F469918
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 620 | 326 | 599 | 209 |
Family's Representative Sequence
| Representative Sequence | 3300026088|Ga0207641_10264401|Ga0207641_102644012 |
| Length | 223 |
| Sequence | MANILDELKTLDPKQPGNWPWFAKIGAFVIIFILVQVAFFFLLWSDQKDQIEKGQQDVAKQKETFLEKKKLAVNLEAYKQQRAEIEQAFGALLKQLPNKSEMDALLIDINQAGLGRGLAFELFKPATTENLTEFYAELPVNIKVTGNYHDLGAFASDVAKMPRIVLLTDLKLDPPKNNILTMEAVAKTYRYLDEEEVNKQRKAVKDKQAKTQSPGKGVGGVGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 2 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 3 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 4 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 5 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 6 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 7 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 8 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 9 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 10 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 11 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 12 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 13 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 14 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 15 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 16 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 17 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 18 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 196 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 206 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 207 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 220 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 221 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 223 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 224 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 225 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 226 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 227 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 228 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 229 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 230 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 231 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 232 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 233 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 234 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 235 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 238 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 303 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 304 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 315 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 319 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 320 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 321 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 324 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 325 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 326 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.61 |
| Metatranscriptomes | 0 |
| Isolates | 3.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.68 |
| Nodule | 0.48 |
| Rhizoplane | 1.94 |
| Rhizosphere | 91.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055536_1001506 | 3300003781 | Bacteria | 13995 |
| 2 | Ga0055530_10000677 | 3300003791 | Bacteria | 28934 |
| 3 | Ga0055540_1001429 | 3300003792 | Bacteria | 14239 |
| 4 | Ga0065712_10121498 | 3300005290 | Bacteria | 1664 |
| 5 | Ga0065712_10183744 | 3300005290 | Bacteria | 1180 |
| 6 | Ga0070658_10018825 | 3300005327 | Bacteria | 5532 |
| 7 | Ga0070658_10047662 | 3300005327 | Bacteria | 3467 |
| 8 | Ga0070670_100080624 | 3300005331 | Bacteria | 2797 |
| 9 | Ga0068869_100000748 | 3300005334 | Bacteria | 18490 |
| 10 | Ga0068869_100050478 | 3300005334 | Bacteria | 3015 |
| 11 | Ga0070666_10124903 | 3300005335 | Bacteria | 1786 |
| 12 | Ga0070680_100105822 | 3300005336 | Bacteria | 2339 |
| 13 | Ga0070682_100389085 | 3300005337 | Bacteria | 1051 |
| 14 | Ga0068868_100009375 | 3300005338 | Bacteria | 7038 |
| 15 | Ga0068868_100061052 | 3300005338 | Bacteria | 2986 |
| 16 | Ga0068868_100064718 | 3300005338 | Bacteria | 2903 |
| 17 | Ga0068868_100102272 | 3300005338 | Bacteria | 2320 |
| 18 | Ga0068868_100225029 | 3300005338 | Unclassified | 1572 |
| 19 | Ga0070689_100003205 | 3300005340 | Bacteria | 10840 |
| 20 | Ga0070689_100134005 | 3300005340 | Unclassified | 1988 |
| 21 | Ga0070689_100158807 | 3300005340 | Bacteria | 1827 |
| 22 | Ga0070689_100773680 | 3300005340 | Bacteria | 843 |
| 23 | Ga0070661_100423378 | 3300005344 | Bacteria | 1056 |
| 24 | Ga0070668_100259924 | 3300005347 | Unclassified | 1443 |
| 25 | Ga0070669_100227168 | 3300005353 | Bacteria | 1478 |
| 26 | Ga0070675_100001954 | 3300005354 | Bacteria | 15249 |
| 27 | Ga0070675_100024903 | 3300005354 | Bacteria | 4796 |
| 28 | Ga0070675_100165132 | 3300005354 | Bacteria | 1907 |
| 29 | Ga0070675_100343828 | 3300005354 | Bacteria | 1322 |
| 30 | Ga0070674_100438373 | 3300005356 | Bacteria | 1076 |
| 31 | Ga0070673_100021180 | 3300005364 | Bacteria | 4706 |
| 32 | Ga0070673_100153859 | 3300005364 | Bacteria | 1950 |
| 33 | Ga0070688_100002581 | 3300005365 | Bacteria | 9178 |
| 34 | Ga0070667_100378302 | 3300005367 | Unclassified | 1286 |
| 35 | Ga0070713_100081227 | 3300005436 | Bacteria | 2766 |
| 36 | Ga0070713_100110885 | 3300005436 | Bacteria | 2392 |
| 37 | Ga0070710_10339105 | 3300005437 | Bacteria | 992 |
| 38 | Ga0070701_10074909 | 3300005438 | Bacteria | 1819 |
| 39 | Ga0070705_100083703 | 3300005440 | Bacteria | 1967 |
| 40 | Ga0070700_100054632 | 3300005441 | Bacteria | 2497 |
| 41 | Ga0070700_100086658 | 3300005441 | Bacteria | 2034 |
| 42 | Ga0070694_100156717 | 3300005444 | Bacteria | 1668 |
| 43 | Ga0070663_100788790 | 3300005455 | Bacteria | 814 |
| 44 | Ga0070678_100030357 | 3300005456 | Bacteria | 3715 |
| 45 | Ga0070678_100060614 | 3300005456 | Bacteria | 2786 |
| 46 | Ga0070678_100181859 | 3300005456 | Bacteria | 1722 |
| 47 | Ga0070678_100641732 | 3300005456 | Bacteria | 952 |
| 48 | Ga0070662_100133658 | 3300005457 | Bacteria | 1916 |
| 49 | Ga0070662_100241102 | 3300005457 | Bacteria | 1450 |
| 50 | Ga0070662_100403948 | 3300005457 | Bacteria | 1128 |
| 51 | Ga0070681_10023535 | 3300005458 | Bacteria | 6195 |
| 52 | Ga0068867_100079695 | 3300005459 | Bacteria | 2465 |
| 53 | Ga0068867_100156291 | 3300005459 | Bacteria | 1795 |
| 54 | Ga0068867_100195499 | 3300005459 | Bacteria | 1616 |
| 55 | Ga0068867_100203848 | 3300005459 | Bacteria | 1585 |
| 56 | Ga0068867_100905986 | 3300005459 | Unclassified | 794 |
| 57 | Ga0070685_10046258 | 3300005466 | Bacteria | 2497 |
| 58 | Ga0070707_100183209 | 3300005468 | Bacteria | 2042 |
| 59 | Ga0070698_100133675 | 3300005471 | Bacteria | 2435 |
| 60 | Ga0070699_100038599 | 3300005518 | Bacteria | 4136 |
| 61 | Ga0070679_100147255 | 3300005530 | Bacteria | 2332 |
| 62 | Ga0070684_100130649 | 3300005535 | Bacteria | 2265 |
| 63 | Ga0070684_100233947 | 3300005535 | Bacteria | 1678 |
| 64 | Ga0070684_100750652 | 3300005535 | Bacteria | 911 |
| 65 | Ga0070672_100013680 | 3300005543 | Bacteria | 5737 |
| 66 | Ga0070672_100293917 | 3300005543 | Unclassified | 1376 |
| 67 | Ga0070686_100608833 | 3300005544 | Bacteria | 862 |
| 68 | Ga0070695_100048036 | 3300005545 | Bacteria | 2728 |
| 69 | Ga0070695_100751344 | 3300005545 | Bacteria | 778 |
| 70 | Ga0070696_100006717 | 3300005546 | Bacteria | 7685 |
| 71 | Ga0070696_100067991 | 3300005546 | Bacteria | 2501 |
| 72 | Ga0070693_100000368 | 3300005547 | Bacteria | 20458 |
| 73 | Ga0070693_100003051 | 3300005547 | Bacteria | 7771 |
| 74 | Ga0070665_100010415 | 3300005548 | Bacteria | 9409 |
| 75 | Ga0070665_100025910 | 3300005548 | Bacteria | 5906 |
| 76 | Ga0070665_100071014 | 3300005548 | Bacteria | 3488 |
| 77 | Ga0070665_100192718 | 3300005548 | Bacteria | 2039 |
| 78 | Ga0070704_100070641 | 3300005549 | Bacteria | 2534 |
| 79 | Ga0068855_100017306 | 3300005563 | Bacteria | 8674 |
| 80 | Ga0068855_100022973 | 3300005563 | Bacteria | 7473 |
| 81 | Ga0068855_100173405 | 3300005563 | Bacteria | 2441 |
| 82 | Ga0068855_100213949 | 3300005563 | Bacteria | 2165 |
| 83 | Ga0070664_100253413 | 3300005564 | Bacteria | 1583 |
| 84 | Ga0068857_100264144 | 3300005577 | Bacteria | 1580 |
| 85 | Ga0068854_100209752 | 3300005578 | Bacteria | 1536 |
| 86 | Ga0068856_100272777 | 3300005614 | Bacteria | 1708 |
| 87 | Ga0068856_100991302 | 3300005614 | Bacteria | 859 |
| 88 | Ga0070702_100051058 | 3300005615 | Unclassified | 2366 |
| 89 | Ga0070702_100053287 | 3300005615 | Bacteria | 2323 |
| 90 | Ga0070702_100055395 | 3300005615 | Bacteria | 2286 |
| 91 | Ga0070702_100454781 | 3300005615 | Bacteria | 930 |
| 92 | Ga0068852_100000366 | 3300005616 | Bacteria | 30499 |
| 93 | Ga0068852_100103446 | 3300005616 | Bacteria | 2576 |
| 94 | Ga0068852_100813735 | 3300005616 | Bacteria | 949 |
| 95 | Ga0068859_100004039 | 3300005617 | Bacteria | 14959 |
| 96 | Ga0068859_100007911 | 3300005617 | Bacteria | 10782 |
| 97 | Ga0068859_100076204 | 3300005617 | Bacteria | 3394 |
| 98 | Ga0068859_100197600 | 3300005617 | Bacteria | 2096 |
| 99 | Ga0068859_100809926 | 3300005617 | Bacteria | 1024 |
| 100 | Ga0068864_100063600 | 3300005618 | Bacteria | 3198 |
| 101 | Ga0068864_100144941 | 3300005618 | Bacteria | 2146 |
| 102 | Ga0068864_100279462 | 3300005618 | Bacteria | 1558 |
| 103 | Ga0068866_10129195 | 3300005718 | Bacteria | 1435 |
| 104 | Ga0068861_100186404 | 3300005719 | Bacteria | 1731 |
| 105 | Ga0068861_100853522 | 3300005719 | Bacteria | 859 |
| 106 | Ga0068851_10000790 | 3300005834 | Bacteria | 13643 |
| 107 | Ga0068851_10221534 | 3300005834 | Bacteria | 1063 |
| 108 | Ga0068870_10042233 | 3300005840 | Bacteria | 2373 |
| 109 | Ga0068863_100043046 | 3300005841 | Bacteria | 4287 |
| 110 | Ga0068858_100035268 | 3300005842 | Bacteria | 4640 |
| 111 | Ga0068858_100039504 | 3300005842 | Bacteria | 4375 |
| 112 | Ga0068858_100047646 | 3300005842 | Bacteria | 3972 |
| 113 | Ga0068858_100048936 | 3300005842 | Bacteria | 3915 |
| 114 | Ga0068860_100162207 | 3300005843 | Bacteria | 2156 |
| 115 | Ga0068862_100075876 | 3300005844 | Bacteria | 2909 |
| 116 | Ga0075364_10059321 | 3300006051 | Bacteria | 2508 |
| 117 | Ga0075364_10122032 | 3300006051 | Bacteria | 1745 |
| 118 | Ga0070715_10073701 | 3300006163 | Bacteria | 1532 |
| 119 | Ga0075367_10093583 | 3300006178 | Bacteria | 1831 |
| 120 | Ga0075369_10019351 | 3300006186 | Bacteria | 2779 |
| 121 | Ga0075366_10002257 | 3300006195 | Bacteria | 9841 |
| 122 | Ga0075366_10012324 | 3300006195 | Bacteria | 4847 |
| 123 | Ga0075366_10033772 | 3300006195 | Bacteria | 3014 |
| 124 | Ga0075366_10177839 | 3300006195 | Bacteria | 1292 |
