997 Ga0307405_10192694
998 Ga0307405_10654448
999 Ga0307410_10393811
1000 Ga0307406_10043596
1001 Ga0307406_10321785
1002 Ga0307412_10030876
1003 Ga0307416_100165913
1004 Ga0307414_10307651
1005 Ga0307414_10398417
1006 Ga0307411_10093870
1007 Ga0307415_100216161
1008 Ga0395898_0085604
1009 Ga0395905_0030319
1010 Ga0395905_0721785
1011 Ga0439436_0000577
1012 Ga0439461_0058005
1013 Ga0439466_0005485
1014 Ga0439466_0043234
1015 Ga0439465_0004086
1016 Ga0451797_1402468
1017 Ga0451795_1609977
1018 Ga0451798_0974092
1019 Ga0451802_1291151
1020 Ga0451807_0945747
1021 Ga0451833_1449534
1022 Ga0451851_0502449
1023 Ga0451853_0849379
1024 Ga0439431_0009932
1025 Ga0439431_0022070
1026 Ga0439445_0010557
1027 Ga0439449_0013756
1028 Ga0450911_000269
1029 Ga0450919_000255
1030 Ga0450920_023133
1031 Ga0450921_000010
1032 Ga0450922_002601
1033 Ga0450923_009380
1034 Ga0450890_005365
1035 Ga0450891_004231
1036 Ga0450896_007953
1037 Ga0450906_000177
1038 Ga0450910_001389
1039 Ga0450908_000284
1040 Ga0450909_004267
1041 Ga0439434_0001778
1042 Ga0439434_0055081
1043 Ga0450893_0002079
1044 Ga0495627_004467
1045 Ga0495590_0011562
1046 Ga0495638_0008100
1047 Ga0495638_0156897
1048 Ga0495639_0003270
1049 Ga0495583_0001282
1050 Ga0495610_0004885
1051 Ga0495610_0066383
1052 Ga0495616_0001568
1053 Ga0495620_0003841
1054 Ga0495631_0000004
1055 Ga0495632_0001652
1056 Ga0495632_0104152
1057 Ga0495632_0105328
1058 Ga0495637_0012316
1059 Ga0495654_0003251
1060 Ga0495654_0003266
1061 Ga0495654_0003434
1062 Ga0495586_0256543
1063 Ga0495609_0104177
1064 Ga0495621_0002367
1065 Ga0495621_0003922
1066 Ga0495621_0014308
1067 Ga0495621_0022691
1068 Ga0495656_0007178
1069 Ga0495668_0036801
1070 Ga0495668_0086498
1071 Ga0495625_0001405
1072 Ga0495588_0003846
1073 Ga0495588_0016176
1074 Ga0495588_0034944
1075 Ga0495658_0018269
1076 Ga0495624_0024245
1077 Ga0495670_0058771
1078 Ga0495671_0001138
1079 Ga0495649_0005163
1080 Ga0495660_0035915
1081 Ga0495660_0044478
1082 Ga0495660_0076794
1083 Ga0495604_0422391
1084 Ga0495676_0077602
1085 Ga0495687_001439
1086 Ga0495677_0072579
1087 Ga0495681_0040262
1088 Ga0495686_0001324
1089 Ga0495686_0115323
1090 Ga0495593_0000598
1091 Ga0495614_0049802
1092 Ga0495614_0086853
1093 Ga0495615_0008575
1094 Ga0496100_0004722
1095 Ga0496101_0040256
1096 Ga0496102_0000706
1097 Ga0496102_0003775
1098 Ga0496102_0012945
1099 Ga0496103_0015323
1100 Ga0496103_0099165
1101 Ga0496104_0004468
1102 Ga0496105_0016042
1103 Ga0496107_0041542
1104 Ga0496109_0202561
1105 Ga0496114_0101262
1106 Ga0496114_0171631
1107 Ga0496114_0233896
1108 Ga0496117_0004392
1109 Ga0496118_0008367
1110 Ga0496118_0023238
1111 Ga0496118_0045244
1112 Ga0496119_0053573
1113 Ga0496121_0006359
1114 Ga0496121_0030332
1115 Ga0496122_0035479
1116 Ga0496122_0072657
1117 Ga0496122_0090371
1118 Ga0496123_0048696
1119 Ga0496123_0099622
1120 Ga0496124_0010062
1121 Ga0496124_0010612
1122 Ga0496125_0013523
1123 Ga0496125_0019514
1124 Ga0496125_0026306
1125 Ga0496126_0012012
1126 Ga0496126_0098644
1127 Ga0501308_007473
1128 Ga0495678_063637
1129 Ga0501043_0000071
1130 Ga0501046_0000311
1131 Ga0501047_0000087
1132 Ga0501048_0000226
1133 Ga0501248_005014
1134 Ga0501249_001626
1135 Ga0501225_0001971
1136 Ga0501241_022096
1137 Ga0501262_003655
1138 Ga0501265_011992
1139 Ga0501045_0009015
1140 nmdc:mga03683_169068_c1
1141 nmdc:mga03683_21935_c1
1142 nmdc:mga03683_3922_c1
1143 nmdc:mga03n38_193078_c1
1144 nmdc:mga03n38_70880_c1
1145 nmdc:mga0k408_52510_c1
1146 nmdc:mga0k408_76349_c1
1147 nmdc:mga06z11_113638_c1
1148 nmdc:mga07m45_1068_c1
1149 nmdc:mga07m45_127127_c1
1150 nmdc:mga07m45_1331_c1
1151 nmdc:mga07m45_13831_c1
1152 nmdc:mga07m45_51509_c1
1153 nmdc:mga07m45_59709_c1
1154 nmdc:mga0sz30_19810_c1
1155 Ga0500610_0000623
1156 Ga0500610_0022859
1157 Ga0500644_0015506
1158 Ga0500651_0000079
1159 Ga0500651_0004907
1160 Ga0500566_0002061
1161 Ga0500562_032310
1162 Ga0500569_035346
1163 Ga0500571_000018
1164 Ga0500593_000059
1165 Ga0500593_012853
1166 Ga0500594_0004945
1167 Ga0500597_021070
1168 Ga0500655_000774
1169 Ga0500658_0000057
1170 Ga0500658_0000456
1171 Ga0500559_0006069
1172 Ga0500559_0015915
1173 Ga0500568_0035770
1174 Ga0500568_0101380
1175 Ga0500574_031600
1176 Ga0500586_057179
1177 Ga0500616_0020477
1178 Ga0500619_000101
1179 Ga0500627_0006385
1180 Ga0500634_0060278
1181 Ga0500634_0113864
1182 Ga0500638_004202
1183 Ga0500645_000346
1184 Ga0500645_005051
1185 Ga0500661_011135
1186 Ga0590075_019775
1187 2511242693
1188 2513229861
1189 2597866252
1190 2597872087
1191 2599509739
1192 2599621515
1193 2599670801
1194 2599679291
1195 2599691026
1196 2599951889
1197 2601693811
1198 2643870802
1199 2644244966
1200 2644327268
1201 2644339564
1202 2644401872
1203 2644465713
1204 2644621310
1205 2677899051
1206 2723250988
1207 2738883563
1208 2808977468
1209 2808992874
1210 2819597681
1211 2831268673
1212 2838058103
1213 2842682554
1214 2842737192
1215 2842750432
1216 2842829022
1217 2842840539
1218 2852618030
1219 2852673088
1220 2860872649
1221 2899929100
1222 2904451346
1223 2904458208
1224 2919466667
1225 2928040465
1226 2928046786
1227 2928058025
1228 2928067634
1229 2928072173
1230 2928085381
1231 2928116691
1232 2929160217
1233 2929526177
1234 2945950731
1235 2945974643
1236 2946033253
1237 2947234041
1238 8054352897
1239 8054508536
1240 8056151871