| 125 | Ga0075366_10314614 | 3300006195 | Bacteria | 959 |
| 126 | Ga0075366_10488711 | 3300006195 | Bacteria | 761 |
| 127 | Ga0097621_100004700 | 3300006237 | Bacteria | 9541 |
| 128 | Ga0097621_100009334 | 3300006237 | Bacteria | 7121 |
| 129 | Ga0097621_100041446 | 3300006237 | Bacteria | 3706 |
| 130 | Ga0097621_100062721 | 3300006237 | Bacteria | 3052 |
| 131 | Ga0097621_100127834 | 3300006237 | Bacteria | 2160 |
| 132 | Ga0068871_100008124 | 3300006358 | Bacteria | 7534 |
| 133 | Ga0068871_100020732 | 3300006358 | Bacteria | 5040 |
| 134 | Ga0068871_100070285 | 3300006358 | Bacteria | 2877 |
| 135 | Ga0068871_100094461 | 3300006358 | Bacteria | 2496 |
| 136 | Ga0068871_100395653 | 3300006358 | Bacteria | 1230 |
| 137 | Ga0068871_100740789 | 3300006358 | Unclassified | 903 |
| 138 | Ga0075428_100015492 | 3300006844 | Bacteria | 8452 |
| 139 | Ga0075430_100088646 | 3300006846 | Unclassified | 2589 |
| 140 | Ga0075430_100140515 | 3300006846 | Bacteria | 2011 |
| 141 | Ga0075431_100125345 | 3300006847 | Bacteria | 2650 |
| 142 | Ga0075433_10019638 | 3300006852 | Bacteria | 5634 |
| 143 | Ga0075434_100089747 | 3300006871 | Bacteria | 3074 |
| 144 | Ga0075429_100073830 | 3300006880 | Bacteria | 2971 |
| 145 | Ga0068865_100084160 | 3300006881 | Bacteria | 2291 |
| 146 | Ga0068865_100138594 | 3300006881 | Bacteria | 1832 |
| 147 | Ga0068865_100153406 | 3300006881 | Bacteria | 1750 |
| 148 | Ga0068865_100257626 | 3300006881 | Bacteria | 1380 |
| 149 | Ga0068865_100358344 | 3300006881 | Unclassified | 1183 |
| 150 | Ga0075436_100014310 | 3300006914 | Bacteria | 5431 |
| 151 | Ga0097620_100004039 | 3300006931 | Bacteria | 14959 |
| 152 | Ga0097620_100007911 | 3300006931 | Bacteria | 10782 |
| 153 | Ga0097620_100076205 | 3300006931 | Bacteria | 3394 |
| 154 | Ga0097620_100197589 | 3300006931 | Bacteria | 2096 |
| 155 | Ga0097620_100809985 | 3300006931 | Bacteria | 1024 |
| 156 | Ga0079104_1008565 | 3300006946 | Bacteria | 3562 |
| 157 | Ga0075435_100125535 | 3300007076 | Bacteria | 2144 |
| 158 | Ga0105251_10051193 | 3300009011 | Bacteria | 1970 |
| 159 | Ga0105250_10002414 | 3300009092 | Bacteria | 9392 |
| 160 | Ga0105240_10364679 | 3300009093 | Bacteria | 1635 |
| 161 | Ga0105240_10382709 | 3300009093 | Bacteria | 1589 |
| 162 | Ga0105240_10676482 | 3300009093 | Bacteria | 1129 |
| 163 | Ga0111539_10002062 | 3300009094 | Bacteria | 26871 |
| 164 | Ga0105245_10053171 | 3300009098 | Bacteria | 3635 |
| 165 | Ga0105245_10084737 | 3300009098 | Bacteria | 2904 |
| 166 | Ga0105245_10085718 | 3300009098 | Bacteria | 2888 |
| 167 | Ga0105245_10104933 | 3300009098 | Bacteria | 2621 |
| 168 | Ga0105245_10135683 | 3300009098 | Bacteria | 2312 |
| 169 | Ga0105245_10137992 | 3300009098 | Bacteria | 2294 |
| 170 | Ga0105247_10120285 | 3300009101 | Unclassified | 1701 |
| 171 | Ga0114129_10435422 | 3300009147 | Bacteria | 1722 |
| 172 | Ga0105243_10048529 | 3300009148 | Bacteria | 3347 |
| 173 | Ga0105243_10093042 | 3300009148 | Bacteria | 2487 |
| 174 | Ga0105243_10228760 | 3300009148 | Bacteria | 1648 |
| 175 | Ga0105243_10979324 | 3300009148 | Bacteria | 847 |
| 176 | Ga0105242_10001487 | 3300009176 | Bacteria | 18449 |
| 177 | Ga0105242_10014314 | 3300009176 | Bacteria | 6143 |
| 178 | Ga0105242_10042298 | 3300009176 | Bacteria | 3678 |
| 179 | Ga0105242_10127404 | 3300009176 | Bacteria | 2193 |
| 180 | Ga0105242_10132571 | 3300009176 | Bacteria | 2153 |
| 181 | Ga0105248_10001876 | 3300009177 | Bacteria | 23307 |
| 182 | Ga0105248_10114213 | 3300009177 | Bacteria | 3046 |
| 183 | Ga0105248_10190892 | 3300009177 | Bacteria | 2308 |
| 184 | Ga0105237_10391936 | 3300009545 | Bacteria | 1394 |
| 185 | Ga0105238_10074407 | 3300009551 | Bacteria | 3389 |
| 186 | Ga0105238_10112099 | 3300009551 | Bacteria | 2707 |
| 187 | Ga0105238_10141518 | 3300009551 | Bacteria | 2382 |
| 188 | Ga0105238_10149115 | 3300009551 | Bacteria | 2315 |
| 189 | Ga0105238_10195945 | 3300009551 | Unclassified | 1996 |
| 190 | Ga0105238_10204719 | 3300009551 | Bacteria | 1949 |
| 191 | Ga0105238_10292074 | 3300009551 | Bacteria | 1612 |
| 192 | Ga0105238_11025986 | 3300009551 | Bacteria | 846 |
| 193 | Ga0105249_10145137 | 3300009553 | Bacteria | 2279 |
| 194 | Ga0105249_10746751 | 3300009553 | Bacteria | 1040 |
| 195 | Ga0105239_10061863 | 3300010375 | Bacteria | 4109 |
| 196 | Ga0105239_10644656 | 3300010375 | Bacteria | 1210 |
| 197 | Ga0105246_10007889 | 3300011119 | Bacteria | 6532 |
| 198 | Ga0105246_10183374 | 3300011119 | Bacteria | 1614 |
| 199 | Ga0105246_10844406 | 3300011119 | Bacteria | 816 |
| 200 | Ga0157345_1000194 | 3300012498 | Bacteria | 9488 |
| 201 | Ga0157373_10019827 | 3300013100 | Bacteria | 4892 |
| 202 | Ga0157373_10686500 | 3300013100 | Bacteria | 749 |
| 203 | Ga0157371_10430589 | 3300013102 | Bacteria | 968 |
| 204 | Ga0157371_10522058 | 3300013102 | Bacteria | 878 |
| 205 | Ga0157370_10011951 | 3300013104 | Bacteria | 9048 |
| 206 | Ga0157370_10124971 | 3300013104 | Bacteria | 2402 |
| 207 | Ga0157369_10037649 | 3300013105 | Bacteria | 5295 |
| 208 | Ga0157369_10044474 | 3300013105 | Bacteria | 4832 |
| 209 | Ga0157374_10015902 | 3300013296 | Bacteria | 6610 |
| 210 | Ga0157374_10030276 | 3300013296 | Bacteria | 4912 |
| 211 | Ga0157374_10050116 | 3300013296 | Bacteria | 3880 |
| 212 | Ga0157374_10060773 | 3300013296 | Bacteria | 3537 |
| 213 | Ga0157378_10018493 | 3300013297 | Bacteria | 6123 |
| 214 | Ga0157378_10095065 | 3300013297 | Bacteria | 2714 |
| 215 | Ga0157378_10242822 | 3300013297 | Bacteria | 1721 |
| 216 | Ga0157378_10256832 | 3300013297 | Unclassified | 1675 |
| 217 | Ga0157378_10278624 | 3300013297 | Bacteria | 1611 |
| 218 | Ga0157378_10380558 | 3300013297 | Bacteria | 1386 |
| 219 | Ga0163162_10002804 | 3300013306 | Bacteria | 16571 |
| 220 | Ga0163162_10058308 | 3300013306 | Bacteria | 3889 |
| 221 | Ga0163162_10133771 | 3300013306 | Bacteria | 2590 |
| 222 | Ga0163162_10295323 | 3300013306 | Bacteria | 1752 |
| 223 | Ga0163162_10488180 | 3300013306 | Bacteria | 1363 |
| 224 | Ga0163162_10772593 | 3300013306 | Unclassified | 1079 |
| 225 | Ga0163162_10831106 | 3300013306 | Bacteria | 1040 |
| 226 | Ga0157372_10000909 | 3300013307 | Bacteria | 32178 |
| 227 | Ga0157372_10264021 | 3300013307 | Bacteria | 1999 |
| 228 | Ga0157372_10598009 | 3300013307 | Bacteria | 1286 |
| 229 | Ga0157372_10736483 | 3300013307 | Bacteria | 1146 |
| 230 | Ga0157375_10058583 | 3300013308 | Bacteria | 3811 |
| 231 | Ga0157375_10113624 | 3300013308 | Bacteria | 2809 |
| 232 | Ga0157375_10286877 | 3300013308 | Bacteria | 1809 |
| 233 | Ga0157380_10036400 | 3300014326 | Bacteria | 3807 |
| 234 | Ga0157379_10230385 | 3300014968 | Bacteria | 1679 |
| 235 | Ga0157379_10281304 | 3300014968 | Bacteria | 1514 |
| 236 | Ga0157376_10054333 | 3300014969 | Bacteria | 3338 |
| 237 | Ga0157376_10085497 | 3300014969 | Bacteria | 2718 |
| 238 | Ga0157376_10204675 | 3300014969 | Bacteria | 1818 |
| 239 | Ga0157376_10281784 | 3300014969 | Bacteria | 1566 |
| 240 | Ga0163161_10180101 | 3300017792 | Bacteria | 1620 |
| 241 | Ga0213876_10101142 | 3300021384 | Bacteria | 1528 |
| 242 | Ga0209676_1000032 | 3300025292 | Bacteria | 469558 |
| 243 | Ga0209050_1000025 | 3300025298 | Bacteria | 528225 |
| 244 | Ga0209051_1000299 | 3300025303 | Bacteria | 78310 |
| 245 | Ga0207656_10000272 | 3300025321 | Bacteria | 17950 |
| 246 | Ga0207696_1007657 | 3300025711 | Bacteria | 4208 |
| 247 | Ga0207655_1003749 | 3300025728 | Bacteria | 11145 |
| 248 | Ga0207713_1000031 | 3300025735 | Bacteria | 283971 |
| 249 | Ga0207682_10085069 | 3300025893 | Bacteria | 1362 |
| 250 | Ga0207642_10058614 | 3300025899 | Bacteria | 1777 |
| 251 | Ga0207710_10095965 | 3300025900 | Bacteria | 1394 |
| 252 | Ga0207688_10117280 | 3300025901 | Bacteria | 1551 |
| 253 | Ga0207688_10123119 | 3300025901 | Bacteria | 1515 |
| 254 | Ga0207688_10304058 | 3300025901 | Bacteria | 976 |
| 255 | Ga0207643_10153571 | 3300025908 | Unclassified | 1382 |
| 256 | Ga0207705_10011261 | 3300025909 | Bacteria | 6482 |
| 257 | Ga0207705_10023458 | 3300025909 | Bacteria | 4401 |
| 258 | Ga0207705_10055013 | 3300025909 | Bacteria | 2869 |
| 259 | Ga0207705_10062816 | 3300025909 | Bacteria | 2683 |
| 260 | Ga0207695_10085416 | 3300025913 | Bacteria | 3184 |
| 261 | Ga0207695_10113330 | 3300025913 | Bacteria | 2688 |
| 262 | Ga0207693_10526647 | 3300025915 | Bacteria | 922 |
| 263 | Ga0207662_10043025 | 3300025918 | Bacteria | 2664 |
| 264 | Ga0207662_10096977 | 3300025918 | Bacteria | 1822 |
| 265 | Ga0207652_10697777 | 3300025921 | Bacteria | 906 |
| 266 | Ga0207646_10152282 | 3300025922 | Bacteria | 2085 |
| 267 | Ga0207681_10224809 | 3300025923 | Bacteria | 1454 |
| 268 | Ga0207681_10309006 | 3300025923 | Bacteria | 1253 |
| 269 | Ga0207694_10180853 | 3300025924 | Bacteria | 1710 |
| 270 | Ga0207694_10310805 | 3300025924 | Bacteria | 1299 |
| 271 | Ga0207694_10390878 | 3300025924 | Bacteria | 1156 |
| 272 | Ga0207650_10329978 | 3300025925 | Bacteria | 1251 |
| 273 | Ga0207650_10562056 | 3300025925 | Unclassified | 957 |
| 274 | Ga0207659_10004053 | 3300025926 | Bacteria | 8840 |
| 275 | Ga0207659_10038347 | 3300025926 | Bacteria | 3332 |
| 276 | Ga0207659_10104903 | 3300025926 | Bacteria | 2138 |
| 277 | Ga0207659_10236877 | 3300025926 | Bacteria | 1475 |
| 278 | Ga0207687_10009127 | 3300025927 | Bacteria | 6485 |
| 279 | Ga0207687_10137327 | 3300025927 | Bacteria | 1850 |
| 280 | Ga0207687_10154086 | 3300025927 | Bacteria | 1756 |
| 281 | Ga0207687_10212570 | 3300025927 | Bacteria | 1518 |
| 282 | Ga0207700_10315514 | 3300025928 | Bacteria | 1353 |
| 283 | Ga0207664_10110460 | 3300025929 | Bacteria | 2286 |
| 284 | Ga0207664_10140235 | 3300025929 | Bacteria | 2044 |
| 285 | Ga0207644_10271591 | 3300025931 | Bacteria | 1359 |
| 286 | Ga0207690_10076662 | 3300025932 | Bacteria | 2322 |
| 287 | Ga0207706_10639163 | 3300025933 | Unclassified | 912 |
| 288 | Ga0207686_10001762 | 3300025934 | Bacteria | 12037 |
| 289 | Ga0207686_10033409 | 3300025934 | Bacteria | 3071 |
| 290 | Ga0207709_10099620 | 3300025935 | Bacteria | 1918 |
| 291 | Ga0207709_10099886 | 3300025935 | Bacteria | 1916 |
| 292 | Ga0207670_10001574 | 3300025936 | Bacteria | 11941 |
| 293 | Ga0207670_10029654 | 3300025936 | Bacteria | 3487 |
| 294 | Ga0207670_10065432 | 3300025936 | Bacteria | 2494 |
| 295 | Ga0207670_10660338 | 3300025936 | Bacteria | 863 |
| 296 | Ga0207669_10049861 | 3300025937 | Bacteria | 2499 |
| 297 | Ga0207669_10092600 | 3300025937 | Bacteria | 1972 |
| 298 | Ga0207669_10174476 | 3300025937 | Bacteria | 1534 |
| 299 | Ga0207669_10325050 | 3300025937 | Bacteria | 1179 |
| 300 | Ga0207704_10037943 | 3300025938 | Bacteria | 2788 |
| 301 | Ga0207704_10045688 | 3300025938 | Bacteria | 2604 |
| 302 | Ga0207704_10127198 | 3300025938 | Bacteria | 1757 |
| 303 | Ga0207704_10223674 | 3300025938 | Bacteria | 1394 |
| 304 | Ga0207691_10004014 | 3300025940 | Bacteria | 14270 |
| 305 | Ga0207691_10230037 | 3300025940 | Unclassified | 1606 |
| 306 | Ga0207711_10013651 | 3300025941 | Bacteria | 6746 |
| 307 | Ga0207711_10014208 | 3300025941 | Bacteria | 6612 |
| 308 | Ga0207711_10173671 | 3300025941 | Bacteria | 1957 |
| 309 | Ga0207689_10002992 | 3300025942 | Bacteria | 15584 |
| 310 | Ga0207689_10034201 | 3300025942 | Bacteria | 4221 |
| 311 | Ga0207689_10063888 | 3300025942 | Bacteria | 3028 |
| 312 | Ga0207679_10247627 | 3300025945 | Bacteria | 1513 |
| 313 | Ga0207679_10346811 | 3300025945 | Bacteria | 1293 |
| 314 | Ga0207667_10019136 | 3300025949 | Bacteria | 7657 |
| 315 | Ga0207667_10026953 | 3300025949 | Bacteria | 6269 |
| 316 | Ga0207667_10061418 | 3300025949 | Bacteria | 3931 |
| 317 | Ga0207651_10059979 | 3300025960 | Bacteria | 2638 |
| 318 | Ga0207651_10145165 | 3300025960 | Bacteria | 1839 |
| 319 | Ga0207651_10164869 | 3300025960 | Unclassified | 1741 |
| 320 | Ga0207651_10265629 | 3300025960 | Bacteria | 1411 |
| 321 | Ga0207651_10322846 | 3300025960 | Bacteria | 1291 |
| 322 | Ga0207712_10292302 | 3300025961 | Bacteria | 1334 |
| 323 | Ga0207668_10545490 | 3300025972 | Bacteria | 1004 |
| 324 | Ga0207640_10204963 | 3300025981 | Bacteria | 1498 |
| 325 | Ga0207640_10210564 | 3300025981 | Bacteria | 1481 |
| 326 | Ga0207640_10926876 | 3300025981 | Bacteria | 762 |
| 327 | Ga0207658_10228603 | 3300025986 | Bacteria | 1569 |
| 328 | Ga0207677_10005410 | 3300026023 | Bacteria | 6931 |
| 329 | Ga0207677_10072632 | 3300026023 | Bacteria | 2433 |
| 330 | Ga0207677_10200293 | 3300026023 | Bacteria | 1586 |
| 331 | Ga0207677_10352437 | 3300026023 | Bacteria | 1234 |
| 332 | Ga0207677_10356873 | 3300026023 | Bacteria | 1227 |
| 333 | Ga0207677_10439304 | 3300026023 | Unclassified | 1115 |
| 334 | Ga0207677_10444426 | 3300026023 | Bacteria | 1110 |
| 335 | Ga0207703_10003555 | 3300026035 | Bacteria | 13026 |
| 336 | Ga0207703_10040646 | 3300026035 | Bacteria | 3722 |
| 337 | Ga0207703_10042255 | 3300026035 | Bacteria | 3656 |
| 338 | Ga0207708_10089711 | 3300026075 | Bacteria | 2369 |
| 339 | Ga0207708_10108470 | 3300026075 | Bacteria | 2153 |
| 340 | Ga0207708_10279147 | 3300026075 | Bacteria | 1353 |
| 341 | Ga0207702_10239380 | 3300026078 | Bacteria | 1700 |
| 342 | Ga0207702_10618485 | 3300026078 | Bacteria | 1064 |
| 343 | Ga0207641_10041880 | 3300026088 | Bacteria | 3840 |
| 344 | Ga0207641_10264401 | 3300026088 | Bacteria | 1612 |
| 345 | Ga0207648_10050473 | 3300026089 | Bacteria | 3638 |
| 346 | Ga0207648_10107633 | 3300026089 | Bacteria | 2447 |
| 347 | Ga0207648_10189543 | 3300026089 | Bacteria | 1822 |
| 348 | Ga0207648_10195558 | 3300026089 | Bacteria | 1793 |
| 349 | Ga0207648_10295235 | 3300026089 | Bacteria | 1452 |
| 350 | Ga0207648_10792990 | 3300026089 | Unclassified | 881 |
| 351 | Ga0207676_10106239 | 3300026095 | Bacteria | 2339 |
| 352 | Ga0207676_10110209 | 3300026095 | Unclassified | 2302 |
| 353 | Ga0207676_10262826 | 3300026095 | Bacteria | 1559 |
| 354 | Ga0207674_10023170 | 3300026116 | Bacteria | 6656 |
| 355 | Ga0207675_100091197 | 3300026118 | Bacteria | 2865 |
| 356 | Ga0207675_100349350 | 3300026118 | Bacteria | 1449 |
| 357 | Ga0207675_100773782 | 3300026118 | Bacteria | 972 |
| 358 | Ga0207683_10027436 | 3300026121 | Bacteria | 4921 |
| 359 | Ga0207683_10042013 | 3300026121 | Bacteria | 3993 |
| 360 | Ga0207683_10095692 | 3300026121 | Bacteria | 2648 |
| 361 | Ga0207683_10292397 | 3300026121 | Bacteria | 1490 |
| 362 | Ga0207698_10001079 | 3300026142 | Bacteria | 15860 |
| 363 | Ga0207698_10124081 | 3300026142 | Bacteria | 2192 |
| 364 | Ga0207698_10206724 | 3300026142 | Bacteria | 1763 |
| 365 | Ga0207698_10354992 | 3300026142 | Bacteria | 1386 |
| 366 | Ga0207698_10759624 | 3300026142 | Bacteria | 969 |
| 367 | Ga0209281_1005200 | 3300027111 | Bacteria | 3671 |
| 368 | Ga0207428_10002330 | 3300027907 | Bacteria | 19019 |
| 369 | Ga0268266_10009678 | 3300028379 | Bacteria | 8471 |
| 370 | Ga0268266_10031462 | 3300028379 | Bacteria | 4506 |
| 371 | Ga0268266_10055827 | 3300028379 | Bacteria | 3396 |
| 372 | Ga0268266_10491758 | 3300028379 | Bacteria | 1170 |
| 373 | Ga0268265_10053174 | 3300028380 | Bacteria | 3067 |
| 374 | Ga0268265_10607307 | 3300028380 | Unclassified | 1046 |
| 375 | Ga0268264_10266856 | 3300028381 | Bacteria | 1597 |
| 376 | Ga0265336_10000272 | 3300028666 | Bacteria | 36231 |
| 377 | Ga0265338_10027334 | 3300028800 | Bacteria | 5727 |
| 378 | Ga0265324_10000004 | 3300029957 | Bacteria | 356972 |
| 379 | Ga0265324_10001557 | 3300029957 | Bacteria | 12848 |
| 380 | Ga0307511_10178818 | 3300030521 | Bacteria | 1148 |
| 381 | Ga0265325_10000187 | 3300031241 | Bacteria | 44205 |
| 382 | Ga0265331_10011735 | 3300031250 | Bacteria | 4787 |
| 383 | Ga0265327_10000065 | 3300031251 | Bacteria | 225004 |
| 384 | Ga0265327_10044502 | 3300031251 | Bacteria | 2366 |
| 385 | Ga0307408_100015286 | 3300031548 | Bacteria | 5109 |
| 386 | Ga0307408_100083553 | 3300031548 | Bacteria | 2393 |
| 387 | Ga0307408_100093273 | 3300031548 | Bacteria | 2277 |
| 388 | Ga0307408_100212556 | 3300031548 | Bacteria | 1573 |
| 389 | Ga0316575_10028575 | 3300031665 | Bacteria | 2174 |
| 390 | Ga0265314_10003992 | 3300031711 | Bacteria | 13952 |
| 391 | Ga0265314_10049794 | 3300031711 | Bacteria | 2930 |
| 392 | Ga0265314_10062866 | 3300031711 | Bacteria | 2521 |
| 393 | Ga0265342_10160232 | 3300031712 | Bacteria | 1244 |
| 394 | Ga0307516_10279748 | 3300031730 | Bacteria | 1351 |
| 395 | Ga0307410_10222817 | 3300031852 | Bacteria | 1452 |
| 396 | Ga0307406_10140396 | 3300031901 | Bacteria | 1709 |
| 397 | Ga0307407_10245506 | 3300031903 | Bacteria | 1224 |
| 398 | Ga0307412_10411390 | 3300031911 | Bacteria | 1104 |
| 399 | Ga0307412_10478187 | 3300031911 | Bacteria | 1032 |
| 400 | Ga0307416_100227685 | 3300032002 | Bacteria | 1794 |
| 401 | Ga0307416_100406787 | 3300032002 | Bacteria | 1400 |
| 402 | Ga0307416_100434887 | 3300032002 | Bacteria | 1360 |
| 403 | Ga0307416_101103739 | 3300032002 | Bacteria | 898 |
| 404 | Ga0307415_100169750 | 3300032126 | Bacteria | 1700 |
| 405 | Ga0307415_100180462 | 3300032126 | Bacteria | 1656 |
| 406 | Ga0373930_0005353 | 3300034816 | Bacteria | 2131 |
| 407 | Ga0373952_0000434 | 3300035092 | Bacteria | 7231 |
| 408 | Ga0373932_0116666 | 3300035112 | Bacteria | 886 |
| 409 | Ga0373960_0004088 | 3300035121 | Bacteria | 3336 |
| 410 | Ga0316574_0006680 | 3300035398 | Bacteria | 6261 |
| 411 | Ga0316574_0024290 | 3300035398 | Bacteria | 3626 |
| 412 | Ga0373931_0057022 | 3300035691 | Bacteria | 2094 |
| 413 | Ga0373931_0057252 | 3300035691 | Bacteria | 2090 |
| 414 | Ga0373935_0309308 | 3300035692 | Bacteria | 1119 |
| 415 | Ga0373927_0304382 | 3300035695 | Bacteria | 1049 |
| 416 | Ga0373933_0421627 | 3300035724 | Bacteria | 872 |
| 417 | Ga0373937_0057081 | 3300036401 | Bacteria | 3586 |
| 418 | Ga0373937_0095962 | 3300036401 | Bacteria | 2749 |
| 419 | Ga0373925_0028973 | 3300037068 | Bacteria | 4059 |
| 420 | Ga0395900_0047854 | 3300037418 | Bacteria | 4405 |
| 421 | Ga0395905_0014429 | 3300037471 | Bacteria | 7543 |
| 422 | Ga0395901_0058360 | 3300038443 | Bacteria | 4014 |
| 423 | Ga0439447_002724 | 3300041407 | Bacteria | 6384 |
| 424 | Ga0439466_0002287 | 3300041411 | Bacteria | 7518 |
| 425 | Ga0439466_0003125 | 3300041411 | Bacteria | 6442 |
| 426 | Ga0451789_0116223 | 3300041443 | Bacteria | 736 |
| 427 | Ga0451847_0252797 | 3300041503 | Bacteria | 902 |
| 428 | Ga0439441_005763 | 3300042001 | Bacteria | 1938 |
| 429 | Ga0439432_006292 | 3300042006 | Bacteria | 4246 |
| 430 | Ga0439451_001417 | 3300042009 | Bacteria | 4742 |
| 431 | Ga0439451_008342 | 3300042009 | Bacteria | 2101 |
| 432 | Ga0439452_002777 | 3300042010 | Bacteria | 6326 |
| 433 | Ga0439456_018724 | 3300042013 | Bacteria | 1454 |
| 434 | Ga0439456_033697 | 3300042013 | Bacteria | 1102 |
| 435 | Ga0439463_000725 | 3300042016 | Bacteria | 9106 |
| 436 | Ga0450911_006357 | 3300042115 | Bacteria | 1766 |
| 437 | Ga0450922_000710 | 3300042124 | Bacteria | 3443 |
| 438 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 439 | Ga0451577_0000375 | 3300042876 | Bacteria | 83271 |
| 440 | Ga0451577_0008682 | 3300042876 | Bacteria | 9864 |
| 441 | Ga0451577_0017659 | 3300042876 | Bacteria | 6587 |
| 442 | Ga0451577_0068618 | 3300042876 | Bacteria | 3162 |
| 443 | Ga0439440_0001551 | 3300042993 | Bacteria | 4206 |
| 444 | Ga0453683_0000013 | 3300044673 | Bacteria | 371932 |
| 445 | Ga0453683_0028559 | 3300044673 | Bacteria | 3531 |
| 446 | Ga0453683_0091361 | 3300044673 | Bacteria | 1908 |
| 447 | Ga0453683_0407530 | 3300044673 | Bacteria | 877 |
| 448 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 449 | Ga0453684_0000040 | 3300044712 | Bacteria | 690210 |
| 450 | Ga0453684_0011349 | 3300044712 | Bacteria | 14968 |
| 451 | Ga0453684_0472856 | 3300044712 | Bacteria | 1392 |
| 452 | Ga0466957_0009448 | 3300044842 | Bacteria | 5568 |
| 453 | Ga0451576_0000006 | 3300045051 | Bacteria | 949698 |
| 454 | Ga0451576_0000037 | 3300045051 | Bacteria | 372173 |
| 455 | Ga0451576_0000677 | 3300045051 | Bacteria | 69349 |
| 456 | Ga0451576_0001321 | 3300045051 | Bacteria | 42891 |
| 457 | Ga0451576_0005709 | 3300045051 | Bacteria | 15522 |
| 458 | Ga0451576_0172783 | 3300045051 | Bacteria | 2255 |
| 459 | Ga0466958_0004234 | 3300045836 | Bacteria | 7545 |
| 460 | Ga0495617_009953 | 3300046452 | Bacteria | 3259 |
| 461 | Ga0495617_023051 | 3300046452 | Bacteria | 2103 |
| 462 | Ga0495627_001267 | 3300046453 | Bacteria | 15562 |
| 463 | Ga0495627_006900 | 3300046453 | Bacteria | 4411 |
| 464 | Ga0495627_007786 | 3300046453 | Bacteria | 4078 |
| 465 | Ga0495592_0029379 | 3300046454 | Bacteria | 4163 |
| 466 | Ga0495603_0314840 | 3300046455 | Bacteria | 899 |
| 467 | Ga0495591_003686 | 3300046458 | Bacteria | 7783 |
| 468 | Ga0495591_006925 | 3300046458 | Bacteria | 4906 |
| 469 | Ga0495591_008069 | 3300046458 | Bacteria | 4360 |
| 470 | Ga0495591_016704 | 3300046458 | Bacteria | 2543 |
| 471 | Ga0495651_0219583 | 3300046462 | Bacteria | 1316 |
| 472 | Ga0495650_0036723 | 3300046471 | Bacteria | 2140 |
| 473 | Ga0495605_0000246 | 3300046474 | Bacteria | 64351 |
| 474 | Ga0495605_0017666 | 3300046474 | Bacteria | 3836 |
| 475 | Ga0495584_0151018 | 3300046491 | Bacteria | 1180 |
| 476 | Ga0495585_0022903 | 3300046492 | Bacteria | 3585 |
| 477 | Ga0495585_0024731 | 3300046492 | Bacteria | 3442 |
| 478 | Ga0495585_0045014 | 3300046492 | Bacteria | 2464 |
| 479 | Ga0495607_0019379 | 3300046501 | Bacteria | 4323 |
| 480 | Ga0495607_0026509 | 3300046501 | Bacteria | 3595 |
| 481 | Ga0495607_0099437 | 3300046501 | Bacteria | 1560 |