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

87

303

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wxk-assembly1.cif.gz_B earp bound with domain i of ef-p 0.7981 113 150
5inn-assembly3.cif.gz_C mouse tdp2 d358n protein, apo state with increased disorder amongst variable dna-binding grasp conformations 0.7818 17 259
5inn-assembly3.cif.gz_C mouse tdp2 d358n protein, apo state with increased disorder amongst variable dna-binding grasp conformations 0.7756 17 259
7di7-assembly1.cif.gz_A falcilysin in complex with chloroquine 0.7738 111 151
5inm-assembly3.cif.gz_C mouse tdp2 protein, apo state with variable dna-binding grasp conformations 0.7696 19 259
ID Description Score Start End Superfamily
af_P0AAW1_9_253_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8685 19 259 3.60.10.10
af_P0AAW1_9_253_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8521 19 259 3.60.10.10
af_Q9HDZ2_710_875_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8361 24 183 3.60.10.10
af_P09151_393_501_3.30.160.270 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Alpha-isopropylmalate synthase LeuA, regulatory domain 0.8294 112 148 3.30.160.270
af_A0A1D6L8D5_102_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8032 111 150 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A455UAP1-F1-model_v4 Endonuclease/exonuclease/phosphatase domain-containing protein 0.9714 131 259 GO:0003824
AF-A0A379ULU1-F1-model_v4 Endonuclease/Exonuclease/ phosphatase family protein 0.9708 145 259 GO:0004519
GO:0004527
AF-W7W7M8-F1-model_v4 Endonuclease/exonuclease/phosphatase domain-containing protein 0.9559 109 259 GO:0003824
GO:0006506
GO:0016020
AF-A0A7H4LWV3-F1-model_v4 Endonuclease/Exonuclease/phosphatase family protein 0.9539 115 259 GO:0004519
GO:0004527
AF-A9MIT9-F1-model_v4 Endonuclease/exonuclease/phosphatase domain-containing protein 0.9538 166 259 GO:0003824

Map