| 482 | Ga0495607_0220649 | 3300046501 | Bacteria | 927 |
| 483 | Ga0495583_0006014 | 3300046506 | Bacteria | 8040 |
| 484 | Ga0495606_0015566 | 3300046507 | Bacteria | 5851 |
| 485 | Ga0495610_0070094 | 3300046512 | Bacteria | 1638 |
| 486 | Ga0495616_0013179 | 3300046513 | Bacteria | 4671 |
| 487 | Ga0495616_0014761 | 3300046513 | Bacteria | 4360 |
| 488 | Ga0495620_0030131 | 3300046515 | Bacteria | 2502 |
| 489 | Ga0495620_0040996 | 3300046515 | Bacteria | 2033 |
| 490 | Ga0495628_0130662 | 3300046516 | Bacteria | 1921 |
| 491 | Ga0495631_0004118 | 3300046518 | Bacteria | 7804 |
| 492 | Ga0495631_0011255 | 3300046518 | Bacteria | 4403 |
| 493 | Ga0495631_0111845 | 3300046518 | Bacteria | 1174 |
| 494 | Ga0495632_0018058 | 3300046519 | Bacteria | 3878 |
| 495 | Ga0495632_0025338 | 3300046519 | Bacteria | 3138 |
| 496 | Ga0495632_0036327 | 3300046519 | Bacteria | 2506 |
| 497 | Ga0495632_0043373 | 3300046519 | Bacteria | 2248 |
| 498 | Ga0495632_0059736 | 3300046519 | Bacteria | 1854 |
| 499 | Ga0495637_0072051 | 3300046520 | Bacteria | 1392 |
| 500 | Ga0495643_0103848 | 3300046522 | Bacteria | 1453 |
| 501 | Ga0495643_0126711 | 3300046522 | Bacteria | 1285 |
| 502 | Ga0495648_0021594 | 3300046524 | Bacteria | 4453 |
| 503 | Ga0495648_0024384 | 3300046524 | Bacteria | 4121 |
| 504 | Ga0495648_0057171 | 3300046524 | Bacteria | 2342 |
| 505 | Ga0495654_0002879 | 3300046530 | Bacteria | 10801 |
| 506 | Ga0495654_0003045 | 3300046530 | Bacteria | 10439 |
| 507 | Ga0495654_0029096 | 3300046530 | Bacteria | 2819 |
| 508 | Ga0495609_0022292 | 3300046538 | Bacteria | 2917 |
| 509 | Ga0495609_0055815 | 3300046538 | Bacteria | 1751 |
| 510 | Ga0495621_0002325 | 3300046539 | Bacteria | 5101 |
| 511 | Ga0495621_0002906 | 3300046539 | Bacteria | 4665 |
| 512 | Ga0495597_0011428 | 3300046542 | Bacteria | 4304 |
| 513 | Ga0495597_0171808 | 3300046542 | Bacteria | 879 |
| 514 | Ga0495645_0024212 | 3300046543 | Bacteria | 4404 |
| 515 | Ga0495622_0002682 | 3300046557 | Bacteria | 8538 |
| 516 | Ga0495622_0029016 | 3300046557 | Bacteria | 2585 |
| 517 | Ga0495633_0020328 | 3300046558 | Bacteria | 3340 |
| 518 | Ga0495633_0195663 | 3300046558 | Bacteria | 929 |
| 519 | Ga0495611_0066627 | 3300046648 | Bacteria | 1642 |
| 520 | Ga0495625_0023066 | 3300046660 | Bacteria | 4758 |
| 521 | Ga0495625_0144835 | 3300046660 | Bacteria | 1600 |
| 522 | Ga0495625_0250628 | 3300046660 | Bacteria | 1149 |
| 523 | Ga0495635_0113486 | 3300046663 | Bacteria | 1850 |
| 524 | Ga0495657_0179292 | 3300046675 | Bacteria | 1301 |
| 525 | Ga0495599_0011329 | 3300046678 | Bacteria | 5476 |
| 526 | Ga0495623_0004175 | 3300046679 | Bacteria | 9519 |
| 527 | Ga0495671_0017004 | 3300046692 | Bacteria | 3874 |
| 528 | Ga0495671_0029482 | 3300046692 | Bacteria | 2817 |
| 529 | Ga0495649_0022218 | 3300046694 | Bacteria | 3549 |
| 530 | Ga0495660_0012624 | 3300046810 | Bacteria | 4902 |
| 531 | Ga0495660_0015977 | 3300046810 | Bacteria | 4330 |
| 532 | Ga0495660_0017774 | 3300046810 | Bacteria | 4090 |
| 533 | Ga0495660_0031969 | 3300046810 | Bacteria | 2956 |
| 534 | Ga0495676_0033772 | 3300047321 | Bacteria | 4300 |
| 535 | Ga0495683_0035437 | 3300047323 | Bacteria | 2536 |
| 536 | Ga0495679_009753 | 3300047446 | Bacteria | 3818 |
| 537 | Ga0495673_0002133 | 3300047469 | Bacteria | 14363 |
| 538 | Ga0495673_0011310 | 3300047469 | Bacteria | 4810 |
| 539 | Ga0495673_0017535 | 3300047469 | Bacteria | 3630 |
| 540 | Ga0495681_0070145 | 3300047470 | Bacteria | 1590 |
| 541 | Ga0495681_0115384 | 3300047470 | Bacteria | 1158 |
| 542 | Ga0495626_0009181 | 3300048091 | Bacteria | 5355 |
| 543 | Ga0495626_0011997 | 3300048091 | Bacteria | 4559 |
| 544 | Ga0495626_0037587 | 3300048091 | Bacteria | 2299 |
| 545 | Ga0496104_0010248 | 3300048907 | Bacteria | 8370 |
| 546 | Ga0496105_0154774 | 3300048908 | Bacteria | 1883 |
| 547 | Ga0496106_0080916 | 3300048909 | Bacteria | 2495 |
| 548 | Ga0496110_0018671 | 3300048913 | Bacteria | 5819 |
| 549 | Ga0495678_008137 | 3300049459 | Bacteria | 5338 |
| 550 | Ga0495678_025575 | 3300049459 | Bacteria | 2533 |
| 551 | Ga0495682_0000735 | 3300049460 | Bacteria | 21204 |
| 552 | Ga0495682_0007404 | 3300049460 | Bacteria | 4366 |
| 553 | Ga0501034_0043398 | 3300049571 | Bacteria | 4551 |
| 554 | Ga0501034_0388269 | 3300049571 | Bacteria | 1320 |
| 555 | Ga0501039_0135356 | 3300049575 | Bacteria | 1935 |
| 556 | Ga0501047_0162547 | 3300049581 | Bacteria | 2104 |
| 557 | Ga0501047_0238350 | 3300049581 | Bacteria | 1670 |
| 558 | Ga0501047_0566615 | 3300049581 | Bacteria | 959 |
| 559 | Ga0501068_0035505 | 3300049584 | Bacteria | 2976 |
| 560 | Ga0501069_0032607 | 3300049585 | Bacteria | 2867 |
| 561 | Ga0501070_0000922 | 3300049586 | Bacteria | 26611 |
| 562 | Ga0501070_0263274 | 3300049586 | Bacteria | 1409 |
| 563 | Ga0501072_0037580 | 3300049588 | Bacteria | 3798 |
| 564 | Ga0501073_0000119 | 3300049589 | Bacteria | 50663 |
| 565 | Ga0501074_0000634 | 3300049590 | Bacteria | 21786 |
| 566 | Ga0501079_0091236 | 3300049741 | Bacteria | 2360 |
| 567 | Ga0501080_0002188 | 3300049742 | Bacteria | 16986 |
| 568 | Ga0501080_0012490 | 3300049742 | Bacteria | 7788 |
| 569 | Ga0501083_0000505 | 3300049744 | Bacteria | 24911 |
| 570 | Ga0501035_0367854 | 3300049822 | Bacteria | 1200 |
| 571 | Ga0501044_0166923 | 3300049823 | Bacteria | 2175 |
| 572 | nmdc:mga00v17_16420_c1 | 3300050491 | Bacteria | 4173 |
| 573 | nmdc:mga00v17_25493_c1 | 3300050491 | Bacteria | 3437 |
| 574 | nmdc:mga0k408_140965_c1 | 3300050493 | Bacteria | 1434 |
| 575 | nmdc:mga0k408_19041_c1 | 3300050493 | Bacteria | 3833 |
| 576 | nmdc:mga0k408_2758_c1 | 3300050493 | Bacteria | 9333 |
| 577 | nmdc:mga0k408_7584_c1 | 3300050493 | Bacteria | 5793 |
| 578 | nmdc:mga0k408_79122_c1 | 3300050493 | Bacteria | 1924 |
| 579 | nmdc:mga06z11_29157_c1 | 3300050494 | Bacteria | 2018 |
| 580 | nmdc:mga07m45_108633_c1 | 3300050496 | Bacteria | 1596 |
| 581 | nmdc:mga09592_61239_c1 | 3300050508 | Bacteria | 3183 |
| 582 | nmdc:mga0qj67_81873_c1 | 3300050509 | Unclassified | 2588 |
| 583 | nmdc:mga06r32_828022_c1 | 3300050510 | Bacteria | 885 |
| 584 | nmdc:mga08y16_1048_c1 | 3300050511 | Bacteria | 27140 |
| 585 | nmdc:mga0n895_235536_c1 | 3300050512 | Bacteria | 1858 |
| 586 | nmdc:mga0rr50_218471_c1 | 3300050513 | Bacteria | 1573 |
| 587 | nmdc:mga08x19_412_c1 | 3300050514 | Bacteria | 29897 |
| 588 | nmdc:mga0a205_19355_c1 | 3300050515 | Bacteria | 6416 |
| 589 | nmdc:mga0sz30_28335_c1 | 3300050516 | Bacteria | 2305 |
| 590 | Ga0495601_0001143 | 3300053077 | Bacteria | 14531 |
| 591 | Ga0495601_0478151 | 3300053077 | Bacteria | 805 |
| 592 | Ga0495595_0018832 | 3300053084 | Bacteria | 2988 |
| 593 | Ga0495619_0006435 | 3300053085 | Bacteria | 7440 |
| 594 | Ga0500641_0014934 | 3300053096 | Bacteria | 2873 |
| 595 | Ga0500572_004330 | 3300053111 | Bacteria | 3222 |
| 596 | Ga0500577_0075346 | 3300053142 | Bacteria | 1333 |
| 597 | Ga0501084_0054513 | 3300054114 | Bacteria | 3345 |
| 598 | Ga0501082_0023922 | 3300060353 | Bacteria | 5268 |
| 599 | Ga0466962_0213743 | 3300061719 | Bacteria | 943 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049575 | Ga0501039_0135356 | Ga0501039_0135356_747_1382 | 146 |
| 2 | 3300044673 | Ga0453683_0407530 | Ga0453683_0407530_32_565 | 161 |
| 3 | 3300046542 | Ga0495597_0171808 | Ga0495597_0171808_19_555 | 172 |
| 4 | 3300006195 | Ga0075366_10177839 | Ga0075366_101778392 | 176 |
| 5 | 3300050493 | nmdc:mga0k408_19041_c1 | nmdc:mga0k408_19041_c1_3135_3779 | 176 |
| 6 | 3300042009 | Ga0439451_001417 | Ga0439451_001417_4162_4719 | 179 |
| 7 | 3300006846 | Ga0075430_100088646 | Ga0075430_1000886462 | 182 |
| 8 | 3300025933 | Ga0207706_10639163 | Ga0207706_106391632 | 182 |
| 9 | 3300050509 | nmdc:mga0qj67_81873_c1 | nmdc:mga0qj67_81873_c1_512_1156 | 182 |
| 10 | 3300050510 | nmdc:mga06r32_828022_c1 | nmdc:mga06r32_828022_c1_185_829 | 182 |
| 11 | 3300005331 | Ga0070670_100080624 | Ga0070670_1000806242 | 184 |
| 12 | 3300005334 | Ga0068869_100000748 | Ga0068869_10000074811 | 184 |
| 13 | 3300005338 | Ga0068868_100225029 | Ga0068868_1002250291 | 184 |
| 14 | 3300005340 | Ga0070689_100134005 | Ga0070689_1001340053 | 184 |
| 15 | 3300005347 | Ga0070668_100259924 | Ga0070668_1002599242 | 184 |
| 16 | 3300005354 | Ga0070675_100024903 | Ga0070675_1000249034 | 184 |
| 17 | 3300005367 | Ga0070667_100378302 | Ga0070667_1003783021 | 184 |
| 18 | 3300005456 | Ga0070678_100060614 | Ga0070678_1000606142 | 184 |
| 19 | 3300005459 | Ga0068867_100156291 | Ga0068867_1001562912 | 184 |
| 20 | 3300005459 | Ga0068867_100905986 | Ga0068867_1009059861 | 184 |
| 21 | 3300005543 | Ga0070672_100293917 | Ga0070672_1002939172 | 184 |
| 22 | 3300005548 | Ga0070665_100010415 | Ga0070665_1000104156 | 184 |
| 23 | 3300005615 | Ga0070702_100051058 | Ga0070702_1000510583 | 184 |
| 24 | 3300005617 | Ga0068859_100004039 | Ga0068859_1000040398 | 184 |
| 25 | 3300005618 | Ga0068864_100063600 | Ga0068864_1000636003 | 184 |
| 26 | 3300005719 | Ga0068861_100186404 | Ga0068861_1001864043 | 184 |
| 27 | 3300005841 | Ga0068863_100043046 | Ga0068863_1000430463 | 184 |
| 28 | 3300005842 | Ga0068858_100039504 | Ga0068858_1000395043 | 184 |
| 29 | 3300005844 | Ga0068862_100075876 | Ga0068862_1000758763 | 184 |
| 30 | 3300006237 | Ga0097621_100041446 | Ga0097621_1000414463 | 184 |
| 31 | 3300006358 | Ga0068871_100740789 | Ga0068871_1007407892 | 184 |
| 32 | 3300006881 | Ga0068865_100358344 | Ga0068865_1003583442 | 184 |
| 33 | 3300006931 | Ga0097620_100004039 | Ga0097620_1000040398 | 184 |
| 34 | 3300009098 | Ga0105245_10104933 | Ga0105245_101049332 | 184 |
| 35 | 3300009101 | Ga0105247_10120285 | Ga0105247_101202852 | 184 |
| 36 | 3300009148 | Ga0105243_10979324 | Ga0105243_109793241 | 184 |
| 37 | 3300009176 | Ga0105242_10042298 | Ga0105242_100422983 | 184 |
| 38 | 3300009177 | Ga0105248_10001876 | Ga0105248_100018766 | 184 |
| 39 | 3300009551 | Ga0105238_10195945 | Ga0105238_101959452 | 184 |
| 40 | 3300010375 | Ga0105239_10061863 | Ga0105239_100618633 | 184 |
| 41 | 3300011119 | Ga0105246_10007889 | Ga0105246_100078895 | 184 |
| 42 | 3300013296 | Ga0157374_10015902 | Ga0157374_100159022 | 184 |
| 43 | 3300013297 | Ga0157378_10256832 | Ga0157378_102568322 | 184 |
| 44 | 3300013306 | Ga0163162_10772593 | Ga0163162_107725932 | 184 |
| 45 | 3300013306 | Ga0163162_10831106 | Ga0163162_108311062 | 184 |
| 46 | 3300013308 | Ga0157375_10058583 | Ga0157375_100585832 | 184 |
| 47 | 3300014969 | Ga0157376_10054333 | Ga0157376_100543331 | 184 |
| 48 | 3300025900 | Ga0207710_10095965 | Ga0207710_100959652 | 184 |
| 49 | 3300025908 | Ga0207643_10153571 | Ga0207643_101535712 | 184 |
| 50 | 3300025925 | Ga0207650_10562056 | Ga0207650_105620562 | 184 |
| 51 | 3300025926 | Ga0207659_10038347 | Ga0207659_100383473 | 184 |
| 52 | 3300025936 | Ga0207670_10029654 | Ga0207670_100296543 | 184 |
| 53 | 3300025937 | Ga0207669_10049861 | Ga0207669_100498613 | 184 |
| 54 | 3300025938 | Ga0207704_10045688 | Ga0207704_100456883 | 184 |
| 55 | 3300025940 | Ga0207691_10230037 | Ga0207691_102300373 | 184 |
| 56 | 3300025941 | Ga0207711_10014208 | Ga0207711_100142084 | 184 |
| 57 | 3300025942 | Ga0207689_10002992 | Ga0207689_100029925 | 184 |
| 58 | 3300025960 | Ga0207651_10164869 | Ga0207651_101648692 | 184 |
| 59 | 3300025972 | Ga0207668_10545490 | Ga0207668_105454902 | 184 |
| 60 | 3300025986 | Ga0207658_10228603 | Ga0207658_102286032 | 184 |
| 61 | 3300026023 | Ga0207677_10439304 | Ga0207677_104393041 | 184 |
| 62 | 3300026035 | Ga0207703_10040646 | Ga0207703_100406462 | 184 |
| 63 | 3300026088 | Ga0207641_10041880 | Ga0207641_100418803 | 184 |
| 64 | 3300026089 | Ga0207648_10050473 | Ga0207648_100504733 | 184 |
| 65 | 3300026089 | Ga0207648_10792990 | Ga0207648_107929902 | 184 |
| 66 | 3300026095 | Ga0207676_10110209 | Ga0207676_101102092 | 184 |
| 67 | 3300026118 | Ga0207675_100091197 | Ga0207675_1000911973 | 184 |
| 68 | 3300026121 | Ga0207683_10027436 | Ga0207683_100274363 | 184 |
| 69 | 3300028379 | Ga0268266_10055827 | Ga0268266_100558272 | 184 |
| 70 | 3300028380 | Ga0268265_10053174 | Ga0268265_100531743 | 184 |
| 71 | 3300035692 | Ga0373935_0309308 | Ga0373935_0309308_103_744 | 184 |
| 72 | 3300053077 | Ga0495601_0478151 | Ga0495601_0478151_96_737 | 184 |
| 73 | 3300005840 | Ga0068870_10042233 | Ga0068870_100422333 | 186 |
| 74 | 3300049741 | Ga0501079_0091236 | Ga0501079_0091236_1611_2231 | 188 |
| 75 | 3300006846 | Ga0075430_100140515 | Ga0075430_1001405153 | 189 |
| 76 | 3300006847 | Ga0075431_100125345 | Ga0075431_1001253453 | 189 |
| 77 | 3300035092 | Ga0373952_0000434 | Ga0373952_0000434_750_1370 | 189 |
| 78 | 3300035121 | Ga0373960_0004088 | Ga0373960_0004088_1542_2162 | 189 |
| 79 | 3300005327 | Ga0070658_10018825 | Ga0070658_100188253 | 190 |
| 80 | 3300005338 | Ga0068868_100061052 | Ga0068868_1000610523 | 190 |
| 81 | 3300005340 | Ga0070689_100773680 | Ga0070689_1007736801 | 190 |
| 82 | 3300005353 | Ga0070669_100227168 | Ga0070669_1002271682 | 190 |
| 83 | 3300005354 | Ga0070675_100343828 | Ga0070675_1003438282 | 190 |
| 84 | 3300005364 | Ga0070673_100021180 | Ga0070673_1000211803 | 190 |
| 85 | 3300005456 | Ga0070678_100030357 | Ga0070678_1000303573 | 190 |
| 86 | 3300005457 | Ga0070662_100241102 | Ga0070662_1002411021 | 190 |
| 87 | 3300005457 | Ga0070662_100403948 | Ga0070662_1004039482 | 190 |
| 88 | 3300005459 | Ga0068867_100195499 | Ga0068867_1001954991 | 190 |
| 89 | 3300005544 | Ga0070686_100608833 | Ga0070686_1006088331 | 190 |
| 90 | 3300005564 | Ga0070664_100253413 | Ga0070664_1002534132 | 190 |
| 91 | 3300005718 | Ga0068866_10129195 | Ga0068866_101291952 | 190 |
| 92 | 3300005842 | Ga0068858_100035268 | Ga0068858_1000352683 | 190 |
| 93 | 3300006881 | Ga0068865_100084160 | Ga0068865_1000841603 | 190 |
| 94 | 3300009148 | Ga0105243_10228760 | Ga0105243_102287602 | 190 |
| 95 | 3300009176 | Ga0105242_10001487 | Ga0105242_100014873 | 190 |
| 96 | 3300009177 | Ga0105248_10190892 | Ga0105248_101908923 | 190 |
| 97 | 3300011119 | Ga0105246_10844406 | Ga0105246_108444061 | 190 |
| 98 | 3300013102 | Ga0157371_10430589 | Ga0157371_104305892 | 190 |
| 99 | 3300013297 | Ga0157378_10278624 | Ga0157378_102786242 | 190 |
| 100 | 3300013306 | Ga0163162_10133771 | Ga0163162_101337713 | 190 |
| 101 | 3300013307 | Ga0157372_10264021 | Ga0157372_102640212 | 190 |
| 102 | 3300014326 | Ga0157380_10036400 | Ga0157380_100364003 | 190 |
| 103 | 3300014968 | Ga0157379_10281304 | Ga0157379_102813043 | 190 |
| 104 | 3300025901 | Ga0207688_10304058 | Ga0207688_103040582 | 190 |
| 105 | 3300025909 | Ga0207705_10011261 | Ga0207705_100112613 | 190 |
| 106 | 3300025923 | Ga0207681_10224809 | Ga0207681_102248092 | 190 |
| 107 | 3300025926 | Ga0207659_10236877 | Ga0207659_102368772 | 190 |
| 108 | 3300025934 | Ga0207686_10033409 | Ga0207686_100334093 | 190 |
| 109 | 3300025936 | Ga0207670_10660338 | Ga0207670_106603382 | 190 |
| 110 | 3300025937 | Ga0207669_10092600 | Ga0207669_100926003 | 190 |
| 111 | 3300025937 | Ga0207669_10174476 | Ga0207669_101744762 | 190 |
| 112 | 3300025938 | Ga0207704_10037943 | Ga0207704_100379433 | 190 |
| 113 | 3300025941 | Ga0207711_10173671 | Ga0207711_101736713 | 190 |
| 114 | 3300025945 | Ga0207679_10247627 | Ga0207679_102476272 | 190 |
| 115 | 3300026023 | Ga0207677_10072632 | Ga0207677_100726323 | 190 |
| 116 | 3300026035 | Ga0207703_10003555 | Ga0207703_100035556 | 190 |
| 117 | 3300026075 | Ga0207708_10108470 | Ga0207708_101084702 | 190 |
| 118 | 3300026089 | Ga0207648_10189543 | Ga0207648_101895431 | 190 |
| 119 | 3300026089 | Ga0207648_10295235 | Ga0207648_102952352 | 190 |
| 120 | 3300026121 | Ga0207683_10042013 | Ga0207683_100420133 | 190 |
| 121 | 3300026142 | Ga0207698_10354992 | Ga0207698_103549922 | 190 |
| 122 | 3300034816 | Ga0373930_0005353 | Ga0373930_0005353_530_1177 | 190 |
| 123 | 3300035112 | Ga0373932_0116666 | Ga0373932_0116666_10_657 | 190 |
| 124 | 3300035691 | Ga0373931_0057252 | Ga0373931_0057252_888_1535 | 190 |
| 125 | 3300050493 | nmdc:mga0k408_140965_c1 | nmdc:mga0k408_140965_c1_749_1390 | 191 |
| 126 | 3300005335 | Ga0070666_10124903 | Ga0070666_101249032 | 192 |
| 127 | 3300005338 | Ga0068868_100102272 | Ga0068868_1001022722 | 192 |
| 128 | 3300005440 | Ga0070705_100083703 | Ga0070705_1000837032 | 192 |
| 129 | 3300005441 | Ga0070700_100054632 | Ga0070700_1000546322 | 192 |
| 130 | 3300005456 | Ga0070678_100181859 | Ga0070678_1001818592 | 192 |
| 131 | 3300005457 | Ga0070662_100133658 | Ga0070662_1001336583 | 192 |
| 132 | 3300005459 | Ga0068867_100079695 | Ga0068867_1000796953 | 192 |
| 133 | 3300005468 | Ga0070707_100183209 | Ga0070707_1001832092 | 192 |
| 134 | 3300005518 | Ga0070699_100038599 | Ga0070699_1000385993 | 192 |
| 135 | 3300005535 | Ga0070684_100233947 | Ga0070684_1002339472 | 192 |
| 136 | 3300005546 | Ga0070696_100006717 | Ga0070696_1000067173 | 192 |
| 137 | 3300005548 | Ga0070665_100025910 | Ga0070665_1000259106 | 192 |
| 138 | 3300005563 | Ga0068855_100173405 | Ga0068855_1001734052 | 192 |
| 139 | 3300005615 | Ga0070702_100055395 | Ga0070702_1000553953 | 192 |
| 140 | 3300005617 | Ga0068859_100809926 | Ga0068859_1008099262 | 192 |
| 141 | 3300005834 | Ga0068851_10221534 | Ga0068851_102215342 | 192 |
| 142 | 3300006195 | Ga0075366_10002257 | Ga0075366_100022576 | 192 |
| 143 | 3300006358 | Ga0068871_100395653 | Ga0068871_1003956532 | 192 |
| 144 | 3300006852 | Ga0075433_10019638 | Ga0075433_100196385 | 192 |
| 145 | 3300006881 | Ga0068865_100257626 | Ga0068865_1002576261 | 192 |
| 146 | 3300006931 | Ga0097620_100809985 | Ga0097620_1008099852 | 192 |
| 147 | 3300009093 | Ga0105240_10382709 | Ga0105240_103827092 | 192 |
| 148 | 3300009098 | Ga0105245_10084737 | Ga0105245_100847373 | 192 |
| 149 | 3300009098 | Ga0105245_10135683 | Ga0105245_101356833 | 192 |
| 150 | 3300009098 | Ga0105245_10137992 | Ga0105245_101379922 | 192 |
| 151 | 3300009147 | Ga0114129_10435422 | Ga0114129_104354222 | 192 |
| 152 | 3300009551 | Ga0105238_10074407 | Ga0105238_100744073 | 192 |
| 153 | 3300013102 | Ga0157371_10522058 | Ga0157371_105220582 | 192 |
| 154 | 3300013105 | Ga0157369_10037649 | Ga0157369_100376493 | 192 |
| 155 | 3300013296 | Ga0157374_10050116 | Ga0157374_100501163 | 192 |
| 156 | 3300013306 | Ga0163162_10295323 | Ga0163162_102953231 | 192 |
| 157 | 3300013307 | Ga0157372_10000909 | Ga0157372_1000090917 | 192 |
| 158 | 3300013308 | Ga0157375_10113624 | Ga0157375_101136242 | 192 |
| 159 | 3300025899 | Ga0207642_10058614 | Ga0207642_100586143 | 192 |
| 160 | 3300025901 | Ga0207688_10123119 | Ga0207688_101231192 | 192 |
| 161 | 3300025909 | Ga0207705_10023458 | Ga0207705_100234584 | 192 |
| 162 | 3300025913 | Ga0207695_10085416 | Ga0207695_100854162 | 192 |
| 163 | 3300025927 | Ga0207687_10154086 | Ga0207687_101540863 | 192 |
| 164 | 3300025927 | Ga0207687_10212570 | Ga0207687_102125702 | 192 |
| 165 | 3300025929 | Ga0207664_10140235 | Ga0207664_101402352 | 192 |
| 166 | 3300025932 | Ga0207690_10076662 | Ga0207690_100766622 | 192 |
| 167 | 3300025938 | Ga0207704_10223674 | Ga0207704_102236742 | 192 |
| 168 | 3300025949 | Ga0207667_10061418 | Ga0207667_100614183 | 192 |
| 169 | 3300025981 | Ga0207640_10210564 | Ga0207640_102105641 | 192 |
| 170 | 3300026023 | Ga0207677_10352437 | Ga0207677_103524372 | 192 |
| 171 | 3300026075 | Ga0207708_10279147 | Ga0207708_102791472 | 192 |
| 172 | 3300026089 | Ga0207648_10195558 | Ga0207648_101955582 | 192 |
| 173 | 3300026121 | Ga0207683_10095692 | Ga0207683_100956923 | 192 |
| 174 | 3300028380 | Ga0268265_10607307 | Ga0268265_106073072 | 192 |
| 175 | 3300035398 | Ga0316574_0006680 | Ga0316574_0006680_1100_1708 | 192 |
| 176 | 3300035398 | Ga0316574_0024290 | Ga0316574_0024290_2550_3158 | 192 |
| 177 | 3300048909 | Ga0496106_0080916 | Ga0496106_0080916_1463_2107 | 192 |
| 178 | 3300050515 | nmdc:mga0a205_19355_c1 | nmdc:mga0a205_19355_c1_1618_2262 | 192 |
| 179 | iso_pu_bacteria | 2923153595 | 2923154048 | 192 |
| 180 | 3300005290 | Ga0065712_10183744 | Ga0065712_101837441 | 193 |
| 181 | 3300005334 | Ga0068869_100050478 | Ga0068869_1000504783 | 193 |
| 182 | 3300005337 | Ga0070682_100389085 | Ga0070682_1003890852 | 193 |
| 183 | 3300005338 | Ga0068868_100009375 | Ga0068868_1000093755 | 193 |
| 184 | 3300005338 | Ga0068868_100064718 | Ga0068868_1000647184 | 193 |
| 185 | 3300005340 | Ga0070689_100003205 | Ga0070689_1000032053 | 193 |
| 186 | 3300005340 | Ga0070689_100158807 | Ga0070689_1001588072 | 193 |
| 187 | 3300005344 | Ga0070661_100423378 | Ga0070661_1004233782 | 193 |
| 188 | 3300005354 | Ga0070675_100001954 | Ga0070675_10000195414 | 193 |
| 189 | 3300005356 | Ga0070674_100438373 | Ga0070674_1004383732 | 193 |
| 190 | 3300005364 | Ga0070673_100153859 | Ga0070673_1001538593 | 193 |
| 191 | 3300005365 | Ga0070688_100002581 | Ga0070688_1000025813 | 193 |
| 192 | 3300005441 | Ga0070700_100086658 | Ga0070700_1000866582 | 193 |
| 193 | 3300005444 | Ga0070694_100156717 | Ga0070694_1001567173 | 193 |
| 194 | 3300005455 | Ga0070663_100788790 | Ga0070663_1007887901 | 193 |
| 195 | 3300005466 | Ga0070685_10046258 | Ga0070685_100462583 | 193 |
| 196 | 3300005535 | Ga0070684_100750652 | Ga0070684_1007506522 | 193 |
| 197 | 3300005543 | Ga0070672_100013680 | Ga0070672_1000136806 | 193 |
| 198 | 3300005545 | Ga0070695_100048036 | Ga0070695_1000480363 | 193 |
| 199 | 3300005545 | Ga0070695_100751344 | Ga0070695_1007513441 | 193 |
| 200 | 3300005546 | Ga0070696_100067991 | Ga0070696_1000679912 | 193 |
| 201 | 3300005547 | Ga0070693_100000368 | Ga0070693_10000036816 | 193 |
| 202 | 3300005547 | Ga0070693_100003051 | Ga0070693_1000030518 | 193 |
| 203 | 3300005563 | Ga0068855_100017306 | Ga0068855_1000173064 | 193 |
| 204 | 3300005577 | Ga0068857_100264144 | Ga0068857_1002641442 | 193 |
| 205 | 3300005578 | Ga0068854_100209752 | Ga0068854_1002097523 | 193 |
| 206 | 3300005614 | Ga0068856_100991302 | Ga0068856_1009913022 | 193 |
| 207 | 3300005615 | Ga0070702_100053287 | Ga0070702_1000532873 | 193 |
| 208 | 3300005616 | Ga0068852_100000366 | Ga0068852_10000036618 | 193 |
| 209 | 3300005616 | Ga0068852_100103446 | Ga0068852_1001034463 | 193 |
| 210 | 3300005616 | Ga0068852_100813735 | Ga0068852_1008137352 | 193 |
| 211 | 3300005617 | Ga0068859_100007911 | Ga0068859_1000079111 | 193 |
| 212 | 3300005617 | Ga0068859_100076204 | Ga0068859_1000762043 | 193 |
| 213 | 3300005617 | Ga0068859_100197600 | Ga0068859_1001976003 | 193 |
| 214 | 3300005618 | Ga0068864_100279462 | Ga0068864_1002794622 | 193 |
| 215 | 3300005719 | Ga0068861_100853522 | Ga0068861_1008535222 | 193 |
| 216 | 3300005834 | Ga0068851_10000790 | Ga0068851_100007906 | 193 |
| 217 | 3300005842 | Ga0068858_100048936 | Ga0068858_1000489363 | 193 |
| 218 | 3300005843 | Ga0068860_100162207 | Ga0068860_1001622073 | 193 |
| 219 | 3300006163 | Ga0070715_10073701 | Ga0070715_100737012 | 193 |
| 220 | 3300006178 | Ga0075367_10093583 | Ga0075367_100935833 | 193 |
| 221 | 3300006195 | Ga0075366_10012324 | Ga0075366_100123243 | 193 |
| 222 | 3300006237 | Ga0097621_100004700 | Ga0097621_1000047007 | 193 |
| 223 | 3300006237 | Ga0097621_100009334 | Ga0097621_1000093343 | 193 |
| 224 | 3300006237 | Ga0097621_100062721 | Ga0097621_1000627213 | 193 |
| 225 | 3300006358 | Ga0068871_100008124 | Ga0068871_1000081247 | 193 |
| 226 | 3300006358 | Ga0068871_100020732 | Ga0068871_1000207323 | 193 |
| 227 | 3300006358 | Ga0068871_100070285 | Ga0068871_1000702853 | 193 |
| 228 | 3300006844 | Ga0075428_100015492 | Ga0075428_1000154923 | 193 |
| 229 | 3300006871 | Ga0075434_100089747 | Ga0075434_1000897474 | 193 |
| 230 | 3300006880 | Ga0075429_100073830 | Ga0075429_1000738302 | 193 |
| 231 | 3300006881 | Ga0068865_100138594 | Ga0068865_1001385943 | 193 |
| 232 | 3300006881 | Ga0068865_100153406 | Ga0068865_1001534062 | 193 |
| 233 | 3300006914 | Ga0075436_100014310 | Ga0075436_1000143103 | 193 |
| 234 | 3300006931 | Ga0097620_100007911 | Ga0097620_1000079111 | 193 |
| 235 | 3300006931 | Ga0097620_100076205 | Ga0097620_1000762053 | 193 |
| 236 | 3300006931 | Ga0097620_100197589 | Ga0097620_1001975893 | 193 |
| 237 | 3300007076 | Ga0075435_100125535 | Ga0075435_1001255352 | 193 |
| 238 | 3300009093 | Ga0105240_10676482 | Ga0105240_106764822 | 193 |
| 239 | 3300009094 | Ga0111539_10002062 | Ga0111539_1000206217 | 193 |
| 240 | 3300009098 | Ga0105245_10053171 | Ga0105245_100531713 | 193 |
| 241 | 3300009098 | Ga0105245_10085718 | Ga0105245_100857183 | 193 |
| 242 | 3300009148 | Ga0105243_10048529 | Ga0105243_100485293 | 193 |
| 243 | 3300009176 | Ga0105242_10014314 | Ga0105242_100143143 | 193 |
| 244 | 3300009177 | Ga0105248_10114213 | Ga0105248_101142133 | 193 |
| 245 | 3300009551 | Ga0105238_10112099 | Ga0105238_101120993 | 193 |
| 246 | 3300009551 | Ga0105238_10204719 | Ga0105238_102047192 | 193 |
| 247 | 3300009551 | Ga0105238_10292074 | Ga0105238_102920743 | 193 |
| 248 | 3300010375 | Ga0105239_10644656 | Ga0105239_106446562 | 193 |
| 249 | 3300013104 | Ga0157370_10124971 | Ga0157370_101249713 | 193 |
| 250 | 3300013296 | Ga0157374_10030276 | Ga0157374_100302763 | 193 |
| 251 | 3300013296 | Ga0157374_10060773 | Ga0157374_100607733 | 193 |
| 252 | 3300013297 | Ga0157378_10095065 | Ga0157378_100950653 | 193 |
| 253 | 3300013297 | Ga0157378_10242822 | Ga0157378_102428221 | 193 |
| 254 | 3300013297 | Ga0157378_10380558 | Ga0157378_103805582 | 193 |
| 255 | 3300013306 | Ga0163162_10488180 | Ga0163162_104881802 | 193 |
| 256 | 3300013307 | Ga0157372_10598009 | Ga0157372_105980092 | 193 |
| 257 | 3300013307 | Ga0157372_10736483 | Ga0157372_107364832 | 193 |
| 258 | 3300013308 | Ga0157375_10286877 | Ga0157375_102868773 | 193 |
| 259 | 3300014968 | Ga0157379_10230385 | Ga0157379_102303852 | 193 |
| 260 | 3300014969 | Ga0157376_10085497 | Ga0157376_100854973 | 193 |
| 261 | 3300014969 | Ga0157376_10204675 | Ga0157376_102046752 | 193 |
| 262 | 3300017792 | Ga0163161_10180101 | Ga0163161_101801013 | 193 |
| 263 | 3300025321 | Ga0207656_10000272 | Ga0207656_1000027212 | 193 |
| 264 | 3300025893 | Ga0207682_10085069 | Ga0207682_100850692 | 193 |
| 265 | 3300025901 | Ga0207688_10117280 | Ga0207688_101172802 | 193 |
| 266 | 3300025909 | Ga0207705_10062816 | Ga0207705_100628163 | 193 |
| 267 | 3300025918 | Ga0207662_10043025 | Ga0207662_100430253 | 193 |
| 268 | 3300025921 | Ga0207652_10697777 | Ga0207652_106977772 | 193 |
| 269 | 3300025922 | Ga0207646_10152282 | Ga0207646_101522822 | 193 |
| 270 | 3300025923 | Ga0207681_10309006 | Ga0207681_103090062 | 193 |
| 271 | 3300025924 | Ga0207694_10180853 | Ga0207694_101808532 | 193 |
| 272 | 3300025924 | Ga0207694_10310805 | Ga0207694_103108052 | 193 |
| 273 | 3300025924 | Ga0207694_10390878 | Ga0207694_103908782 | 193 |
| 274 | 3300025925 | Ga0207650_10329978 | Ga0207650_103299781 | 193 |
| 275 | 3300025926 | Ga0207659_10004053 | Ga0207659_100040536 | 193 |
| 276 | 3300025927 | Ga0207687_10009127 | Ga0207687_100091272 | 193 |
| 277 | 3300025927 | Ga0207687_10137327 | Ga0207687_101373273 | 193 |
| 278 | 3300025929 | Ga0207664_10110460 | Ga0207664_101104603 | 193 |
| 279 | 3300025934 | Ga0207686_10001762 | Ga0207686_100017624 | 193 |
| 280 | 3300025935 | Ga0207709_10099620 | Ga0207709_100996202 | 193 |
| 281 | 3300025936 | Ga0207670_10001574 | Ga0207670_100015746 | 193 |
| 282 | 3300025936 | Ga0207670_10065432 | Ga0207670_100654322 | 193 |
| 283 | 3300025938 | Ga0207704_10127198 | Ga0207704_101271982 | 193 |
| 284 | 3300025940 | Ga0207691_10004014 | Ga0207691_1000401411 | 193 |
| 285 | 3300025942 | Ga0207689_10034201 | Ga0207689_100342014 | 193 |
| 286 | 3300025942 | Ga0207689_10063888 | Ga0207689_100638883 | 193 |
| 287 | 3300025945 | Ga0207679_10346811 | Ga0207679_103468112 | 193 |
| 288 | 3300025949 | Ga0207667_10026953 | Ga0207667_100269534 | 193 |
| 289 | 3300025960 | Ga0207651_10059979 | Ga0207651_100599793 | 193 |
| 290 | 3300025960 | Ga0207651_10265629 | Ga0207651_102656292 | 193 |
| 291 | 3300025961 | Ga0207712_10292302 | Ga0207712_102923022 | 193 |
| 292 | 3300025981 | Ga0207640_10204963 | Ga0207640_102049632 | 193 |
| 293 | 3300026023 | Ga0207677_10005410 | Ga0207677_100054105 | 193 |
| 294 | 3300026023 | Ga0207677_10200293 | Ga0207677_102002932 | 193 |
| 295 | 3300026023 | Ga0207677_10356873 | Ga0207677_103568732 | 193 |
| 296 | 3300026023 | Ga0207677_10444426 | Ga0207677_104444262 | 193 |
| 297 | 3300026075 | Ga0207708_10089711 | Ga0207708_100897112 | 193 |
| 298 | 3300026078 | Ga0207702_10618485 | Ga0207702_106184852 | 193 |
| 299 | 3300026088 | Ga0207641_10264401 | Ga0207641_102644012 | 193 |
| 300 | 3300026089 | Ga0207648_10107633 | Ga0207648_101076332 | 193 |
| 301 | 3300026095 | Ga0207676_10262826 | Ga0207676_102628262 | 193 |
| 302 | 3300026116 | Ga0207674_10023170 | Ga0207674_100231706 | 193 |
| 303 | 3300026118 | Ga0207675_100773782 | Ga0207675_1007737821 | 193 |
| 304 | 3300026142 | Ga0207698_10001079 | Ga0207698_100010795 | 193 |
| 305 | 3300026142 | Ga0207698_10124081 | Ga0207698_101240813 | 193 |
| 306 | 3300026142 | Ga0207698_10759624 | Ga0207698_107596242 | 193 |
| 307 | 3300027907 | Ga0207428_10002330 | Ga0207428_1000233017 | 193 |
| 308 | 3300028381 | Ga0268264_10266856 | Ga0268264_102668563 | 193 |
| 309 | 3300031251 | Ga0265327_10044502 | Ga0265327_100445022 | 193 |
| 310 | 3300031548 | Ga0307408_100083553 | Ga0307408_1000835532 | 193 |
| 311 | 3300031548 | Ga0307408_100212556 | Ga0307408_1002125562 | 193 |
| 312 | 3300031711 | Ga0265314_10049794 | Ga0265314_100497942 | 193 |
| 313 | 3300031711 | Ga0265314_10062866 | Ga0265314_100628663 | 193 |
| 314 | 3300031712 | Ga0265342_10160232 | Ga0265342_101602322 | 193 |
| 315 | 3300031911 | Ga0307412_10411390 | Ga0307412_104113901 | 193 |
| 316 | 3300032002 | Ga0307416_100434887 | Ga0307416_1004348872 | 193 |
| 317 | 3300035724 | Ga0373933_0421627 | Ga0373933_0421627_193_828 | 193 |
| 318 | 3300036401 | Ga0373937_0095962 | Ga0373937_0095962_1036_1671 | 193 |
| 319 | 3300037418 | Ga0395900_0047854 | Ga0395900_0047854_948_1586 | 193 |
| 320 | 3300037471 | Ga0395905_0014429 | Ga0395905_0014429_2781_3419 | 193 |
| 321 | 3300038443 | Ga0395901_0058360 | Ga0395901_0058360_2836_3474 | 193 |
| 322 | 3300041443 | Ga0451789_0116223 | Ga0451789_0116223_81_722 | 193 |
| 323 | 3300041503 | Ga0451847_0252797 | Ga0451847_0252797_133_780 | 193 |
| 324 | 3300044673 | Ga0453683_0028559 | Ga0453683_0028559_663_1283 | 193 |
| 325 | 3300044842 | Ga0466957_0009448 | Ga0466957_0009448_284_919 | 193 |
| 326 | 3300045051 | Ga0451576_0000006 | Ga0451576_0000006_446469_447089 | 193 |
| 327 | 3300045836 | Ga0466958_0004234 | Ga0466958_0004234_3870_4505 | 193 |
| 328 | 3300046454 | Ga0495592_0029379 | Ga0495592_0029379_1292_1927 | 193 |
| 329 | 3300046462 | Ga0495651_0219583 | Ga0495651_0219583_509_1144 | 193 |
| 330 | 3300046516 | Ga0495628_0130662 | Ga0495628_0130662_780_1415 | 193 |
| 331 | 3300046539 | Ga0495621_0002325 | Ga0495621_0002325_543_1196 | 193 |
| 332 | 3300046543 | Ga0495645_0024212 | Ga0495645_0024212_3009_3644 | 193 |
| 333 | 3300046663 | Ga0495635_0113486 | Ga0495635_0113486_968_1603 | 193 |
| 334 | 3300046675 | Ga0495657_0179292 | Ga0495657_0179292_148_783 | 193 |
| 335 | 3300046678 | Ga0495599_0011329 | Ga0495599_0011329_4020_4655 | 193 |
| 336 | 3300046679 | Ga0495623_0004175 | Ga0495623_0004175_5629_6264 | 193 |
| 337 | 3300048907 | Ga0496104_0010248 | Ga0496104_0010248_1353_1997 | 193 |
| 338 | 3300048908 | Ga0496105_0154774 | Ga0496105_0154774_333_977 | 193 |
| 339 | 3300048913 | Ga0496110_0018671 | Ga0496110_0018671_2002_2646 | 193 |
| 340 | 3300050493 | nmdc:mga0k408_79122_c1 | nmdc:mga0k408_79122_c1_151_789 | 193 |
| 341 | 3300050494 | nmdc:mga06z11_29157_c1 | nmdc:mga06z11_29157_c1_1140_1778 | 193 |
| 342 | 3300050508 | nmdc:mga09592_61239_c1 | nmdc:mga09592_61239_c1_2062_2706 | 193 |
| 343 | 3300050511 | nmdc:mga08y16_1048_c1 | nmdc:mga08y16_1048_c1_4981_5625 | 193 |
| 344 | 3300050512 | nmdc:mga0n895_235536_c1 | nmdc:mga0n895_235536_c1_434_1099 | 193 |
| 345 | 3300050513 | nmdc:mga0rr50_218471_c1 | nmdc:mga0rr50_218471_c1_851_1516 | 193 |
| 346 | 3300050514 | nmdc:mga08x19_412_c1 | nmdc:mga08x19_412_c1_4314_4979 | 193 |
| 347 | 3300053077 | Ga0495601_0001143 | Ga0495601_0001143_5248_5883 | 193 |
| 348 | 3300053084 | Ga0495595_0018832 | Ga0495595_0018832_1233_1868 | 193 |
| 349 | 3300053085 | Ga0495619_0006435 | Ga0495619_0006435_3206_3841 | 193 |
| 350 | 3300061719 | Ga0466962_0213743 | Ga0466962_0213743_31_666 | 193 |
| 351 | 3300005290 | Ga0065712_10121498 | Ga0065712_101214983 | 194 |
| 352 | 3300005327 | Ga0070658_10047662 | Ga0070658_100476623 | 194 |
| 353 | 3300005336 | Ga0070680_100105822 | Ga0070680_1001058223 | 194 |
| 354 | 3300005354 | Ga0070675_100165132 | Ga0070675_1001651322 | 194 |
| 355 | 3300005436 | Ga0070713_100081227 | Ga0070713_1000812272 | 194 |
| 356 | 3300005436 | Ga0070713_100110885 | Ga0070713_1001108853 | 194 |
| 357 | 3300005437 | Ga0070710_10339105 | Ga0070710_103391051 | 194 |
| 358 | 3300005438 | Ga0070701_10074909 | Ga0070701_100749093 | 194 |
| 359 | 3300005456 | Ga0070678_100641732 | Ga0070678_1006417322 | 194 |
| 360 | 3300005458 | Ga0070681_10023535 | Ga0070681_100235356 | 194 |
| 361 | 3300005459 | Ga0068867_100203848 | Ga0068867_1002038482 | 194 |
| 362 | 3300005471 | Ga0070698_100133675 | Ga0070698_1001336751 | 194 |
| 363 | 3300005530 | Ga0070679_100147255 | Ga0070679_1001472553 | 194 |
| 364 | 3300005535 | Ga0070684_100130649 | Ga0070684_1001306492 | 194 |
| 365 | 3300005548 | Ga0070665_100192718 | Ga0070665_1001927183 | 194 |
| 366 | 3300005549 | Ga0070704_100070641 | Ga0070704_1000706413 | 194 |
| 367 | 3300005563 | Ga0068855_100213949 | Ga0068855_1002139492 | 194 |
| 368 | 3300005614 | Ga0068856_100272777 | Ga0068856_1002727773 | 194 |
| 369 | 3300005615 | Ga0070702_100454781 | Ga0070702_1004547811 | 194 |
| 370 | 3300005618 | Ga0068864_100144941 | Ga0068864_1001449413 | 194 |
| 371 | 3300005842 | Ga0068858_100047646 | Ga0068858_1000476463 | 194 |
| 372 | 3300006051 | Ga0075364_10122032 | Ga0075364_101220322 | 194 |
| 373 | 3300006186 | Ga0075369_10019351 | Ga0075369_100193513 | 194 |
| 374 | 3300006195 | Ga0075366_10033772 | Ga0075366_100337723 | 194 |
| 375 | 3300006195 | Ga0075366_10314614 | Ga0075366_103146142 | 194 |
| 376 | 3300006195 | Ga0075366_10488711 | Ga0075366_104887111 | 194 |
| 377 | 3300006237 | Ga0097621_100127834 | Ga0097621_1001278343 | 194 |
| 378 | 3300006358 | Ga0068871_100094461 | Ga0068871_1000944612 | 194 |
| 379 | 3300009093 | Ga0105240_10364679 | Ga0105240_103646792 | 194 |
| 380 | 3300009148 | Ga0105243_10093042 | Ga0105243_100930423 | 194 |
| 381 | 3300009176 | Ga0105242_10127404 | Ga0105242_101274042 | 194 |
| 382 | 3300009176 | Ga0105242_10132571 | Ga0105242_101325712 | 194 |
| 383 | 3300009545 | Ga0105237_10391936 | Ga0105237_103919362 | 194 |
| 384 | 3300009551 | Ga0105238_10141518 | Ga0105238_101415182 | 194 |
| 385 | 3300009551 | Ga0105238_10149115 | Ga0105238_101491152 | 194 |
| 386 | 3300009551 | Ga0105238_11025986 | Ga0105238_110259861 | 194 |
| 387 | 3300009553 | Ga0105249_10145137 | Ga0105249_101451373 | 194 |
| 388 | 3300009553 | Ga0105249_10746751 | Ga0105249_107467511 | 194 |
| 389 | 3300011119 | Ga0105246_10183374 | Ga0105246_101833743 | 194 |
| 390 | 3300013100 | Ga0157373_10686500 | Ga0157373_106865001 | 194 |
| 391 | 3300013297 | Ga0157378_10018493 | Ga0157378_100184933 | 194 |
| 392 | 3300013306 | Ga0163162_10058308 | Ga0163162_100583083 | 194 |
| 393 | 3300014969 | Ga0157376_10281784 | Ga0157376_102817842 | 194 |
| 394 | 3300021384 | Ga0213876_10101142 | Ga0213876_101011422 | 194 |
| 395 | 3300025909 | Ga0207705_10055013 | Ga0207705_100550133 | 194 |
| 396 | 3300025913 | Ga0207695_10113330 | Ga0207695_101133303 | 194 |
| 397 | 3300025915 | Ga0207693_10526647 | Ga0207693_105266472 | 194 |
| 398 | 3300025918 | Ga0207662_10096977 | Ga0207662_100969773 | 194 |
| 399 | 3300025926 | Ga0207659_10104903 | Ga0207659_101049032 | 194 |
| 400 | 3300025928 | Ga0207700_10315514 | Ga0207700_103155142 | 194 |
| 401 | 3300025931 | Ga0207644_10271591 | Ga0207644_102715912 | 194 |
| 402 | 3300025935 | Ga0207709_10099886 | Ga0207709_100998862 | 194 |
| 403 | 3300025937 | Ga0207669_10325050 | Ga0207669_103250502 | 194 |
| 404 | 3300025941 | Ga0207711_10013651 | Ga0207711_100136513 | 194 |
| 405 | 3300025960 | Ga0207651_10145165 | Ga0207651_101451653 | 194 |
| 406 | 3300025960 | Ga0207651_10322846 | Ga0207651_103228462 | 194 |
| 407 | 3300025981 | Ga0207640_10926876 | Ga0207640_109268761 | 194 |
| 408 | 3300026035 | Ga0207703_10042255 | Ga0207703_100422553 | 194 |
| 409 | 3300026078 | Ga0207702_10239380 | Ga0207702_102393803 | 194 |
| 410 | 3300026095 | Ga0207676_10106239 | Ga0207676_101062392 | 194 |
| 411 | 3300026118 | Ga0207675_100349350 | Ga0207675_1003493502 | 194 |
| 412 | 3300026121 | Ga0207683_10292397 | Ga0207683_102923972 | 194 |
| 413 | 3300026142 | Ga0207698_10206724 | Ga0207698_102067243 | 194 |
| 414 | 3300028379 | Ga0268266_10031462 | Ga0268266_100314623 | 194 |
| 415 | 3300028800 | Ga0265338_10027334 | Ga0265338_100273342 | 194 |
| 416 | 3300029957 | Ga0265324_10001557 | Ga0265324_100015576 | 194 |
| 417 | 3300031548 | Ga0307408_100093273 | Ga0307408_1000932733 | 194 |
| 418 | 3300031711 | Ga0265314_10003992 | Ga0265314_100039926 | 194 |
| 419 | 3300031852 | Ga0307410_10222817 | Ga0307410_102228173 | 194 |
| 420 | 3300031901 | Ga0307406_10140396 | Ga0307406_101403962 | 194 |
| 421 | 3300031903 | Ga0307407_10245506 | Ga0307407_102455062 | 194 |
| 422 | 3300031911 | Ga0307412_10478187 | Ga0307412_104781871 | 194 |
| 423 | 3300032002 | Ga0307416_100227685 | Ga0307416_1002276852 | 194 |
| 424 | 3300032002 | Ga0307416_100406787 | Ga0307416_1004067871 | 194 |
| 425 | 3300032002 | Ga0307416_101103739 | Ga0307416_1011037392 | 194 |
| 426 | 3300032126 | Ga0307415_100169750 | Ga0307415_1001697502 | 194 |
| 427 | 3300032126 | Ga0307415_100180462 | Ga0307415_1001804622 | 194 |
| 428 | 3300035691 | Ga0373931_0057022 | Ga0373931_0057022_438_1091 | 194 |
| 429 | 3300035695 | Ga0373927_0304382 | Ga0373927_0304382_183_833 | 194 |
| 430 | 3300036401 | Ga0373937_0057081 | Ga0373937_0057081_502_1152 | 194 |
| 431 | 3300037068 | Ga0373925_0028973 | Ga0373925_0028973_2060_2710 | 194 |
| 432 | 3300042001 | Ga0439441_005763 | Ga0439441_005763_670_1320 | 194 |
| 433 | 3300042876 | Ga0451577_0000002 | Ga0451577_0000002_1539905_1540546 | 194 |
| 434 | 3300042876 | Ga0451577_0000375 | Ga0451577_0000375_79738_80376 | 194 |
| 435 | 3300042876 | Ga0451577_0017659 | Ga0451577_0017659_4214_4852 | 194 |
| 436 | 3300042876 | Ga0451577_0068618 | Ga0451577_0068618_1971_2591 | 194 |
| 437 | 3300044673 | Ga0453683_0000013 | Ga0453683_0000013_180462_181103 | 194 |
| 438 | 3300044673 | Ga0453683_0091361 | Ga0453683_0091361_669_1319 | 194 |
| 439 | 3300044712 | Ga0453684_0000002 | Ga0453684_0000002_190830_191471 | 194 |
| 440 | 3300044712 | Ga0453684_0000040 | Ga0453684_0000040_520749_521387 | 194 |
| 441 | 3300044712 | Ga0453684_0011349 | Ga0453684_0011349_7185_7823 | 194 |
| 442 | 3300044712 | Ga0453684_0472856 | Ga0453684_0472856_164_808 | 194 |
| 443 | 3300045051 | Ga0451576_0000037 | Ga0451576_0000037_180703_181344 | 194 |
| 444 | 3300045051 | Ga0451576_0000677 | Ga0451576_0000677_66937_67575 | 194 |
| 445 | 3300045051 | Ga0451576_0001321 | Ga0451576_0001321_27075_27707 | 194 |
| 446 | 3300045051 | Ga0451576_0005709 | Ga0451576_0005709_13111_13749 | 194 |
| 447 | 3300045051 | Ga0451576_0172783 | Ga0451576_0172783_1222_1872 | 194 |
| 448 | 3300046455 | Ga0495603_0314840 | Ga0495603_0314840_247_882 | 194 |
| 449 | 3300046539 | Ga0495621_0002906 | Ga0495621_0002906_1598_2254 | 194 |
| 450 | 3300046558 | Ga0495633_0195663 | Ga0495633_0195663_19_669 | 194 |
| 451 | 3300049571 | Ga0501034_0388269 | Ga0501034_0388269_643_1281 | 194 |
| 452 | 3300049581 | Ga0501047_0238350 | Ga0501047_0238350_308_946 | 194 |
| 453 | 3300049581 | Ga0501047_0566615 | Ga0501047_0566615_267_905 | 194 |
| 454 | 3300049584 | Ga0501068_0035505 | Ga0501068_0035505_723_1361 | 194 |
| 455 | 3300049585 | Ga0501069_0032607 | Ga0501069_0032607_1863_2501 | 194 |
| 456 | 3300049586 | Ga0501070_0000922 | Ga0501070_0000922_23465_24103 | 194 |
| 457 | 3300049588 | Ga0501072_0037580 | Ga0501072_0037580_1472_2110 | 194 |
| 458 | 3300049589 | Ga0501073_0000119 | Ga0501073_0000119_25932_26570 | 194 |
| 459 | 3300049590 | Ga0501074_0000634 | Ga0501074_0000634_14815_15453 | 194 |
| 460 | 3300049742 | Ga0501080_0002188 | Ga0501080_0002188_9864_10502 | 194 |
| 461 | 3300049744 | Ga0501083_0000505 | Ga0501083_0000505_16538_17176 | 194 |
| 462 | 3300049822 | Ga0501035_0367854 | Ga0501035_0367854_307_945 | 194 |
| 463 | 3300049823 | Ga0501044_0166923 | Ga0501044_0166923_630_1268 | 194 |
| 464 | 3300050491 | nmdc:mga00v17_16420_c1 | nmdc:mga00v17_16420_c1_2802_3449 | 194 |
| 465 | 3300050493 | nmdc:mga0k408_2758_c1 | nmdc:mga0k408_2758_c1_243_890 | 194 |
| 466 | 3300050493 | nmdc:mga0k408_7584_c1 | nmdc:mga0k408_7584_c1_4362_5009 | 194 |
| 467 | 3300050496 | nmdc:mga07m45_108633_c1 | nmdc:mga07m45_108633_c1_870_1520 | 194 |
| 468 | 3300050516 | nmdc:mga0sz30_28335_c1 | nmdc:mga0sz30_28335_c1_1616_2263 | 194 |
| 469 | 3300053096 | Ga0500641_0014934 | Ga0500641_0014934_477_1121 | 194 |
| 470 | 3300054114 | Ga0501084_0054513 | Ga0501084_0054513_1449_2087 | 194 |
| 471 | 3300060353 | Ga0501082_0023922 | Ga0501082_0023922_4149_4787 | 194 |
| 472 | 3300005563 | Ga0068855_100022973 | Ga0068855_1000229737 | 195 |
| 473 | 3300013104 | Ga0157370_10011951 | Ga0157370_100119513 | 195 |
| 474 | 3300025949 | Ga0207667_10019136 | Ga0207667_100191363 | 195 |
| 475 | 3300028666 | Ga0265336_10000272 | Ga0265336_1000027217 | 195 |
| 476 | 3300029957 | Ga0265324_10000004 | Ga0265324_1000000432 | 195 |
| 477 | 3300031241 | Ga0265325_10000187 | Ga0265325_100001872 | 195 |
| 478 | 3300049581 | Ga0501047_0162547 | Ga0501047_0162547_1415_2065 | 195 |
| 479 | 3300049586 | Ga0501070_0263274 | Ga0501070_0263274_319_969 | 195 |
| 480 | 3300049742 | Ga0501080_0012490 | Ga0501080_0012490_5485_6135 | 195 |
| 481 | 3300031665 | Ga0316575_10028575 | Ga0316575_100285751 | 197 |
| 482 | 3300046491 | Ga0495584_0151018 | Ga0495584_0151018_27_620 | 197 |
| 483 | iso_pu_bacteria | 2554235132 | 2554818087 | 197 |
| 484 | iso_pu_bacteria | 2606217733 | 2608380611 | 197 |
| 485 | iso_pu_bacteria | 2718217725 | 2718632136 | 197 |
| 486 | iso_pu_bacteria | 2969304461 | 2969304935 | 197 |
| 487 | iso_pu_bacteria | 3007419365 | 3007419988 | 197 |
| 488 | iso_pu_bacteria | 640427133 | 640486511 | 197 |
| 489 | 3300031250 | Ga0265331_10011735 | Ga0265331_100117354 | 199 |
| 490 | 3300031251 | Ga0265327_10000065 | Ga0265327_1000006536 | 199 |
| 491 | 3300005548 | Ga0070665_100071014 | Ga0070665_1000710142 | 201 |
| 492 | 3300006051 | Ga0075364_10059321 | Ga0075364_100593212 | 201 |
| 493 | 3300006946 | Ga0079104_1008565 | Ga0079104_10085654 | 201 |
| 494 | 3300009011 | Ga0105251_10051193 | Ga0105251_100511933 | 201 |
| 495 | 3300009092 | Ga0105250_10002414 | Ga0105250_100024143 | 201 |
| 496 | 3300012498 | Ga0157345_1000194 | Ga0157345_10001943 | 201 |
| 497 | 3300013100 | Ga0157373_10019827 | Ga0157373_100198273 | 201 |
| 498 | 3300013105 | Ga0157369_10044474 | Ga0157369_100444743 | 201 |
| 499 | 3300013306 | Ga0163162_10002804 | Ga0163162_100028044 | 201 |
| 500 | 3300025711 | Ga0207696_1007657 | Ga0207696_10076573 | 201 |
| 501 | 3300025728 | Ga0207655_1003749 | Ga0207655_10037497 | 201 |
| 502 | 3300027111 | Ga0209281_1005200 | Ga0209281_10052004 | 201 |
| 503 | 3300028379 | Ga0268266_10009678 | Ga0268266_100096783 | 201 |
| 504 | 3300028379 | Ga0268266_10491758 | Ga0268266_104917582 | 201 |
| 505 | 3300030521 | Ga0307511_10178818 | Ga0307511_101788182 | 201 |
| 506 | 3300031548 | Ga0307408_100015286 | Ga0307408_1000152863 | 201 |
| 507 | 3300031730 | Ga0307516_10279748 | Ga0307516_102797482 | 201 |
| 508 | 3300041407 | Ga0439447_002724 | Ga0439447_002724_2634_3257 | 201 |
| 509 | 3300041411 | Ga0439466_0003125 | Ga0439466_0003125_4716_5339 | 201 |
| 510 | 3300042006 | Ga0439432_006292 | Ga0439432_006292_2344_2967 | 201 |
| 511 | 3300042009 | Ga0439451_008342 | Ga0439451_008342_1345_1968 | 201 |
| 512 | 3300042010 | Ga0439452_002777 | Ga0439452_002777_2665_3288 | 201 |
| 513 | 3300042013 | Ga0439456_018724 | Ga0439456_018724_340_963 | 201 |
| 514 | 3300042115 | Ga0450911_006357 | Ga0450911_006357_403_1026 | 201 |
| 515 | 3300042124 | Ga0450922_000710 | Ga0450922_000710_510_1133 | 201 |
| 516 | 3300042876 | Ga0451577_0008682 | Ga0451577_0008682_4127_4750 | 201 |
| 517 | 3300046452 | Ga0495617_009953 | Ga0495617_009953_505_1128 | 201 |
| 518 | 3300046452 | Ga0495617_023051 | Ga0495617_023051_1158_1781 | 201 |
| 519 | 3300046453 | Ga0495627_006900 | Ga0495627_006900_1418_2041 | 201 |
| 520 | 3300046453 | Ga0495627_007786 | Ga0495627_007786_2157_2780 | 201 |
| 521 | 3300046458 | Ga0495591_003686 | Ga0495591_003686_2790_3413 | 201 |
| 522 | 3300046458 | Ga0495591_006925 | Ga0495591_006925_2195_2818 | 201 |
| 523 | 3300046458 | Ga0495591_008069 | Ga0495591_008069_2388_3011 | 201 |
| 524 | 3300046458 | Ga0495591_016704 | Ga0495591_016704_574_1197 | 201 |
| 525 | 3300046471 | Ga0495650_0036723 | Ga0495650_0036723_1318_1941 | 201 |
| 526 | 3300046474 | Ga0495605_0000246 | Ga0495605_0000246_56590_57213 | 201 |
| 527 | 3300046474 | Ga0495605_0017666 | Ga0495605_0017666_2217_2840 | 201 |
| 528 | 3300046492 | Ga0495585_0022903 | Ga0495585_0022903_1030_1653 | 201 |
| 529 | 3300046492 | Ga0495585_0024731 | Ga0495585_0024731_431_1054 | 201 |
| 530 | 3300046492 | Ga0495585_0045014 | Ga0495585_0045014_574_1197 | 201 |
| 531 | 3300046501 | Ga0495607_0019379 | Ga0495607_0019379_2350_2973 | 201 |
| 532 | 3300046501 | Ga0495607_0026509 | Ga0495607_0026509_998_1621 | 201 |
| 533 | 3300046501 | Ga0495607_0099437 | Ga0495607_0099437_589_1212 | 201 |
| 534 | 3300046501 | Ga0495607_0220649 | Ga0495607_0220649_282_905 | 201 |
| 535 | 3300046506 | Ga0495583_0006014 | Ga0495583_0006014_2599_3222 | 201 |
| 536 | 3300046507 | Ga0495606_0015566 | Ga0495606_0015566_2451_3074 | 201 |
| 537 | 3300046512 | Ga0495610_0070094 | Ga0495610_0070094_61_684 | 201 |
| 538 | 3300046513 | Ga0495616_0013179 | Ga0495616_0013179_2143_2766 | 201 |
| 539 | 3300046513 | Ga0495616_0014761 | Ga0495616_0014761_1376_1999 | 201 |
| 540 | 3300046515 | Ga0495620_0030131 | Ga0495620_0030131_1081_1704 | 201 |
| 541 | 3300046515 | Ga0495620_0040996 | Ga0495620_0040996_1350_1973 | 201 |
| 542 | 3300046518 | Ga0495631_0011255 | Ga0495631_0011255_2479_3102 | 201 |
| 543 | 3300046518 | Ga0495631_0111845 | Ga0495631_0111845_384_1007 | 201 |
| 544 | 3300046519 | Ga0495632_0025338 | Ga0495632_0025338_460_1083 | 201 |
| 545 | 3300046519 | Ga0495632_0036327 | Ga0495632_0036327_1319_1942 | 201 |
| 546 | 3300046519 | Ga0495632_0043373 | Ga0495632_0043373_1463_2086 | 201 |
| 547 | 3300046519 | Ga0495632_0059736 | Ga0495632_0059736_667_1290 | 201 |
| 548 | 3300046520 | Ga0495637_0072051 | Ga0495637_0072051_408_1031 | 201 |
| 549 | 3300046522 | Ga0495643_0103848 | Ga0495643_0103848_411_1034 | 201 |
| 550 | 3300046522 | Ga0495643_0126711 | Ga0495643_0126711_446_1069 | 201 |
| 551 | 3300046524 | Ga0495648_0021594 | Ga0495648_0021594_1864_2487 | 201 |
| 552 | 3300046524 | Ga0495648_0024384 | Ga0495648_0024384_2126_2749 | 201 |
| 553 | 3300046524 | Ga0495648_0057171 | Ga0495648_0057171_1436_2059 | 201 |
| 554 | 3300046530 | Ga0495654_0003045 | Ga0495654_0003045_4329_4952 | 201 |
| 555 | 3300046530 | Ga0495654_0029096 | Ga0495654_0029096_2051_2674 | 201 |
| 556 | 3300046538 | Ga0495609_0022292 | Ga0495609_0022292_480_1103 | 201 |
| 557 | 3300046538 | Ga0495609_0055815 | Ga0495609_0055815_589_1212 | 201 |
| 558 | 3300046542 | Ga0495597_0011428 | Ga0495597_0011428_2355_2978 | 201 |
| 559 | 3300046557 | Ga0495622_0002682 | Ga0495622_0002682_5518_6141 | 201 |
| 560 | 3300046557 | Ga0495622_0029016 | Ga0495622_0029016_1777_2400 | 201 |
| 561 | 3300046558 | Ga0495633_0020328 | Ga0495633_0020328_1297_1920 | 201 |
| 562 | 3300046648 | Ga0495611_0066627 | Ga0495611_0066627_545_1168 | 201 |
| 563 | 3300046660 | Ga0495625_0023066 | Ga0495625_0023066_2090_2713 | 201 |
| 564 | 3300046660 | Ga0495625_0144835 | Ga0495625_0144835_545_1168 | 201 |
| 565 | 3300046660 | Ga0495625_0250628 | Ga0495625_0250628_206_829 | 201 |
| 566 | 3300046692 | Ga0495671_0017004 | Ga0495671_0017004_1286_1909 | 201 |
| 567 | 3300046692 | Ga0495671_0029482 | Ga0495671_0029482_497_1120 | 201 |
| 568 | 3300046694 | Ga0495649_0022218 | Ga0495649_0022218_911_1534 | 201 |
| 569 | 3300046810 | Ga0495660_0012624 | Ga0495660_0012624_1909_2532 | 201 |
| 570 | 3300046810 | Ga0495660_0015977 | Ga0495660_0015977_2375_2998 | 201 |
| 571 | 3300046810 | Ga0495660_0017774 | Ga0495660_0017774_2356_2979 | 201 |
| 572 | 3300046810 | Ga0495660_0031969 | Ga0495660_0031969_410_1033 | 201 |
| 573 | 3300047321 | Ga0495676_0033772 | Ga0495676_0033772_2394_3017 | 201 |
| 574 | 3300047323 | Ga0495683_0035437 | Ga0495683_0035437_1285_1908 | 201 |
| 575 | 3300047446 | Ga0495679_009753 | Ga0495679_009753_1915_2538 | 201 |
| 576 | 3300047469 | Ga0495673_0002133 | Ga0495673_0002133_4924_5547 | 201 |
| 577 | 3300047469 | Ga0495673_0011310 | Ga0495673_0011310_1731_2354 | 201 |
| 578 | 3300047469 | Ga0495673_0017535 | Ga0495673_0017535_1346_1969 | 201 |
| 579 | 3300047470 | Ga0495681_0070145 | Ga0495681_0070145_312_935 | 201 |
| 580 | 3300047470 | Ga0495681_0115384 | Ga0495681_0115384_24_647 | 201 |
| 581 | 3300048091 | Ga0495626_0009181 | Ga0495626_0009181_2521_3144 | 201 |
| 582 | 3300048091 | Ga0495626_0011997 | Ga0495626_0011997_1906_2529 | 201 |
| 583 | 3300048091 | Ga0495626_0037587 | Ga0495626_0037587_243_866 | 201 |
| 584 | 3300049459 | Ga0495678_008137 | Ga0495678_008137_2206_2829 | 201 |
| 585 | 3300049459 | Ga0495678_025575 | Ga0495678_025575_394_1017 | 201 |
| 586 | 3300049460 | Ga0495682_0000735 | Ga0495682_0000735_9371_9994 | 201 |
| 587 | 3300049460 | Ga0495682_0007404 | Ga0495682_0007404_1300_1923 | 201 |
| 588 | 3300050491 | nmdc:mga00v17_25493_c1 | nmdc:mga00v17_25493_c1_1293_1916 | 201 |
| 589 | 3300053111 | Ga0500572_004330 | Ga0500572_004330_1393_2016 | 201 |
| 590 | 3300053142 | Ga0500577_0075346 | Ga0500577_0075346_92_715 | 201 |
| 591 | iso_pu_bacteria | 2511231006 | 2511265558 | 201 |
| 592 | iso_pu_bacteria | 2512047018 | 2512325930 | 201 |
| 593 | iso_pu_bacteria | 2582580891 | 2583789829 | 201 |
| 594 | iso_pu_bacteria | 2597489887 | 2597855637 | 201 |
| 595 | iso_pu_bacteria | 2599185185 | 2599485539 | 201 |
| 596 | iso_pu_bacteria | 2599185257 | 2599806668 | 201 |
| 597 | iso_pu_bacteria | 2599185307 | 2599973685 | 201 |
| 598 | iso_pu_bacteria | 2600254931 | 2600364907 | 201 |
| 599 | iso_pu_bacteria | 2600255283 | 2601627212 | 201 |
| 600 | iso_pu_bacteria | 2671180172 | 2671772319 | 201 |
| 601 | iso_pu_bacteria | 2740892503 | 2743735054 | 201 |
| 602 | iso_pu_bacteria | 2984286254 | 2984292011 | 201 |
| 603 | iso_pu_bacteria | 8015687852 | 8015688297 | 201 |
| 604 | iso_pu_bacteria | 8055770955 | 8055771395 | 201 |
| 605 | 3300003781 | Ga0055536_1001506 | Ga0055536_10015066 | 205 |
| 606 | 3300003791 | Ga0055530_10000677 | Ga0055530_100006776 | 205 |
| 607 | 3300003792 | Ga0055540_1001429 | Ga0055540_10014298 | 205 |
| 608 | 3300025292 | Ga0209676_1000032 | Ga0209676_1000032327 | 205 |
| 609 | 3300025298 | Ga0209050_1000025 | Ga0209050_1000025328 | 205 |
| 610 | 3300025303 | Ga0209051_1000299 | Ga0209051_100029916 | 205 |
| 611 | 3300025735 | Ga0207713_1000031 | Ga0207713_100003178 | 205 |
| 612 | 3300041411 | Ga0439466_0002287 | Ga0439466_0002287_2195_2812 | 205 |
| 613 | 3300042013 | Ga0439456_033697 | Ga0439456_033697_331_948 | 205 |
| 614 | 3300042016 | Ga0439463_000725 | Ga0439463_000725_6347_6964 | 205 |
| 615 | 3300042993 | Ga0439440_0001551 | Ga0439440_0001551_1028_1645 | 205 |
| 616 | 3300046453 | Ga0495627_001267 | Ga0495627_001267_6966_7610 | 205 |
| 617 | 3300046518 | Ga0495631_0004118 | Ga0495631_0004118_4700_5344 | 205 |
| 618 | 3300046519 | Ga0495632_0018058 | Ga0495632_0018058_1468_2112 | 205 |
| 619 | 3300046530 | Ga0495654_0002879 | Ga0495654_0002879_3652_4296 | 205 |
| 620 | 3300049571 | Ga0501034_0043398 | Ga0501034_0043398_3775_4431 | 205 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5uvr-assembly1.cif.gz_A | the core region of pilo from the type iv pilus system of pseudomonas aeruginosa | 0.9232 | 110 | 201 |
| 5uvr-assembly1.cif.gz_A | the core region of pilo from the type iv pilus system of pseudomonas aeruginosa | 0.8611 | 110 | 201 |
| 6lad-assembly8.cif.gz_F | crystal structure of amuc_1100 from akkermansia muciniphila | 0.8224 | 116 | 203 |
| 6lad-assembly7.cif.gz_A | crystal structure of amuc_1100 from akkermansia muciniphila | 0.7977 | 116 | 204 |
| 6lad-assembly8.cif.gz_D | crystal structure of amuc_1100 from akkermansia muciniphila | 0.7902 | 116 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2rjzB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B | 0.977 | 108 | 201 | 3.30.70.60 |
| 2rjzB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B | 0.9468 | 108 | 201 | 3.30.70.60 |
| af_I1JQN9_795_861_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.8611 | 111 | 167 | 3.30.70.260 |
| af_Q46832_101_178_3.30.1360.100 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;General secretion pathway protein M, EpsM | 0.8026 | 112 | 197 | 3.30.1360.100 |
| af_P0AG24_623_702_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.7853 | 111 | 170 | 3.30.70.260 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A455U627-F1-model_v4 | Pilus assembly protein PilO | 0.9794 | 113 | 203 |
GO:0043107
GO:0043683 |
| AF-A0A655Q5A6-F1-model_v4 | deleted | 0.9584 | 105 | 203 |
|
| AF-A0A3N5PJI3-F1-model_v4 | Pilus assembly protein PilO | 0.9517 | 103 | 205 |
GO:0043107
GO:0043683 |
| AF-A0A850R049-F1-model_v4 | Type 4a pilus biogenesis protein PilO | 0.9491 | 116 | 204 |
GO:0043107
GO:0043683 |
| AF-A0A7U6KSB1-F1-model_v4 | Type IV pilus assembly protein PilO | 0.9333 | 93 | 205 |
GO:0043107
GO:0043683 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar