F469918

General Info

Members Datasets Scaffolds Average Seq Length
620 326 599 209

Family's Representative Sequence

Representative Sequence 3300026088|Ga0207641_10264401|Ga0207641_102644012
Length 223
Sequence MANILDELKTLDPKQPGNWPWFAKIGAFVIIFILVQVAFFFLLWSDQKDQIEKGQQDVAKQKETFLEKKKLAVNLEAYKQQRAEIEQAFGALLKQLPNKSEMDALLIDINQAGLGRGLAFELFKPATTENLTEFYAELPVNIKVTGNYHDLGAFASDVAKMPRIVLLTDLKLDPPKNNILTMEAVAKTYRYLDEEEVNKQRKAVKDKQAKTQSPGKGVGGVGK

Samples

Sample ID Description Type Environment
1 2511231006 Pseudomonas sp. GM17 Isolate Nodule
2 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
3 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
4 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
5 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
6 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
7 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
8 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
9 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
10 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
11 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
12 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
13 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
14 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
15 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
16 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
17 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
18 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
190 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
193 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
206 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
207 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
208 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
209 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
220 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
221 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
222 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
223 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
224 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
225 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
226 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
227 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
228 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
229 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
230 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
233 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
238 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
239 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
246 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
247 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
248 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
249 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
252 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
253 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
256 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
257 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
261 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
262 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
263 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
266 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
267 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
272 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
273 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
274 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
275 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
278 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
279 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
280 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
281 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
287 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
303 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
304 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
305 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
319 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
320 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
324 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
325 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
326 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.61
Metatranscriptomes 0
Isolates 3.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.68
Nodule 0.48
Rhizoplane 1.94
Rhizosphere 91.45
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1001506 3300003781 Bacteria 13995
2 Ga0055530_10000677 3300003791 Bacteria 28934
3 Ga0055540_1001429 3300003792 Bacteria 14239
4 Ga0065712_10121498 3300005290 Bacteria 1664
5 Ga0065712_10183744 3300005290 Bacteria 1180
6 Ga0070658_10018825 3300005327 Bacteria 5532
7 Ga0070658_10047662 3300005327 Bacteria 3467
8 Ga0070670_100080624 3300005331 Bacteria 2797
9 Ga0068869_100000748 3300005334 Bacteria 18490
10 Ga0068869_100050478 3300005334 Bacteria 3015
11 Ga0070666_10124903 3300005335 Bacteria 1786
12 Ga0070680_100105822 3300005336 Bacteria 2339
13 Ga0070682_100389085 3300005337 Bacteria 1051
14 Ga0068868_100009375 3300005338 Bacteria 7038
15 Ga0068868_100061052 3300005338 Bacteria 2986
16 Ga0068868_100064718 3300005338 Bacteria 2903
17 Ga0068868_100102272 3300005338 Bacteria 2320
18 Ga0068868_100225029 3300005338 Unclassified 1572
19 Ga0070689_100003205 3300005340 Bacteria 10840
20 Ga0070689_100134005 3300005340 Unclassified 1988
21 Ga0070689_100158807 3300005340 Bacteria 1827
22 Ga0070689_100773680 3300005340 Bacteria 843
23 Ga0070661_100423378 3300005344 Bacteria 1056
24 Ga0070668_100259924 3300005347 Unclassified 1443
25 Ga0070669_100227168 3300005353 Bacteria 1478
26 Ga0070675_100001954 3300005354 Bacteria 15249
27 Ga0070675_100024903 3300005354 Bacteria 4796
28 Ga0070675_100165132 3300005354 Bacteria 1907
29 Ga0070675_100343828 3300005354 Bacteria 1322
30 Ga0070674_100438373 3300005356 Bacteria 1076
31 Ga0070673_100021180 3300005364 Bacteria 4706
32 Ga0070673_100153859 3300005364 Bacteria 1950
33 Ga0070688_100002581 3300005365 Bacteria 9178
34 Ga0070667_100378302 3300005367 Unclassified 1286
35 Ga0070713_100081227 3300005436 Bacteria 2766
36 Ga0070713_100110885 3300005436 Bacteria 2392
37 Ga0070710_10339105 3300005437 Bacteria 992
38 Ga0070701_10074909 3300005438 Bacteria 1819
39 Ga0070705_100083703 3300005440 Bacteria 1967
40 Ga0070700_100054632 3300005441 Bacteria 2497
41 Ga0070700_100086658 3300005441 Bacteria 2034
42 Ga0070694_100156717 3300005444 Bacteria 1668
43 Ga0070663_100788790 3300005455 Bacteria 814
44 Ga0070678_100030357 3300005456 Bacteria 3715
45 Ga0070678_100060614 3300005456 Bacteria 2786
46 Ga0070678_100181859 3300005456 Bacteria 1722
47 Ga0070678_100641732 3300005456 Bacteria 952
48 Ga0070662_100133658 3300005457 Bacteria 1916
49 Ga0070662_100241102 3300005457 Bacteria 1450
50 Ga0070662_100403948 3300005457 Bacteria 1128
51 Ga0070681_10023535 3300005458 Bacteria 6195
52 Ga0068867_100079695 3300005459 Bacteria 2465
53 Ga0068867_100156291 3300005459 Bacteria 1795
54 Ga0068867_100195499 3300005459 Bacteria 1616
55 Ga0068867_100203848 3300005459 Bacteria 1585
56 Ga0068867_100905986 3300005459 Unclassified 794
57 Ga0070685_10046258 3300005466 Bacteria 2497
58 Ga0070707_100183209 3300005468 Bacteria 2042
59 Ga0070698_100133675 3300005471 Bacteria 2435
60 Ga0070699_100038599 3300005518 Bacteria 4136
61 Ga0070679_100147255 3300005530 Bacteria 2332
62 Ga0070684_100130649 3300005535 Bacteria 2265
63 Ga0070684_100233947 3300005535 Bacteria 1678
64 Ga0070684_100750652 3300005535 Bacteria 911
65 Ga0070672_100013680 3300005543 Bacteria 5737
66 Ga0070672_100293917 3300005543 Unclassified 1376
67 Ga0070686_100608833 3300005544 Bacteria 862
68 Ga0070695_100048036 3300005545 Bacteria 2728
69 Ga0070695_100751344 3300005545 Bacteria 778
70 Ga0070696_100006717 3300005546 Bacteria 7685
71 Ga0070696_100067991 3300005546 Bacteria 2501
72 Ga0070693_100000368 3300005547 Bacteria 20458
73 Ga0070693_100003051 3300005547 Bacteria 7771
74 Ga0070665_100010415 3300005548 Bacteria 9409
75 Ga0070665_100025910 3300005548 Bacteria 5906
76 Ga0070665_100071014 3300005548 Bacteria 3488
77 Ga0070665_100192718 3300005548 Bacteria 2039
78 Ga0070704_100070641 3300005549 Bacteria 2534
79 Ga0068855_100017306 3300005563 Bacteria 8674
80 Ga0068855_100022973 3300005563 Bacteria 7473
81 Ga0068855_100173405 3300005563 Bacteria 2441
82 Ga0068855_100213949 3300005563 Bacteria 2165
83 Ga0070664_100253413 3300005564 Bacteria 1583
84 Ga0068857_100264144 3300005577 Bacteria 1580
85 Ga0068854_100209752 3300005578 Bacteria 1536
86 Ga0068856_100272777 3300005614 Bacteria 1708
87 Ga0068856_100991302 3300005614 Bacteria 859
88 Ga0070702_100051058 3300005615 Unclassified 2366
89 Ga0070702_100053287 3300005615 Bacteria 2323
90 Ga0070702_100055395 3300005615 Bacteria 2286
91 Ga0070702_100454781 3300005615 Bacteria 930
92 Ga0068852_100000366 3300005616 Bacteria 30499
93 Ga0068852_100103446 3300005616 Bacteria 2576
94 Ga0068852_100813735 3300005616 Bacteria 949
95 Ga0068859_100004039 3300005617 Bacteria 14959
96 Ga0068859_100007911 3300005617 Bacteria 10782
97 Ga0068859_100076204 3300005617 Bacteria 3394
98 Ga0068859_100197600 3300005617 Bacteria 2096
99 Ga0068859_100809926 3300005617 Bacteria 1024
100 Ga0068864_100063600 3300005618 Bacteria 3198
101 Ga0068864_100144941 3300005618 Bacteria 2146
102 Ga0068864_100279462 3300005618 Bacteria 1558
103 Ga0068866_10129195 3300005718 Bacteria 1435
104 Ga0068861_100186404 3300005719 Bacteria 1731
105 Ga0068861_100853522 3300005719 Bacteria 859
106 Ga0068851_10000790 3300005834 Bacteria 13643
107 Ga0068851_10221534 3300005834 Bacteria 1063
108 Ga0068870_10042233 3300005840 Bacteria 2373
109 Ga0068863_100043046 3300005841 Bacteria 4287
110 Ga0068858_100035268 3300005842 Bacteria 4640
111 Ga0068858_100039504 3300005842 Bacteria 4375
112 Ga0068858_100047646 3300005842 Bacteria 3972
113 Ga0068858_100048936 3300005842 Bacteria 3915
114 Ga0068860_100162207 3300005843 Bacteria 2156
115 Ga0068862_100075876 3300005844 Bacteria 2909
116 Ga0075364_10059321 3300006051 Bacteria 2508
117 Ga0075364_10122032 3300006051 Bacteria 1745
118 Ga0070715_10073701 3300006163 Bacteria 1532
119 Ga0075367_10093583 3300006178 Bacteria 1831
120 Ga0075369_10019351 3300006186 Bacteria 2779
121 Ga0075366_10002257 3300006195 Bacteria 9841
122 Ga0075366_10012324 3300006195 Bacteria 4847
123 Ga0075366_10033772 3300006195 Bacteria 3014
124 Ga0075366_10177839 3300006195 Bacteria 1292
125 Ga0075366_10314614 3300006195 Bacteria 959
126 Ga0075366_10488711 3300006195 Bacteria 761
127 Ga0097621_100004700 3300006237 Bacteria 9541
128 Ga0097621_100009334 3300006237 Bacteria 7121
129 Ga0097621_100041446 3300006237 Bacteria 3706
130 Ga0097621_100062721 3300006237 Bacteria 3052
131 Ga0097621_100127834 3300006237 Bacteria 2160
132 Ga0068871_100008124 3300006358 Bacteria 7534
133 Ga0068871_100020732 3300006358 Bacteria 5040
134 Ga0068871_100070285 3300006358 Bacteria 2877
135 Ga0068871_100094461 3300006358 Bacteria 2496
136 Ga0068871_100395653 3300006358 Bacteria 1230
137 Ga0068871_100740789 3300006358 Unclassified 903
138 Ga0075428_100015492 3300006844 Bacteria 8452
139 Ga0075430_100088646 3300006846 Unclassified 2589
140 Ga0075430_100140515 3300006846 Bacteria 2011
141 Ga0075431_100125345 3300006847 Bacteria 2650
142 Ga0075433_10019638 3300006852 Bacteria 5634
143 Ga0075434_100089747 3300006871 Bacteria 3074
144 Ga0075429_100073830 3300006880 Bacteria 2971
145 Ga0068865_100084160 3300006881 Bacteria 2291
146 Ga0068865_100138594 3300006881 Bacteria 1832
147 Ga0068865_100153406 3300006881 Bacteria 1750
148 Ga0068865_100257626 3300006881 Bacteria 1380
149 Ga0068865_100358344 3300006881 Unclassified 1183
150 Ga0075436_100014310 3300006914 Bacteria 5431
151 Ga0097620_100004039 3300006931 Bacteria 14959
152 Ga0097620_100007911 3300006931 Bacteria 10782
153 Ga0097620_100076205 3300006931 Bacteria 3394
154 Ga0097620_100197589 3300006931 Bacteria 2096
155 Ga0097620_100809985 3300006931 Bacteria 1024
156 Ga0079104_1008565 3300006946 Bacteria 3562
157 Ga0075435_100125535 3300007076 Bacteria 2144
158 Ga0105251_10051193 3300009011 Bacteria 1970
159 Ga0105250_10002414 3300009092 Bacteria 9392
160 Ga0105240_10364679 3300009093 Bacteria 1635
161 Ga0105240_10382709 3300009093 Bacteria 1589
162 Ga0105240_10676482 3300009093 Bacteria 1129
163 Ga0111539_10002062 3300009094 Bacteria 26871
164 Ga0105245_10053171 3300009098 Bacteria 3635
165 Ga0105245_10084737 3300009098 Bacteria 2904
166 Ga0105245_10085718 3300009098 Bacteria 2888
167 Ga0105245_10104933 3300009098 Bacteria 2621
168 Ga0105245_10135683 3300009098 Bacteria 2312
169 Ga0105245_10137992 3300009098 Bacteria 2294
170 Ga0105247_10120285 3300009101 Unclassified 1701
171 Ga0114129_10435422 3300009147 Bacteria 1722
172 Ga0105243_10048529 3300009148 Bacteria 3347
173 Ga0105243_10093042 3300009148 Bacteria 2487
174 Ga0105243_10228760 3300009148 Bacteria 1648
175 Ga0105243_10979324 3300009148 Bacteria 847
176 Ga0105242_10001487 3300009176 Bacteria 18449
177 Ga0105242_10014314 3300009176 Bacteria 6143
178 Ga0105242_10042298 3300009176 Bacteria 3678
179 Ga0105242_10127404 3300009176 Bacteria 2193
180 Ga0105242_10132571 3300009176 Bacteria 2153
181 Ga0105248_10001876 3300009177 Bacteria 23307
182 Ga0105248_10114213 3300009177 Bacteria 3046
183 Ga0105248_10190892 3300009177 Bacteria 2308
184 Ga0105237_10391936 3300009545 Bacteria 1394
185 Ga0105238_10074407 3300009551 Bacteria 3389
186 Ga0105238_10112099 3300009551 Bacteria 2707
187 Ga0105238_10141518 3300009551 Bacteria 2382
188 Ga0105238_10149115 3300009551 Bacteria 2315
189 Ga0105238_10195945 3300009551 Unclassified 1996
190 Ga0105238_10204719 3300009551 Bacteria 1949
191 Ga0105238_10292074 3300009551 Bacteria 1612
192 Ga0105238_11025986 3300009551 Bacteria 846
193 Ga0105249_10145137 3300009553 Bacteria 2279
194 Ga0105249_10746751 3300009553 Bacteria 1040
195 Ga0105239_10061863 3300010375 Bacteria 4109
196 Ga0105239_10644656 3300010375 Bacteria 1210
197 Ga0105246_10007889 3300011119 Bacteria 6532
198 Ga0105246_10183374 3300011119 Bacteria 1614
199 Ga0105246_10844406 3300011119 Bacteria 816
200 Ga0157345_1000194 3300012498 Bacteria 9488
201 Ga0157373_10019827 3300013100 Bacteria 4892
202 Ga0157373_10686500 3300013100 Bacteria 749
203 Ga0157371_10430589 3300013102 Bacteria 968
204 Ga0157371_10522058 3300013102 Bacteria 878
205 Ga0157370_10011951 3300013104 Bacteria 9048
206 Ga0157370_10124971 3300013104 Bacteria 2402
207 Ga0157369_10037649 3300013105 Bacteria 5295
208 Ga0157369_10044474 3300013105 Bacteria 4832
209 Ga0157374_10015902 3300013296 Bacteria 6610
210 Ga0157374_10030276 3300013296 Bacteria 4912
211 Ga0157374_10050116 3300013296 Bacteria 3880
212 Ga0157374_10060773 3300013296 Bacteria 3537
213 Ga0157378_10018493 3300013297 Bacteria 6123
214 Ga0157378_10095065 3300013297 Bacteria 2714
215 Ga0157378_10242822 3300013297 Bacteria 1721
216 Ga0157378_10256832 3300013297 Unclassified 1675
217 Ga0157378_10278624 3300013297 Bacteria 1611
218 Ga0157378_10380558 3300013297 Bacteria 1386
219 Ga0163162_10002804 3300013306 Bacteria 16571
220 Ga0163162_10058308 3300013306 Bacteria 3889
221 Ga0163162_10133771 3300013306 Bacteria 2590
222 Ga0163162_10295323 3300013306 Bacteria 1752
223 Ga0163162_10488180 3300013306 Bacteria 1363
224 Ga0163162_10772593 3300013306 Unclassified 1079
225 Ga0163162_10831106 3300013306 Bacteria 1040
226 Ga0157372_10000909 3300013307 Bacteria 32178
227 Ga0157372_10264021 3300013307 Bacteria 1999
228 Ga0157372_10598009 3300013307 Bacteria 1286
229 Ga0157372_10736483 3300013307 Bacteria 1146
230 Ga0157375_10058583 3300013308 Bacteria 3811
231 Ga0157375_10113624 3300013308 Bacteria 2809
232 Ga0157375_10286877 3300013308 Bacteria 1809
233 Ga0157380_10036400 3300014326 Bacteria 3807
234 Ga0157379_10230385 3300014968 Bacteria 1679
235 Ga0157379_10281304 3300014968 Bacteria 1514
236 Ga0157376_10054333 3300014969 Bacteria 3338
237 Ga0157376_10085497 3300014969 Bacteria 2718
238 Ga0157376_10204675 3300014969 Bacteria 1818
239 Ga0157376_10281784 3300014969 Bacteria 1566
240 Ga0163161_10180101 3300017792 Bacteria 1620
241 Ga0213876_10101142 3300021384 Bacteria 1528
242 Ga0209676_1000032 3300025292 Bacteria 469558
243 Ga0209050_1000025 3300025298 Bacteria 528225
244 Ga0209051_1000299 3300025303 Bacteria 78310
245 Ga0207656_10000272 3300025321 Bacteria 17950
246 Ga0207696_1007657 3300025711 Bacteria 4208
247 Ga0207655_1003749 3300025728 Bacteria 11145
248 Ga0207713_1000031 3300025735 Bacteria 283971
249 Ga0207682_10085069 3300025893 Bacteria 1362
250 Ga0207642_10058614 3300025899 Bacteria 1777
251 Ga0207710_10095965 3300025900 Bacteria 1394
252 Ga0207688_10117280 3300025901 Bacteria 1551
253 Ga0207688_10123119 3300025901 Bacteria 1515
254 Ga0207688_10304058 3300025901 Bacteria 976
255 Ga0207643_10153571 3300025908 Unclassified 1382
256 Ga0207705_10011261 3300025909 Bacteria 6482
257 Ga0207705_10023458 3300025909 Bacteria 4401
258 Ga0207705_10055013 3300025909 Bacteria 2869
259 Ga0207705_10062816 3300025909 Bacteria 2683
260 Ga0207695_10085416 3300025913 Bacteria 3184
261 Ga0207695_10113330 3300025913 Bacteria 2688
262 Ga0207693_10526647 3300025915 Bacteria 922
263 Ga0207662_10043025 3300025918 Bacteria 2664
264 Ga0207662_10096977 3300025918 Bacteria 1822
265 Ga0207652_10697777 3300025921 Bacteria 906
266 Ga0207646_10152282 3300025922 Bacteria 2085
267 Ga0207681_10224809 3300025923 Bacteria 1454
268 Ga0207681_10309006 3300025923 Bacteria 1253
269 Ga0207694_10180853 3300025924 Bacteria 1710
270 Ga0207694_10310805 3300025924 Bacteria 1299
271 Ga0207694_10390878 3300025924 Bacteria 1156
272 Ga0207650_10329978 3300025925 Bacteria 1251
273 Ga0207650_10562056 3300025925 Unclassified 957
274 Ga0207659_10004053 3300025926 Bacteria 8840
275 Ga0207659_10038347 3300025926 Bacteria 3332
276 Ga0207659_10104903 3300025926 Bacteria 2138
277 Ga0207659_10236877 3300025926 Bacteria 1475
278 Ga0207687_10009127 3300025927 Bacteria 6485
279 Ga0207687_10137327 3300025927 Bacteria 1850
280 Ga0207687_10154086 3300025927 Bacteria 1756
281 Ga0207687_10212570 3300025927 Bacteria 1518
282 Ga0207700_10315514 3300025928 Bacteria 1353
283 Ga0207664_10110460 3300025929 Bacteria 2286
284 Ga0207664_10140235 3300025929 Bacteria 2044
285 Ga0207644_10271591 3300025931 Bacteria 1359
286 Ga0207690_10076662 3300025932 Bacteria 2322
287 Ga0207706_10639163 3300025933 Unclassified 912
288 Ga0207686_10001762 3300025934 Bacteria 12037
289 Ga0207686_10033409 3300025934 Bacteria 3071
290 Ga0207709_10099620 3300025935 Bacteria 1918
291 Ga0207709_10099886 3300025935 Bacteria 1916
292 Ga0207670_10001574 3300025936 Bacteria 11941
293 Ga0207670_10029654 3300025936 Bacteria 3487
294 Ga0207670_10065432 3300025936 Bacteria 2494
295 Ga0207670_10660338 3300025936 Bacteria 863
296 Ga0207669_10049861 3300025937 Bacteria 2499
297 Ga0207669_10092600 3300025937 Bacteria 1972
298 Ga0207669_10174476 3300025937 Bacteria 1534
299 Ga0207669_10325050 3300025937 Bacteria 1179
300 Ga0207704_10037943 3300025938 Bacteria 2788
301 Ga0207704_10045688 3300025938 Bacteria 2604
302 Ga0207704_10127198 3300025938 Bacteria 1757
303 Ga0207704_10223674 3300025938 Bacteria 1394
304 Ga0207691_10004014 3300025940 Bacteria 14270
305 Ga0207691_10230037 3300025940 Unclassified 1606
306 Ga0207711_10013651 3300025941 Bacteria 6746
307 Ga0207711_10014208 3300025941 Bacteria 6612
308 Ga0207711_10173671 3300025941 Bacteria 1957
309 Ga0207689_10002992 3300025942 Bacteria 15584
310 Ga0207689_10034201 3300025942 Bacteria 4221
311 Ga0207689_10063888 3300025942 Bacteria 3028
312 Ga0207679_10247627 3300025945 Bacteria 1513
313 Ga0207679_10346811 3300025945 Bacteria 1293
314 Ga0207667_10019136 3300025949 Bacteria 7657
315 Ga0207667_10026953 3300025949 Bacteria 6269
316 Ga0207667_10061418 3300025949 Bacteria 3931
317 Ga0207651_10059979 3300025960 Bacteria 2638
318 Ga0207651_10145165 3300025960 Bacteria 1839
319 Ga0207651_10164869 3300025960 Unclassified 1741
320 Ga0207651_10265629 3300025960 Bacteria 1411
321 Ga0207651_10322846 3300025960 Bacteria 1291
322 Ga0207712_10292302 3300025961 Bacteria 1334
323 Ga0207668_10545490 3300025972 Bacteria 1004
324 Ga0207640_10204963 3300025981 Bacteria 1498
325 Ga0207640_10210564 3300025981 Bacteria 1481
326 Ga0207640_10926876 3300025981 Bacteria 762
327 Ga0207658_10228603 3300025986 Bacteria 1569
328 Ga0207677_10005410 3300026023 Bacteria 6931
329 Ga0207677_10072632 3300026023 Bacteria 2433
330 Ga0207677_10200293 3300026023 Bacteria 1586
331 Ga0207677_10352437 3300026023 Bacteria 1234
332 Ga0207677_10356873 3300026023 Bacteria 1227
333 Ga0207677_10439304 3300026023 Unclassified 1115
334 Ga0207677_10444426 3300026023 Bacteria 1110
335 Ga0207703_10003555 3300026035 Bacteria 13026
336 Ga0207703_10040646 3300026035 Bacteria 3722
337 Ga0207703_10042255 3300026035 Bacteria 3656
338 Ga0207708_10089711 3300026075 Bacteria 2369
339 Ga0207708_10108470 3300026075 Bacteria 2153
340 Ga0207708_10279147 3300026075 Bacteria 1353
341 Ga0207702_10239380 3300026078 Bacteria 1700
342 Ga0207702_10618485 3300026078 Bacteria 1064
343 Ga0207641_10041880 3300026088 Bacteria 3840
344 Ga0207641_10264401 3300026088 Bacteria 1612
345 Ga0207648_10050473 3300026089 Bacteria 3638
346 Ga0207648_10107633 3300026089 Bacteria 2447
347 Ga0207648_10189543 3300026089 Bacteria 1822
348 Ga0207648_10195558 3300026089 Bacteria 1793
349 Ga0207648_10295235 3300026089 Bacteria 1452
350 Ga0207648_10792990 3300026089 Unclassified 881
351 Ga0207676_10106239 3300026095 Bacteria 2339
352 Ga0207676_10110209 3300026095 Unclassified 2302
353 Ga0207676_10262826 3300026095 Bacteria 1559
354 Ga0207674_10023170 3300026116 Bacteria 6656
355 Ga0207675_100091197 3300026118 Bacteria 2865
356 Ga0207675_100349350 3300026118 Bacteria 1449
357 Ga0207675_100773782 3300026118 Bacteria 972
358 Ga0207683_10027436 3300026121 Bacteria 4921
359 Ga0207683_10042013 3300026121 Bacteria 3993
360 Ga0207683_10095692 3300026121 Bacteria 2648
361 Ga0207683_10292397 3300026121 Bacteria 1490
362 Ga0207698_10001079 3300026142 Bacteria 15860
363 Ga0207698_10124081 3300026142 Bacteria 2192
364 Ga0207698_10206724 3300026142 Bacteria 1763
365 Ga0207698_10354992 3300026142 Bacteria 1386
366 Ga0207698_10759624 3300026142 Bacteria 969
367 Ga0209281_1005200 3300027111 Bacteria 3671
368 Ga0207428_10002330 3300027907 Bacteria 19019
369 Ga0268266_10009678 3300028379 Bacteria 8471
370 Ga0268266_10031462 3300028379 Bacteria 4506
371 Ga0268266_10055827 3300028379 Bacteria 3396
372 Ga0268266_10491758 3300028379 Bacteria 1170
373 Ga0268265_10053174 3300028380 Bacteria 3067
374 Ga0268265_10607307 3300028380 Unclassified 1046
375 Ga0268264_10266856 3300028381 Bacteria 1597
376 Ga0265336_10000272 3300028666 Bacteria 36231
377 Ga0265338_10027334 3300028800 Bacteria 5727
378 Ga0265324_10000004 3300029957 Bacteria 356972
379 Ga0265324_10001557 3300029957 Bacteria 12848
380 Ga0307511_10178818 3300030521 Bacteria 1148
381 Ga0265325_10000187 3300031241 Bacteria 44205
382 Ga0265331_10011735 3300031250 Bacteria 4787
383 Ga0265327_10000065 3300031251 Bacteria 225004
384 Ga0265327_10044502 3300031251 Bacteria 2366
385 Ga0307408_100015286 3300031548 Bacteria 5109
386 Ga0307408_100083553 3300031548 Bacteria 2393
387 Ga0307408_100093273 3300031548 Bacteria 2277
388 Ga0307408_100212556 3300031548 Bacteria 1573
389 Ga0316575_10028575 3300031665 Bacteria 2174
390 Ga0265314_10003992 3300031711 Bacteria 13952
391 Ga0265314_10049794 3300031711 Bacteria 2930
392 Ga0265314_10062866 3300031711 Bacteria 2521
393 Ga0265342_10160232 3300031712 Bacteria 1244
394 Ga0307516_10279748 3300031730 Bacteria 1351
395 Ga0307410_10222817 3300031852 Bacteria 1452
396 Ga0307406_10140396 3300031901 Bacteria 1709
397 Ga0307407_10245506 3300031903 Bacteria 1224
398 Ga0307412_10411390 3300031911 Bacteria 1104
399 Ga0307412_10478187 3300031911 Bacteria 1032
400 Ga0307416_100227685 3300032002 Bacteria 1794
401 Ga0307416_100406787 3300032002 Bacteria 1400
402 Ga0307416_100434887 3300032002 Bacteria 1360
403 Ga0307416_101103739 3300032002 Bacteria 898
404 Ga0307415_100169750 3300032126 Bacteria 1700
405 Ga0307415_100180462 3300032126 Bacteria 1656
406 Ga0373930_0005353 3300034816 Bacteria 2131
407 Ga0373952_0000434 3300035092 Bacteria 7231
408 Ga0373932_0116666 3300035112 Bacteria 886
409 Ga0373960_0004088 3300035121 Bacteria 3336
410 Ga0316574_0006680 3300035398 Bacteria 6261
411 Ga0316574_0024290 3300035398 Bacteria 3626
412 Ga0373931_0057022 3300035691 Bacteria 2094
413 Ga0373931_0057252 3300035691 Bacteria 2090
414 Ga0373935_0309308 3300035692 Bacteria 1119
415 Ga0373927_0304382 3300035695 Bacteria 1049
416 Ga0373933_0421627 3300035724 Bacteria 872
417 Ga0373937_0057081 3300036401 Bacteria 3586
418 Ga0373937_0095962 3300036401 Bacteria 2749
419 Ga0373925_0028973 3300037068 Bacteria 4059
420 Ga0395900_0047854 3300037418 Bacteria 4405
421 Ga0395905_0014429 3300037471 Bacteria 7543
422 Ga0395901_0058360 3300038443 Bacteria 4014
423 Ga0439447_002724 3300041407 Bacteria 6384
424 Ga0439466_0002287 3300041411 Bacteria 7518
425 Ga0439466_0003125 3300041411 Bacteria 6442
426 Ga0451789_0116223 3300041443 Bacteria 736
427 Ga0451847_0252797 3300041503 Bacteria 902
428 Ga0439441_005763 3300042001 Bacteria 1938
429 Ga0439432_006292 3300042006 Bacteria 4246
430 Ga0439451_001417 3300042009 Bacteria 4742
431 Ga0439451_008342 3300042009 Bacteria 2101
432 Ga0439452_002777 3300042010 Bacteria 6326
433 Ga0439456_018724 3300042013 Bacteria 1454
434 Ga0439456_033697 3300042013 Bacteria 1102
435 Ga0439463_000725 3300042016 Bacteria 9106
436 Ga0450911_006357 3300042115 Bacteria 1766
437 Ga0450922_000710 3300042124 Bacteria 3443
438 Ga0451577_0000002 3300042876 Bacteria 1731375
439 Ga0451577_0000375 3300042876 Bacteria 83271
440 Ga0451577_0008682 3300042876 Bacteria 9864
441 Ga0451577_0017659 3300042876 Bacteria 6587
442 Ga0451577_0068618 3300042876 Bacteria 3162
443 Ga0439440_0001551 3300042993 Bacteria 4206
444 Ga0453683_0000013 3300044673 Bacteria 371932
445 Ga0453683_0028559 3300044673 Bacteria 3531
446 Ga0453683_0091361 3300044673 Bacteria 1908
447 Ga0453683_0407530 3300044673 Bacteria 877
448 Ga0453684_0000002 3300044712 Bacteria 1731375
449 Ga0453684_0000040 3300044712 Bacteria 690210
450 Ga0453684_0011349 3300044712 Bacteria 14968
451 Ga0453684_0472856 3300044712 Bacteria 1392
452 Ga0466957_0009448 3300044842 Bacteria 5568
453 Ga0451576_0000006 3300045051 Bacteria 949698
454 Ga0451576_0000037 3300045051 Bacteria 372173
455 Ga0451576_0000677 3300045051 Bacteria 69349
456 Ga0451576_0001321 3300045051 Bacteria 42891
457 Ga0451576_0005709 3300045051 Bacteria 15522
458 Ga0451576_0172783 3300045051 Bacteria 2255
459 Ga0466958_0004234 3300045836 Bacteria 7545
460 Ga0495617_009953 3300046452 Bacteria 3259
461 Ga0495617_023051 3300046452 Bacteria 2103
462 Ga0495627_001267 3300046453 Bacteria 15562
463 Ga0495627_006900 3300046453 Bacteria 4411
464 Ga0495627_007786 3300046453 Bacteria 4078
465 Ga0495592_0029379 3300046454 Bacteria 4163
466 Ga0495603_0314840 3300046455 Bacteria 899
467 Ga0495591_003686 3300046458 Bacteria 7783
468 Ga0495591_006925 3300046458 Bacteria 4906
469 Ga0495591_008069 3300046458 Bacteria 4360
470 Ga0495591_016704 3300046458 Bacteria 2543
471 Ga0495651_0219583 3300046462 Bacteria 1316
472 Ga0495650_0036723 3300046471 Bacteria 2140
473 Ga0495605_0000246 3300046474 Bacteria 64351
474 Ga0495605_0017666 3300046474 Bacteria 3836
475 Ga0495584_0151018 3300046491 Bacteria 1180
476 Ga0495585_0022903 3300046492 Bacteria 3585
477 Ga0495585_0024731 3300046492 Bacteria 3442
478 Ga0495585_0045014 3300046492 Bacteria 2464
479 Ga0495607_0019379 3300046501 Bacteria 4323
480 Ga0495607_0026509 3300046501 Bacteria 3595
481 Ga0495607_0099437 3300046501 Bacteria 1560
482 Ga0495607_0220649 3300046501 Bacteria 927
483 Ga0495583_0006014 3300046506 Bacteria 8040
484 Ga0495606_0015566 3300046507 Bacteria 5851
485 Ga0495610_0070094 3300046512 Bacteria 1638
486 Ga0495616_0013179 3300046513 Bacteria 4671
487 Ga0495616_0014761 3300046513 Bacteria 4360
488 Ga0495620_0030131 3300046515 Bacteria 2502
489 Ga0495620_0040996 3300046515 Bacteria 2033
490 Ga0495628_0130662 3300046516 Bacteria 1921
491 Ga0495631_0004118 3300046518 Bacteria 7804
492 Ga0495631_0011255 3300046518 Bacteria 4403
493 Ga0495631_0111845 3300046518 Bacteria 1174
494 Ga0495632_0018058 3300046519 Bacteria 3878
495 Ga0495632_0025338 3300046519 Bacteria 3138
496 Ga0495632_0036327 3300046519 Bacteria 2506
497 Ga0495632_0043373 3300046519 Bacteria 2248
498 Ga0495632_0059736 3300046519 Bacteria 1854
499 Ga0495637_0072051 3300046520 Bacteria 1392
500 Ga0495643_0103848 3300046522 Bacteria 1453
501 Ga0495643_0126711 3300046522 Bacteria 1285
502 Ga0495648_0021594 3300046524 Bacteria 4453
503 Ga0495648_0024384 3300046524 Bacteria 4121
504 Ga0495648_0057171 3300046524 Bacteria 2342
505 Ga0495654_0002879 3300046530 Bacteria 10801
506 Ga0495654_0003045 3300046530 Bacteria 10439
507 Ga0495654_0029096 3300046530 Bacteria 2819
508 Ga0495609_0022292 3300046538 Bacteria 2917
509 Ga0495609_0055815 3300046538 Bacteria 1751
510 Ga0495621_0002325 3300046539 Bacteria 5101
511 Ga0495621_0002906 3300046539 Bacteria 4665
512 Ga0495597_0011428 3300046542 Bacteria 4304
513 Ga0495597_0171808 3300046542 Bacteria 879
514 Ga0495645_0024212 3300046543 Bacteria 4404
515 Ga0495622_0002682 3300046557 Bacteria 8538
516 Ga0495622_0029016 3300046557 Bacteria 2585
517 Ga0495633_0020328 3300046558 Bacteria 3340
518 Ga0495633_0195663 3300046558 Bacteria 929
519 Ga0495611_0066627 3300046648 Bacteria 1642
520 Ga0495625_0023066 3300046660 Bacteria 4758
521 Ga0495625_0144835 3300046660 Bacteria 1600
522 Ga0495625_0250628 3300046660 Bacteria 1149
523 Ga0495635_0113486 3300046663 Bacteria 1850
524 Ga0495657_0179292 3300046675 Bacteria 1301
525 Ga0495599_0011329 3300046678 Bacteria 5476
526 Ga0495623_0004175 3300046679 Bacteria 9519
527 Ga0495671_0017004 3300046692 Bacteria 3874
528 Ga0495671_0029482 3300046692 Bacteria 2817
529 Ga0495649_0022218 3300046694 Bacteria 3549
530 Ga0495660_0012624 3300046810 Bacteria 4902
531 Ga0495660_0015977 3300046810 Bacteria 4330
532 Ga0495660_0017774 3300046810 Bacteria 4090
533 Ga0495660_0031969 3300046810 Bacteria 2956
534 Ga0495676_0033772 3300047321 Bacteria 4300
535 Ga0495683_0035437 3300047323 Bacteria 2536
536 Ga0495679_009753 3300047446 Bacteria 3818
537 Ga0495673_0002133 3300047469 Bacteria 14363
538 Ga0495673_0011310 3300047469 Bacteria 4810
539 Ga0495673_0017535 3300047469 Bacteria 3630
540 Ga0495681_0070145 3300047470 Bacteria 1590
541 Ga0495681_0115384 3300047470 Bacteria 1158
542 Ga0495626_0009181 3300048091 Bacteria 5355
543 Ga0495626_0011997 3300048091 Bacteria 4559
544 Ga0495626_0037587 3300048091 Bacteria 2299
545 Ga0496104_0010248 3300048907 Bacteria 8370
546 Ga0496105_0154774 3300048908 Bacteria 1883
547 Ga0496106_0080916 3300048909 Bacteria 2495
548 Ga0496110_0018671 3300048913 Bacteria 5819
549 Ga0495678_008137 3300049459 Bacteria 5338
550 Ga0495678_025575 3300049459 Bacteria 2533
551 Ga0495682_0000735 3300049460 Bacteria 21204
552 Ga0495682_0007404 3300049460 Bacteria 4366
553 Ga0501034_0043398 3300049571 Bacteria 4551
554 Ga0501034_0388269 3300049571 Bacteria 1320
555 Ga0501039_0135356 3300049575 Bacteria 1935
556 Ga0501047_0162547 3300049581 Bacteria 2104
557 Ga0501047_0238350 3300049581 Bacteria 1670
558 Ga0501047_0566615 3300049581 Bacteria 959
559 Ga0501068_0035505 3300049584 Bacteria 2976
560 Ga0501069_0032607 3300049585 Bacteria 2867
561 Ga0501070_0000922 3300049586 Bacteria 26611
562 Ga0501070_0263274 3300049586 Bacteria 1409
563 Ga0501072_0037580 3300049588 Bacteria 3798
564 Ga0501073_0000119 3300049589 Bacteria 50663
565 Ga0501074_0000634 3300049590 Bacteria 21786
566 Ga0501079_0091236 3300049741 Bacteria 2360
567 Ga0501080_0002188 3300049742 Bacteria 16986
568 Ga0501080_0012490 3300049742 Bacteria 7788
569 Ga0501083_0000505 3300049744 Bacteria 24911
570 Ga0501035_0367854 3300049822 Bacteria 1200
571 Ga0501044_0166923 3300049823 Bacteria 2175
572 nmdc:mga00v17_16420_c1 3300050491 Bacteria 4173
573 nmdc:mga00v17_25493_c1 3300050491 Bacteria 3437
574 nmdc:mga0k408_140965_c1 3300050493 Bacteria 1434
575 nmdc:mga0k408_19041_c1 3300050493 Bacteria 3833
576 nmdc:mga0k408_2758_c1 3300050493 Bacteria 9333
577 nmdc:mga0k408_7584_c1 3300050493 Bacteria 5793
578 nmdc:mga0k408_79122_c1 3300050493 Bacteria 1924
579 nmdc:mga06z11_29157_c1 3300050494 Bacteria 2018
580 nmdc:mga07m45_108633_c1 3300050496 Bacteria 1596
581 nmdc:mga09592_61239_c1 3300050508 Bacteria 3183
582 nmdc:mga0qj67_81873_c1 3300050509 Unclassified 2588
583 nmdc:mga06r32_828022_c1 3300050510 Bacteria 885
584 nmdc:mga08y16_1048_c1 3300050511 Bacteria 27140
585 nmdc:mga0n895_235536_c1 3300050512 Bacteria 1858
586 nmdc:mga0rr50_218471_c1 3300050513 Bacteria 1573
587 nmdc:mga08x19_412_c1 3300050514 Bacteria 29897
588 nmdc:mga0a205_19355_c1 3300050515 Bacteria 6416
589 nmdc:mga0sz30_28335_c1 3300050516 Bacteria 2305
590 Ga0495601_0001143 3300053077 Bacteria 14531
591 Ga0495601_0478151 3300053077 Bacteria 805
592 Ga0495595_0018832 3300053084 Bacteria 2988
593 Ga0495619_0006435 3300053085 Bacteria 7440
594 Ga0500641_0014934 3300053096 Bacteria 2873
595 Ga0500572_004330 3300053111 Bacteria 3222
596 Ga0500577_0075346 3300053142 Bacteria 1333
597 Ga0501084_0054513 3300054114 Bacteria 3345
598 Ga0501082_0023922 3300060353 Bacteria 5268
599 Ga0466962_0213743 3300061719 Bacteria 943

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0135356 Ga0501039_0135356_747_1382 146
2 3300044673 Ga0453683_0407530 Ga0453683_0407530_32_565 161
3 3300046542 Ga0495597_0171808 Ga0495597_0171808_19_555 172
4 3300006195 Ga0075366_10177839 Ga0075366_101778392 176
5 3300050493 nmdc:mga0k408_19041_c1 nmdc:mga0k408_19041_c1_3135_3779 176
6 3300042009 Ga0439451_001417 Ga0439451_001417_4162_4719 179
7 3300006846 Ga0075430_100088646 Ga0075430_1000886462 182
8 3300025933 Ga0207706_10639163 Ga0207706_106391632 182
9 3300050509 nmdc:mga0qj67_81873_c1 nmdc:mga0qj67_81873_c1_512_1156 182
10 3300050510 nmdc:mga06r32_828022_c1 nmdc:mga06r32_828022_c1_185_829 182
11 3300005331 Ga0070670_100080624 Ga0070670_1000806242 184
12 3300005334 Ga0068869_100000748 Ga0068869_10000074811 184
13 3300005338 Ga0068868_100225029 Ga0068868_1002250291 184
14 3300005340 Ga0070689_100134005 Ga0070689_1001340053 184
15 3300005347 Ga0070668_100259924 Ga0070668_1002599242 184
16 3300005354 Ga0070675_100024903 Ga0070675_1000249034 184
17 3300005367 Ga0070667_100378302 Ga0070667_1003783021 184
18 3300005456 Ga0070678_100060614 Ga0070678_1000606142 184
19 3300005459 Ga0068867_100156291 Ga0068867_1001562912 184
20 3300005459 Ga0068867_100905986 Ga0068867_1009059861 184
21 3300005543 Ga0070672_100293917 Ga0070672_1002939172 184
22 3300005548 Ga0070665_100010415 Ga0070665_1000104156 184
23 3300005615 Ga0070702_100051058 Ga0070702_1000510583 184
24 3300005617 Ga0068859_100004039 Ga0068859_1000040398 184
25 3300005618 Ga0068864_100063600 Ga0068864_1000636003 184
26 3300005719 Ga0068861_100186404 Ga0068861_1001864043 184
27 3300005841 Ga0068863_100043046 Ga0068863_1000430463 184
28 3300005842 Ga0068858_100039504 Ga0068858_1000395043 184
29 3300005844 Ga0068862_100075876 Ga0068862_1000758763 184
30 3300006237 Ga0097621_100041446 Ga0097621_1000414463 184
31 3300006358 Ga0068871_100740789 Ga0068871_1007407892 184
32 3300006881 Ga0068865_100358344 Ga0068865_1003583442 184
33 3300006931 Ga0097620_100004039 Ga0097620_1000040398 184
34 3300009098 Ga0105245_10104933 Ga0105245_101049332 184
35 3300009101 Ga0105247_10120285 Ga0105247_101202852 184
36 3300009148 Ga0105243_10979324 Ga0105243_109793241 184
37 3300009176 Ga0105242_10042298 Ga0105242_100422983 184
38 3300009177 Ga0105248_10001876 Ga0105248_100018766 184
39 3300009551 Ga0105238_10195945 Ga0105238_101959452 184
40 3300010375 Ga0105239_10061863 Ga0105239_100618633 184
41 3300011119 Ga0105246_10007889 Ga0105246_100078895 184
42 3300013296 Ga0157374_10015902 Ga0157374_100159022 184
43 3300013297 Ga0157378_10256832 Ga0157378_102568322 184
44 3300013306 Ga0163162_10772593 Ga0163162_107725932 184
45 3300013306 Ga0163162_10831106 Ga0163162_108311062 184
46 3300013308 Ga0157375_10058583 Ga0157375_100585832 184
47 3300014969 Ga0157376_10054333 Ga0157376_100543331 184
48 3300025900 Ga0207710_10095965 Ga0207710_100959652 184
49 3300025908 Ga0207643_10153571 Ga0207643_101535712 184
50 3300025925 Ga0207650_10562056 Ga0207650_105620562 184
51 3300025926 Ga0207659_10038347 Ga0207659_100383473 184
52 3300025936 Ga0207670_10029654 Ga0207670_100296543 184
53 3300025937 Ga0207669_10049861 Ga0207669_100498613 184
54 3300025938 Ga0207704_10045688 Ga0207704_100456883 184
55 3300025940 Ga0207691_10230037 Ga0207691_102300373 184
56 3300025941 Ga0207711_10014208 Ga0207711_100142084 184
57 3300025942 Ga0207689_10002992 Ga0207689_100029925 184
58 3300025960 Ga0207651_10164869 Ga0207651_101648692 184
59 3300025972 Ga0207668_10545490 Ga0207668_105454902 184
60 3300025986 Ga0207658_10228603 Ga0207658_102286032 184
61 3300026023 Ga0207677_10439304 Ga0207677_104393041 184
62 3300026035 Ga0207703_10040646 Ga0207703_100406462 184
63 3300026088 Ga0207641_10041880 Ga0207641_100418803 184
64 3300026089 Ga0207648_10050473 Ga0207648_100504733 184
65 3300026089 Ga0207648_10792990 Ga0207648_107929902 184
66 3300026095 Ga0207676_10110209 Ga0207676_101102092 184
67 3300026118 Ga0207675_100091197 Ga0207675_1000911973 184
68 3300026121 Ga0207683_10027436 Ga0207683_100274363 184
69 3300028379 Ga0268266_10055827 Ga0268266_100558272 184
70 3300028380 Ga0268265_10053174 Ga0268265_100531743 184
71 3300035692 Ga0373935_0309308 Ga0373935_0309308_103_744 184
72 3300053077 Ga0495601_0478151 Ga0495601_0478151_96_737 184
73 3300005840 Ga0068870_10042233 Ga0068870_100422333 186
74 3300049741 Ga0501079_0091236 Ga0501079_0091236_1611_2231 188
75 3300006846 Ga0075430_100140515 Ga0075430_1001405153 189
76 3300006847 Ga0075431_100125345 Ga0075431_1001253453 189
77 3300035092 Ga0373952_0000434 Ga0373952_0000434_750_1370 189
78 3300035121 Ga0373960_0004088 Ga0373960_0004088_1542_2162 189
79 3300005327 Ga0070658_10018825 Ga0070658_100188253 190
80 3300005338 Ga0068868_100061052 Ga0068868_1000610523 190
81 3300005340 Ga0070689_100773680 Ga0070689_1007736801 190
82 3300005353 Ga0070669_100227168 Ga0070669_1002271682 190
83 3300005354 Ga0070675_100343828 Ga0070675_1003438282 190
84 3300005364 Ga0070673_100021180 Ga0070673_1000211803 190
85 3300005456 Ga0070678_100030357 Ga0070678_1000303573 190
86 3300005457 Ga0070662_100241102 Ga0070662_1002411021 190
87 3300005457 Ga0070662_100403948 Ga0070662_1004039482 190
88 3300005459 Ga0068867_100195499 Ga0068867_1001954991 190
89 3300005544 Ga0070686_100608833 Ga0070686_1006088331 190
90 3300005564 Ga0070664_100253413 Ga0070664_1002534132 190
91 3300005718 Ga0068866_10129195 Ga0068866_101291952 190
92 3300005842 Ga0068858_100035268 Ga0068858_1000352683 190
93 3300006881 Ga0068865_100084160 Ga0068865_1000841603 190
94 3300009148 Ga0105243_10228760 Ga0105243_102287602 190
95 3300009176 Ga0105242_10001487 Ga0105242_100014873 190
96 3300009177 Ga0105248_10190892 Ga0105248_101908923 190
97 3300011119 Ga0105246_10844406 Ga0105246_108444061 190
98 3300013102 Ga0157371_10430589 Ga0157371_104305892 190
99 3300013297 Ga0157378_10278624 Ga0157378_102786242 190
100 3300013306 Ga0163162_10133771 Ga0163162_101337713 190
101 3300013307 Ga0157372_10264021 Ga0157372_102640212 190
102 3300014326 Ga0157380_10036400 Ga0157380_100364003 190
103 3300014968 Ga0157379_10281304 Ga0157379_102813043 190
104 3300025901 Ga0207688_10304058 Ga0207688_103040582 190
105 3300025909 Ga0207705_10011261 Ga0207705_100112613 190
106 3300025923 Ga0207681_10224809 Ga0207681_102248092 190
107 3300025926 Ga0207659_10236877 Ga0207659_102368772 190
108 3300025934 Ga0207686_10033409 Ga0207686_100334093 190
109 3300025936 Ga0207670_10660338 Ga0207670_106603382 190
110 3300025937 Ga0207669_10092600 Ga0207669_100926003 190
111 3300025937 Ga0207669_10174476 Ga0207669_101744762 190
112 3300025938 Ga0207704_10037943 Ga0207704_100379433 190
113 3300025941 Ga0207711_10173671 Ga0207711_101736713 190
114 3300025945 Ga0207679_10247627 Ga0207679_102476272 190
115 3300026023 Ga0207677_10072632 Ga0207677_100726323 190
116 3300026035 Ga0207703_10003555 Ga0207703_100035556 190
117 3300026075 Ga0207708_10108470 Ga0207708_101084702 190
118 3300026089 Ga0207648_10189543 Ga0207648_101895431 190
119 3300026089 Ga0207648_10295235 Ga0207648_102952352 190
120 3300026121 Ga0207683_10042013 Ga0207683_100420133 190
121 3300026142 Ga0207698_10354992 Ga0207698_103549922 190
122 3300034816 Ga0373930_0005353 Ga0373930_0005353_530_1177 190
123 3300035112 Ga0373932_0116666 Ga0373932_0116666_10_657 190
124 3300035691 Ga0373931_0057252 Ga0373931_0057252_888_1535 190
125 3300050493 nmdc:mga0k408_140965_c1 nmdc:mga0k408_140965_c1_749_1390 191
126 3300005335 Ga0070666_10124903 Ga0070666_101249032 192
127 3300005338 Ga0068868_100102272 Ga0068868_1001022722 192
128 3300005440 Ga0070705_100083703 Ga0070705_1000837032 192
129 3300005441 Ga0070700_100054632 Ga0070700_1000546322 192
130 3300005456 Ga0070678_100181859 Ga0070678_1001818592 192
131 3300005457 Ga0070662_100133658 Ga0070662_1001336583 192
132 3300005459 Ga0068867_100079695 Ga0068867_1000796953 192
133 3300005468 Ga0070707_100183209 Ga0070707_1001832092 192
134 3300005518 Ga0070699_100038599 Ga0070699_1000385993 192
135 3300005535 Ga0070684_100233947 Ga0070684_1002339472 192
136 3300005546 Ga0070696_100006717 Ga0070696_1000067173 192
137 3300005548 Ga0070665_100025910 Ga0070665_1000259106 192
138 3300005563 Ga0068855_100173405 Ga0068855_1001734052 192
139 3300005615 Ga0070702_100055395 Ga0070702_1000553953 192
140 3300005617 Ga0068859_100809926 Ga0068859_1008099262 192
141 3300005834 Ga0068851_10221534 Ga0068851_102215342 192
142 3300006195 Ga0075366_10002257 Ga0075366_100022576 192
143 3300006358 Ga0068871_100395653 Ga0068871_1003956532 192
144 3300006852 Ga0075433_10019638 Ga0075433_100196385 192
145 3300006881 Ga0068865_100257626 Ga0068865_1002576261 192
146 3300006931 Ga0097620_100809985 Ga0097620_1008099852 192
147 3300009093 Ga0105240_10382709 Ga0105240_103827092 192
148 3300009098 Ga0105245_10084737 Ga0105245_100847373 192
149 3300009098 Ga0105245_10135683 Ga0105245_101356833 192
150 3300009098 Ga0105245_10137992 Ga0105245_101379922 192
151 3300009147 Ga0114129_10435422 Ga0114129_104354222 192
152 3300009551 Ga0105238_10074407 Ga0105238_100744073 192
153 3300013102 Ga0157371_10522058 Ga0157371_105220582 192
154 3300013105 Ga0157369_10037649 Ga0157369_100376493 192
155 3300013296 Ga0157374_10050116 Ga0157374_100501163 192
156 3300013306 Ga0163162_10295323 Ga0163162_102953231 192
157 3300013307 Ga0157372_10000909 Ga0157372_1000090917 192
158 3300013308 Ga0157375_10113624 Ga0157375_101136242 192
159 3300025899 Ga0207642_10058614 Ga0207642_100586143 192
160 3300025901 Ga0207688_10123119 Ga0207688_101231192 192
161 3300025909 Ga0207705_10023458 Ga0207705_100234584 192
162 3300025913 Ga0207695_10085416 Ga0207695_100854162 192
163 3300025927 Ga0207687_10154086 Ga0207687_101540863 192
164 3300025927 Ga0207687_10212570 Ga0207687_102125702 192
165 3300025929 Ga0207664_10140235 Ga0207664_101402352 192
166 3300025932 Ga0207690_10076662 Ga0207690_100766622 192
167 3300025938 Ga0207704_10223674 Ga0207704_102236742 192
168 3300025949 Ga0207667_10061418 Ga0207667_100614183 192
169 3300025981 Ga0207640_10210564 Ga0207640_102105641 192
170 3300026023 Ga0207677_10352437 Ga0207677_103524372 192
171 3300026075 Ga0207708_10279147 Ga0207708_102791472 192
172 3300026089 Ga0207648_10195558 Ga0207648_101955582 192
173 3300026121 Ga0207683_10095692 Ga0207683_100956923 192
174 3300028380 Ga0268265_10607307 Ga0268265_106073072 192
175 3300035398 Ga0316574_0006680 Ga0316574_0006680_1100_1708 192
176 3300035398 Ga0316574_0024290 Ga0316574_0024290_2550_3158 192
177 3300048909 Ga0496106_0080916 Ga0496106_0080916_1463_2107 192
178 3300050515 nmdc:mga0a205_19355_c1 nmdc:mga0a205_19355_c1_1618_2262 192
179 iso_pu_bacteria 2923153595 2923154048 192
180 3300005290 Ga0065712_10183744 Ga0065712_101837441 193
181 3300005334 Ga0068869_100050478 Ga0068869_1000504783 193
182 3300005337 Ga0070682_100389085 Ga0070682_1003890852 193
183 3300005338 Ga0068868_100009375 Ga0068868_1000093755 193
184 3300005338 Ga0068868_100064718 Ga0068868_1000647184 193
185 3300005340 Ga0070689_100003205 Ga0070689_1000032053 193
186 3300005340 Ga0070689_100158807 Ga0070689_1001588072 193
187 3300005344 Ga0070661_100423378 Ga0070661_1004233782 193
188 3300005354 Ga0070675_100001954 Ga0070675_10000195414 193
189 3300005356 Ga0070674_100438373 Ga0070674_1004383732 193
190 3300005364 Ga0070673_100153859 Ga0070673_1001538593 193
191 3300005365 Ga0070688_100002581 Ga0070688_1000025813 193
192 3300005441 Ga0070700_100086658 Ga0070700_1000866582 193
193 3300005444 Ga0070694_100156717 Ga0070694_1001567173 193
194 3300005455 Ga0070663_100788790 Ga0070663_1007887901 193
195 3300005466 Ga0070685_10046258 Ga0070685_100462583 193
196 3300005535 Ga0070684_100750652 Ga0070684_1007506522 193
197 3300005543 Ga0070672_100013680 Ga0070672_1000136806 193
198 3300005545 Ga0070695_100048036 Ga0070695_1000480363 193
199 3300005545 Ga0070695_100751344 Ga0070695_1007513441 193
200 3300005546 Ga0070696_100067991 Ga0070696_1000679912 193
201 3300005547 Ga0070693_100000368 Ga0070693_10000036816 193
202 3300005547 Ga0070693_100003051 Ga0070693_1000030518 193
203 3300005563 Ga0068855_100017306 Ga0068855_1000173064 193
204 3300005577 Ga0068857_100264144 Ga0068857_1002641442 193
205 3300005578 Ga0068854_100209752 Ga0068854_1002097523 193
206 3300005614 Ga0068856_100991302 Ga0068856_1009913022 193
207 3300005615 Ga0070702_100053287 Ga0070702_1000532873 193
208 3300005616 Ga0068852_100000366 Ga0068852_10000036618 193
209 3300005616 Ga0068852_100103446 Ga0068852_1001034463 193
210 3300005616 Ga0068852_100813735 Ga0068852_1008137352 193
211 3300005617 Ga0068859_100007911 Ga0068859_1000079111 193
212 3300005617 Ga0068859_100076204 Ga0068859_1000762043 193
213 3300005617 Ga0068859_100197600 Ga0068859_1001976003 193
214 3300005618 Ga0068864_100279462 Ga0068864_1002794622 193
215 3300005719 Ga0068861_100853522 Ga0068861_1008535222 193
216 3300005834 Ga0068851_10000790 Ga0068851_100007906 193
217 3300005842 Ga0068858_100048936 Ga0068858_1000489363 193
218 3300005843 Ga0068860_100162207 Ga0068860_1001622073 193
219 3300006163 Ga0070715_10073701 Ga0070715_100737012 193
220 3300006178 Ga0075367_10093583 Ga0075367_100935833 193
221 3300006195 Ga0075366_10012324 Ga0075366_100123243 193
222 3300006237 Ga0097621_100004700 Ga0097621_1000047007 193
223 3300006237 Ga0097621_100009334 Ga0097621_1000093343 193
224 3300006237 Ga0097621_100062721 Ga0097621_1000627213 193
225 3300006358 Ga0068871_100008124 Ga0068871_1000081247 193
226 3300006358 Ga0068871_100020732 Ga0068871_1000207323 193
227 3300006358 Ga0068871_100070285 Ga0068871_1000702853 193
228 3300006844 Ga0075428_100015492 Ga0075428_1000154923 193
229 3300006871 Ga0075434_100089747 Ga0075434_1000897474 193
230 3300006880 Ga0075429_100073830 Ga0075429_1000738302 193
231 3300006881 Ga0068865_100138594 Ga0068865_1001385943 193
232 3300006881 Ga0068865_100153406 Ga0068865_1001534062 193
233 3300006914 Ga0075436_100014310 Ga0075436_1000143103 193
234 3300006931 Ga0097620_100007911 Ga0097620_1000079111 193
235 3300006931 Ga0097620_100076205 Ga0097620_1000762053 193
236 3300006931 Ga0097620_100197589 Ga0097620_1001975893 193
237 3300007076 Ga0075435_100125535 Ga0075435_1001255352 193
238 3300009093 Ga0105240_10676482 Ga0105240_106764822 193
239 3300009094 Ga0111539_10002062 Ga0111539_1000206217 193
240 3300009098 Ga0105245_10053171 Ga0105245_100531713 193
241 3300009098 Ga0105245_10085718 Ga0105245_100857183 193
242 3300009148 Ga0105243_10048529 Ga0105243_100485293 193
243 3300009176 Ga0105242_10014314 Ga0105242_100143143 193
244 3300009177 Ga0105248_10114213 Ga0105248_101142133 193
245 3300009551 Ga0105238_10112099 Ga0105238_101120993 193
246 3300009551 Ga0105238_10204719 Ga0105238_102047192 193
247 3300009551 Ga0105238_10292074 Ga0105238_102920743 193
248 3300010375 Ga0105239_10644656 Ga0105239_106446562 193
249 3300013104 Ga0157370_10124971 Ga0157370_101249713 193
250 3300013296 Ga0157374_10030276 Ga0157374_100302763 193
251 3300013296 Ga0157374_10060773 Ga0157374_100607733 193
252 3300013297 Ga0157378_10095065 Ga0157378_100950653 193
253 3300013297 Ga0157378_10242822 Ga0157378_102428221 193
254 3300013297 Ga0157378_10380558 Ga0157378_103805582 193
255 3300013306 Ga0163162_10488180 Ga0163162_104881802 193
256 3300013307 Ga0157372_10598009 Ga0157372_105980092 193
257 3300013307 Ga0157372_10736483 Ga0157372_107364832 193
258 3300013308 Ga0157375_10286877 Ga0157375_102868773 193
259 3300014968 Ga0157379_10230385 Ga0157379_102303852 193
260 3300014969 Ga0157376_10085497 Ga0157376_100854973 193
261 3300014969 Ga0157376_10204675 Ga0157376_102046752 193
262 3300017792 Ga0163161_10180101 Ga0163161_101801013 193
263 3300025321 Ga0207656_10000272 Ga0207656_1000027212 193
264 3300025893 Ga0207682_10085069 Ga0207682_100850692 193
265 3300025901 Ga0207688_10117280 Ga0207688_101172802 193
266 3300025909 Ga0207705_10062816 Ga0207705_100628163 193
267 3300025918 Ga0207662_10043025 Ga0207662_100430253 193
268 3300025921 Ga0207652_10697777 Ga0207652_106977772 193
269 3300025922 Ga0207646_10152282 Ga0207646_101522822 193
270 3300025923 Ga0207681_10309006 Ga0207681_103090062 193
271 3300025924 Ga0207694_10180853 Ga0207694_101808532 193
272 3300025924 Ga0207694_10310805 Ga0207694_103108052 193
273 3300025924 Ga0207694_10390878 Ga0207694_103908782 193
274 3300025925 Ga0207650_10329978 Ga0207650_103299781 193
275 3300025926 Ga0207659_10004053 Ga0207659_100040536 193
276 3300025927 Ga0207687_10009127 Ga0207687_100091272 193
277 3300025927 Ga0207687_10137327 Ga0207687_101373273 193
278 3300025929 Ga0207664_10110460 Ga0207664_101104603 193
279 3300025934 Ga0207686_10001762 Ga0207686_100017624 193
280 3300025935 Ga0207709_10099620 Ga0207709_100996202 193
281 3300025936 Ga0207670_10001574 Ga0207670_100015746 193
282 3300025936 Ga0207670_10065432 Ga0207670_100654322 193
283 3300025938 Ga0207704_10127198 Ga0207704_101271982 193
284 3300025940 Ga0207691_10004014 Ga0207691_1000401411 193
285 3300025942 Ga0207689_10034201 Ga0207689_100342014 193
286 3300025942 Ga0207689_10063888 Ga0207689_100638883 193
287 3300025945 Ga0207679_10346811 Ga0207679_103468112 193
288 3300025949 Ga0207667_10026953 Ga0207667_100269534 193
289 3300025960 Ga0207651_10059979 Ga0207651_100599793 193
290 3300025960 Ga0207651_10265629 Ga0207651_102656292 193
291 3300025961 Ga0207712_10292302 Ga0207712_102923022 193
292 3300025981 Ga0207640_10204963 Ga0207640_102049632 193
293 3300026023 Ga0207677_10005410 Ga0207677_100054105 193
294 3300026023 Ga0207677_10200293 Ga0207677_102002932 193
295 3300026023 Ga0207677_10356873 Ga0207677_103568732 193
296 3300026023 Ga0207677_10444426 Ga0207677_104444262 193
297 3300026075 Ga0207708_10089711 Ga0207708_100897112 193
298 3300026078 Ga0207702_10618485 Ga0207702_106184852 193
299 3300026088 Ga0207641_10264401 Ga0207641_102644012 193
300 3300026089 Ga0207648_10107633 Ga0207648_101076332 193
301 3300026095 Ga0207676_10262826 Ga0207676_102628262 193
302 3300026116 Ga0207674_10023170 Ga0207674_100231706 193
303 3300026118 Ga0207675_100773782 Ga0207675_1007737821 193
304 3300026142 Ga0207698_10001079 Ga0207698_100010795 193
305 3300026142 Ga0207698_10124081 Ga0207698_101240813 193
306 3300026142 Ga0207698_10759624 Ga0207698_107596242 193
307 3300027907 Ga0207428_10002330 Ga0207428_1000233017 193
308 3300028381 Ga0268264_10266856 Ga0268264_102668563 193
309 3300031251 Ga0265327_10044502 Ga0265327_100445022 193
310 3300031548 Ga0307408_100083553 Ga0307408_1000835532 193
311 3300031548 Ga0307408_100212556 Ga0307408_1002125562 193
312 3300031711 Ga0265314_10049794 Ga0265314_100497942 193
313 3300031711 Ga0265314_10062866 Ga0265314_100628663 193
314 3300031712 Ga0265342_10160232 Ga0265342_101602322 193
315 3300031911 Ga0307412_10411390 Ga0307412_104113901 193
316 3300032002 Ga0307416_100434887 Ga0307416_1004348872 193
317 3300035724 Ga0373933_0421627 Ga0373933_0421627_193_828 193
318 3300036401 Ga0373937_0095962 Ga0373937_0095962_1036_1671 193
319 3300037418 Ga0395900_0047854 Ga0395900_0047854_948_1586 193
320 3300037471 Ga0395905_0014429 Ga0395905_0014429_2781_3419 193
321 3300038443 Ga0395901_0058360 Ga0395901_0058360_2836_3474 193
322 3300041443 Ga0451789_0116223 Ga0451789_0116223_81_722 193
323 3300041503 Ga0451847_0252797 Ga0451847_0252797_133_780 193
324 3300044673 Ga0453683_0028559 Ga0453683_0028559_663_1283 193
325 3300044842 Ga0466957_0009448 Ga0466957_0009448_284_919 193
326 3300045051 Ga0451576_0000006 Ga0451576_0000006_446469_447089 193
327 3300045836 Ga0466958_0004234 Ga0466958_0004234_3870_4505 193
328 3300046454 Ga0495592_0029379 Ga0495592_0029379_1292_1927 193
329 3300046462 Ga0495651_0219583 Ga0495651_0219583_509_1144 193
330 3300046516 Ga0495628_0130662 Ga0495628_0130662_780_1415 193
331 3300046539 Ga0495621_0002325 Ga0495621_0002325_543_1196 193
332 3300046543 Ga0495645_0024212 Ga0495645_0024212_3009_3644 193
333 3300046663 Ga0495635_0113486 Ga0495635_0113486_968_1603 193
334 3300046675 Ga0495657_0179292 Ga0495657_0179292_148_783 193
335 3300046678 Ga0495599_0011329 Ga0495599_0011329_4020_4655 193
336 3300046679 Ga0495623_0004175 Ga0495623_0004175_5629_6264 193
337 3300048907 Ga0496104_0010248 Ga0496104_0010248_1353_1997 193
338 3300048908 Ga0496105_0154774 Ga0496105_0154774_333_977 193
339 3300048913 Ga0496110_0018671 Ga0496110_0018671_2002_2646 193
340 3300050493 nmdc:mga0k408_79122_c1 nmdc:mga0k408_79122_c1_151_789 193
341 3300050494 nmdc:mga06z11_29157_c1 nmdc:mga06z11_29157_c1_1140_1778 193
342 3300050508 nmdc:mga09592_61239_c1 nmdc:mga09592_61239_c1_2062_2706 193
343 3300050511 nmdc:mga08y16_1048_c1 nmdc:mga08y16_1048_c1_4981_5625 193
344 3300050512 nmdc:mga0n895_235536_c1 nmdc:mga0n895_235536_c1_434_1099 193
345 3300050513 nmdc:mga0rr50_218471_c1 nmdc:mga0rr50_218471_c1_851_1516 193
346 3300050514 nmdc:mga08x19_412_c1 nmdc:mga08x19_412_c1_4314_4979 193
347 3300053077 Ga0495601_0001143 Ga0495601_0001143_5248_5883 193
348 3300053084 Ga0495595_0018832 Ga0495595_0018832_1233_1868 193
349 3300053085 Ga0495619_0006435 Ga0495619_0006435_3206_3841 193
350 3300061719 Ga0466962_0213743 Ga0466962_0213743_31_666 193
351 3300005290 Ga0065712_10121498 Ga0065712_101214983 194
352 3300005327 Ga0070658_10047662 Ga0070658_100476623 194
353 3300005336 Ga0070680_100105822 Ga0070680_1001058223 194
354 3300005354 Ga0070675_100165132 Ga0070675_1001651322 194
355 3300005436 Ga0070713_100081227 Ga0070713_1000812272 194
356 3300005436 Ga0070713_100110885 Ga0070713_1001108853 194
357 3300005437 Ga0070710_10339105 Ga0070710_103391051 194
358 3300005438 Ga0070701_10074909 Ga0070701_100749093 194
359 3300005456 Ga0070678_100641732 Ga0070678_1006417322 194
360 3300005458 Ga0070681_10023535 Ga0070681_100235356 194
361 3300005459 Ga0068867_100203848 Ga0068867_1002038482 194
362 3300005471 Ga0070698_100133675 Ga0070698_1001336751 194
363 3300005530 Ga0070679_100147255 Ga0070679_1001472553 194
364 3300005535 Ga0070684_100130649 Ga0070684_1001306492 194
365 3300005548 Ga0070665_100192718 Ga0070665_1001927183 194
366 3300005549 Ga0070704_100070641 Ga0070704_1000706413 194
367 3300005563 Ga0068855_100213949 Ga0068855_1002139492 194
368 3300005614 Ga0068856_100272777 Ga0068856_1002727773 194
369 3300005615 Ga0070702_100454781 Ga0070702_1004547811 194
370 3300005618 Ga0068864_100144941 Ga0068864_1001449413 194
371 3300005842 Ga0068858_100047646 Ga0068858_1000476463 194
372 3300006051 Ga0075364_10122032 Ga0075364_101220322 194
373 3300006186 Ga0075369_10019351 Ga0075369_100193513 194
374 3300006195 Ga0075366_10033772 Ga0075366_100337723 194
375 3300006195 Ga0075366_10314614 Ga0075366_103146142 194
376 3300006195 Ga0075366_10488711 Ga0075366_104887111 194
377 3300006237 Ga0097621_100127834 Ga0097621_1001278343 194
378 3300006358 Ga0068871_100094461 Ga0068871_1000944612 194
379 3300009093 Ga0105240_10364679 Ga0105240_103646792 194
380 3300009148 Ga0105243_10093042 Ga0105243_100930423 194
381 3300009176 Ga0105242_10127404 Ga0105242_101274042 194
382 3300009176 Ga0105242_10132571 Ga0105242_101325712 194
383 3300009545 Ga0105237_10391936 Ga0105237_103919362 194
384 3300009551 Ga0105238_10141518 Ga0105238_101415182 194
385 3300009551 Ga0105238_10149115 Ga0105238_101491152 194
386 3300009551 Ga0105238_11025986 Ga0105238_110259861 194
387 3300009553 Ga0105249_10145137 Ga0105249_101451373 194
388 3300009553 Ga0105249_10746751 Ga0105249_107467511 194
389 3300011119 Ga0105246_10183374 Ga0105246_101833743 194
390 3300013100 Ga0157373_10686500 Ga0157373_106865001 194
391 3300013297 Ga0157378_10018493 Ga0157378_100184933 194
392 3300013306 Ga0163162_10058308 Ga0163162_100583083 194
393 3300014969 Ga0157376_10281784 Ga0157376_102817842 194
394 3300021384 Ga0213876_10101142 Ga0213876_101011422 194
395 3300025909 Ga0207705_10055013 Ga0207705_100550133 194
396 3300025913 Ga0207695_10113330 Ga0207695_101133303 194
397 3300025915 Ga0207693_10526647 Ga0207693_105266472 194
398 3300025918 Ga0207662_10096977 Ga0207662_100969773 194
399 3300025926 Ga0207659_10104903 Ga0207659_101049032 194
400 3300025928 Ga0207700_10315514 Ga0207700_103155142 194
401 3300025931 Ga0207644_10271591 Ga0207644_102715912 194
402 3300025935 Ga0207709_10099886 Ga0207709_100998862 194
403 3300025937 Ga0207669_10325050 Ga0207669_103250502 194
404 3300025941 Ga0207711_10013651 Ga0207711_100136513 194
405 3300025960 Ga0207651_10145165 Ga0207651_101451653 194
406 3300025960 Ga0207651_10322846 Ga0207651_103228462 194
407 3300025981 Ga0207640_10926876 Ga0207640_109268761 194
408 3300026035 Ga0207703_10042255 Ga0207703_100422553 194
409 3300026078 Ga0207702_10239380 Ga0207702_102393803 194
410 3300026095 Ga0207676_10106239 Ga0207676_101062392 194
411 3300026118 Ga0207675_100349350 Ga0207675_1003493502 194
412 3300026121 Ga0207683_10292397 Ga0207683_102923972 194
413 3300026142 Ga0207698_10206724 Ga0207698_102067243 194
414 3300028379 Ga0268266_10031462 Ga0268266_100314623 194
415 3300028800 Ga0265338_10027334 Ga0265338_100273342 194
416 3300029957 Ga0265324_10001557 Ga0265324_100015576 194
417 3300031548 Ga0307408_100093273 Ga0307408_1000932733 194
418 3300031711 Ga0265314_10003992 Ga0265314_100039926 194
419 3300031852 Ga0307410_10222817 Ga0307410_102228173 194
420 3300031901 Ga0307406_10140396 Ga0307406_101403962 194
421 3300031903 Ga0307407_10245506 Ga0307407_102455062 194
422 3300031911 Ga0307412_10478187 Ga0307412_104781871 194
423 3300032002 Ga0307416_100227685 Ga0307416_1002276852 194
424 3300032002 Ga0307416_100406787 Ga0307416_1004067871 194
425 3300032002 Ga0307416_101103739 Ga0307416_1011037392 194
426 3300032126 Ga0307415_100169750 Ga0307415_1001697502 194
427 3300032126 Ga0307415_100180462 Ga0307415_1001804622 194
428 3300035691 Ga0373931_0057022 Ga0373931_0057022_438_1091 194
429 3300035695 Ga0373927_0304382 Ga0373927_0304382_183_833 194
430 3300036401 Ga0373937_0057081 Ga0373937_0057081_502_1152 194
431 3300037068 Ga0373925_0028973 Ga0373925_0028973_2060_2710 194
432 3300042001 Ga0439441_005763 Ga0439441_005763_670_1320 194
433 3300042876 Ga0451577_0000002 Ga0451577_0000002_1539905_1540546 194
434 3300042876 Ga0451577_0000375 Ga0451577_0000375_79738_80376 194
435 3300042876 Ga0451577_0017659 Ga0451577_0017659_4214_4852 194
436 3300042876 Ga0451577_0068618 Ga0451577_0068618_1971_2591 194
437 3300044673 Ga0453683_0000013 Ga0453683_0000013_180462_181103 194
438 3300044673 Ga0453683_0091361 Ga0453683_0091361_669_1319 194
439 3300044712 Ga0453684_0000002 Ga0453684_0000002_190830_191471 194
440 3300044712 Ga0453684_0000040 Ga0453684_0000040_520749_521387 194
441 3300044712 Ga0453684_0011349 Ga0453684_0011349_7185_7823 194
442 3300044712 Ga0453684_0472856 Ga0453684_0472856_164_808 194
443 3300045051 Ga0451576_0000037 Ga0451576_0000037_180703_181344 194
444 3300045051 Ga0451576_0000677 Ga0451576_0000677_66937_67575 194
445 3300045051 Ga0451576_0001321 Ga0451576_0001321_27075_27707 194
446 3300045051 Ga0451576_0005709 Ga0451576_0005709_13111_13749 194
447 3300045051 Ga0451576_0172783 Ga0451576_0172783_1222_1872 194
448 3300046455 Ga0495603_0314840 Ga0495603_0314840_247_882 194
449 3300046539 Ga0495621_0002906 Ga0495621_0002906_1598_2254 194
450 3300046558 Ga0495633_0195663 Ga0495633_0195663_19_669 194
451 3300049571 Ga0501034_0388269 Ga0501034_0388269_643_1281 194
452 3300049581 Ga0501047_0238350 Ga0501047_0238350_308_946 194
453 3300049581 Ga0501047_0566615 Ga0501047_0566615_267_905 194
454 3300049584 Ga0501068_0035505 Ga0501068_0035505_723_1361 194
455 3300049585 Ga0501069_0032607 Ga0501069_0032607_1863_2501 194
456 3300049586 Ga0501070_0000922 Ga0501070_0000922_23465_24103 194
457 3300049588 Ga0501072_0037580 Ga0501072_0037580_1472_2110 194
458 3300049589 Ga0501073_0000119 Ga0501073_0000119_25932_26570 194
459 3300049590 Ga0501074_0000634 Ga0501074_0000634_14815_15453 194
460 3300049742 Ga0501080_0002188 Ga0501080_0002188_9864_10502 194
461 3300049744 Ga0501083_0000505 Ga0501083_0000505_16538_17176 194
462 3300049822 Ga0501035_0367854 Ga0501035_0367854_307_945 194
463 3300049823 Ga0501044_0166923 Ga0501044_0166923_630_1268 194
464 3300050491 nmdc:mga00v17_16420_c1 nmdc:mga00v17_16420_c1_2802_3449 194
465 3300050493 nmdc:mga0k408_2758_c1 nmdc:mga0k408_2758_c1_243_890 194
466 3300050493 nmdc:mga0k408_7584_c1 nmdc:mga0k408_7584_c1_4362_5009 194
467 3300050496 nmdc:mga07m45_108633_c1 nmdc:mga07m45_108633_c1_870_1520 194
468 3300050516 nmdc:mga0sz30_28335_c1 nmdc:mga0sz30_28335_c1_1616_2263 194
469 3300053096 Ga0500641_0014934 Ga0500641_0014934_477_1121 194
470 3300054114 Ga0501084_0054513 Ga0501084_0054513_1449_2087 194
471 3300060353 Ga0501082_0023922 Ga0501082_0023922_4149_4787 194
472 3300005563 Ga0068855_100022973 Ga0068855_1000229737 195
473 3300013104 Ga0157370_10011951 Ga0157370_100119513 195
474 3300025949 Ga0207667_10019136 Ga0207667_100191363 195
475 3300028666 Ga0265336_10000272 Ga0265336_1000027217 195
476 3300029957 Ga0265324_10000004 Ga0265324_1000000432 195
477 3300031241 Ga0265325_10000187 Ga0265325_100001872 195
478 3300049581 Ga0501047_0162547 Ga0501047_0162547_1415_2065 195
479 3300049586 Ga0501070_0263274 Ga0501070_0263274_319_969 195
480 3300049742 Ga0501080_0012490 Ga0501080_0012490_5485_6135 195
481 3300031665 Ga0316575_10028575 Ga0316575_100285751 197
482 3300046491 Ga0495584_0151018 Ga0495584_0151018_27_620 197
483 iso_pu_bacteria 2554235132 2554818087 197
484 iso_pu_bacteria 2606217733 2608380611 197
485 iso_pu_bacteria 2718217725 2718632136 197
486 iso_pu_bacteria 2969304461 2969304935 197
487 iso_pu_bacteria 3007419365 3007419988 197
488 iso_pu_bacteria 640427133 640486511 197
489 3300031250 Ga0265331_10011735 Ga0265331_100117354 199
490 3300031251 Ga0265327_10000065 Ga0265327_1000006536 199
491 3300005548 Ga0070665_100071014 Ga0070665_1000710142 201
492 3300006051 Ga0075364_10059321 Ga0075364_100593212 201
493 3300006946 Ga0079104_1008565 Ga0079104_10085654 201
494 3300009011 Ga0105251_10051193 Ga0105251_100511933 201
495 3300009092 Ga0105250_10002414 Ga0105250_100024143 201
496 3300012498 Ga0157345_1000194 Ga0157345_10001943 201
497 3300013100 Ga0157373_10019827 Ga0157373_100198273 201
498 3300013105 Ga0157369_10044474 Ga0157369_100444743 201
499 3300013306 Ga0163162_10002804 Ga0163162_100028044 201
500 3300025711 Ga0207696_1007657 Ga0207696_10076573 201
501 3300025728 Ga0207655_1003749 Ga0207655_10037497 201
502 3300027111 Ga0209281_1005200 Ga0209281_10052004 201
503 3300028379 Ga0268266_10009678 Ga0268266_100096783 201
504 3300028379 Ga0268266_10491758 Ga0268266_104917582 201
505 3300030521 Ga0307511_10178818 Ga0307511_101788182 201
506 3300031548 Ga0307408_100015286 Ga0307408_1000152863 201
507 3300031730 Ga0307516_10279748 Ga0307516_102797482 201
508 3300041407 Ga0439447_002724 Ga0439447_002724_2634_3257 201
509 3300041411 Ga0439466_0003125 Ga0439466_0003125_4716_5339 201
510 3300042006 Ga0439432_006292 Ga0439432_006292_2344_2967 201
511 3300042009 Ga0439451_008342 Ga0439451_008342_1345_1968 201
512 3300042010 Ga0439452_002777 Ga0439452_002777_2665_3288 201
513 3300042013 Ga0439456_018724 Ga0439456_018724_340_963 201
514 3300042115 Ga0450911_006357 Ga0450911_006357_403_1026 201
515 3300042124 Ga0450922_000710 Ga0450922_000710_510_1133 201
516 3300042876 Ga0451577_0008682 Ga0451577_0008682_4127_4750 201
517 3300046452 Ga0495617_009953 Ga0495617_009953_505_1128 201
518 3300046452 Ga0495617_023051 Ga0495617_023051_1158_1781 201
519 3300046453 Ga0495627_006900 Ga0495627_006900_1418_2041 201
520 3300046453 Ga0495627_007786 Ga0495627_007786_2157_2780 201
521 3300046458 Ga0495591_003686 Ga0495591_003686_2790_3413 201
522 3300046458 Ga0495591_006925 Ga0495591_006925_2195_2818 201
523 3300046458 Ga0495591_008069 Ga0495591_008069_2388_3011 201
524 3300046458 Ga0495591_016704 Ga0495591_016704_574_1197 201
525 3300046471 Ga0495650_0036723 Ga0495650_0036723_1318_1941 201
526 3300046474 Ga0495605_0000246 Ga0495605_0000246_56590_57213 201
527 3300046474 Ga0495605_0017666 Ga0495605_0017666_2217_2840 201
528 3300046492 Ga0495585_0022903 Ga0495585_0022903_1030_1653 201
529 3300046492 Ga0495585_0024731 Ga0495585_0024731_431_1054 201
530 3300046492 Ga0495585_0045014 Ga0495585_0045014_574_1197 201
531 3300046501 Ga0495607_0019379 Ga0495607_0019379_2350_2973 201
532 3300046501 Ga0495607_0026509 Ga0495607_0026509_998_1621 201
533 3300046501 Ga0495607_0099437 Ga0495607_0099437_589_1212 201
534 3300046501 Ga0495607_0220649 Ga0495607_0220649_282_905 201
535 3300046506 Ga0495583_0006014 Ga0495583_0006014_2599_3222 201
536 3300046507 Ga0495606_0015566 Ga0495606_0015566_2451_3074 201
537 3300046512 Ga0495610_0070094 Ga0495610_0070094_61_684 201
538 3300046513 Ga0495616_0013179 Ga0495616_0013179_2143_2766 201
539 3300046513 Ga0495616_0014761 Ga0495616_0014761_1376_1999 201
540 3300046515 Ga0495620_0030131 Ga0495620_0030131_1081_1704 201
541 3300046515 Ga0495620_0040996 Ga0495620_0040996_1350_1973 201
542 3300046518 Ga0495631_0011255 Ga0495631_0011255_2479_3102 201
543 3300046518 Ga0495631_0111845 Ga0495631_0111845_384_1007 201
544 3300046519 Ga0495632_0025338 Ga0495632_0025338_460_1083 201
545 3300046519 Ga0495632_0036327 Ga0495632_0036327_1319_1942 201
546 3300046519 Ga0495632_0043373 Ga0495632_0043373_1463_2086 201
547 3300046519 Ga0495632_0059736 Ga0495632_0059736_667_1290 201
548 3300046520 Ga0495637_0072051 Ga0495637_0072051_408_1031 201
549 3300046522 Ga0495643_0103848 Ga0495643_0103848_411_1034 201
550 3300046522 Ga0495643_0126711 Ga0495643_0126711_446_1069 201
551 3300046524 Ga0495648_0021594 Ga0495648_0021594_1864_2487 201
552 3300046524 Ga0495648_0024384 Ga0495648_0024384_2126_2749 201
553 3300046524 Ga0495648_0057171 Ga0495648_0057171_1436_2059 201
554 3300046530 Ga0495654_0003045 Ga0495654_0003045_4329_4952 201
555 3300046530 Ga0495654_0029096 Ga0495654_0029096_2051_2674 201
556 3300046538 Ga0495609_0022292 Ga0495609_0022292_480_1103 201
557 3300046538 Ga0495609_0055815 Ga0495609_0055815_589_1212 201
558 3300046542 Ga0495597_0011428 Ga0495597_0011428_2355_2978 201
559 3300046557 Ga0495622_0002682 Ga0495622_0002682_5518_6141 201
560 3300046557 Ga0495622_0029016 Ga0495622_0029016_1777_2400 201
561 3300046558 Ga0495633_0020328 Ga0495633_0020328_1297_1920 201
562 3300046648 Ga0495611_0066627 Ga0495611_0066627_545_1168 201
563 3300046660 Ga0495625_0023066 Ga0495625_0023066_2090_2713 201
564 3300046660 Ga0495625_0144835 Ga0495625_0144835_545_1168 201
565 3300046660 Ga0495625_0250628 Ga0495625_0250628_206_829 201
566 3300046692 Ga0495671_0017004 Ga0495671_0017004_1286_1909 201
567 3300046692 Ga0495671_0029482 Ga0495671_0029482_497_1120 201
568 3300046694 Ga0495649_0022218 Ga0495649_0022218_911_1534 201
569 3300046810 Ga0495660_0012624 Ga0495660_0012624_1909_2532 201
570 3300046810 Ga0495660_0015977 Ga0495660_0015977_2375_2998 201
571 3300046810 Ga0495660_0017774 Ga0495660_0017774_2356_2979 201
572 3300046810 Ga0495660_0031969 Ga0495660_0031969_410_1033 201
573 3300047321 Ga0495676_0033772 Ga0495676_0033772_2394_3017 201
574 3300047323 Ga0495683_0035437 Ga0495683_0035437_1285_1908 201
575 3300047446 Ga0495679_009753 Ga0495679_009753_1915_2538 201
576 3300047469 Ga0495673_0002133 Ga0495673_0002133_4924_5547 201
577 3300047469 Ga0495673_0011310 Ga0495673_0011310_1731_2354 201
578 3300047469 Ga0495673_0017535 Ga0495673_0017535_1346_1969 201
579 3300047470 Ga0495681_0070145 Ga0495681_0070145_312_935 201
580 3300047470 Ga0495681_0115384 Ga0495681_0115384_24_647 201
581 3300048091 Ga0495626_0009181 Ga0495626_0009181_2521_3144 201
582 3300048091 Ga0495626_0011997 Ga0495626_0011997_1906_2529 201
583 3300048091 Ga0495626_0037587 Ga0495626_0037587_243_866 201
584 3300049459 Ga0495678_008137 Ga0495678_008137_2206_2829 201
585 3300049459 Ga0495678_025575 Ga0495678_025575_394_1017 201
586 3300049460 Ga0495682_0000735 Ga0495682_0000735_9371_9994 201
587 3300049460 Ga0495682_0007404 Ga0495682_0007404_1300_1923 201
588 3300050491 nmdc:mga00v17_25493_c1 nmdc:mga00v17_25493_c1_1293_1916 201
589 3300053111 Ga0500572_004330 Ga0500572_004330_1393_2016 201
590 3300053142 Ga0500577_0075346 Ga0500577_0075346_92_715 201
591 iso_pu_bacteria 2511231006 2511265558 201
592 iso_pu_bacteria 2512047018 2512325930 201
593 iso_pu_bacteria 2582580891 2583789829 201
594 iso_pu_bacteria 2597489887 2597855637 201
595 iso_pu_bacteria 2599185185 2599485539 201
596 iso_pu_bacteria 2599185257 2599806668 201
597 iso_pu_bacteria 2599185307 2599973685 201
598 iso_pu_bacteria 2600254931 2600364907 201
599 iso_pu_bacteria 2600255283 2601627212 201
600 iso_pu_bacteria 2671180172 2671772319 201
601 iso_pu_bacteria 2740892503 2743735054 201
602 iso_pu_bacteria 2984286254 2984292011 201
603 iso_pu_bacteria 8015687852 8015688297 201
604 iso_pu_bacteria 8055770955 8055771395 201
605 3300003781 Ga0055536_1001506 Ga0055536_10015066 205
606 3300003791 Ga0055530_10000677 Ga0055530_100006776 205
607 3300003792 Ga0055540_1001429 Ga0055540_10014298 205
608 3300025292 Ga0209676_1000032 Ga0209676_1000032327 205
609 3300025298 Ga0209050_1000025 Ga0209050_1000025328 205
610 3300025303 Ga0209051_1000299 Ga0209051_100029916 205
611 3300025735 Ga0207713_1000031 Ga0207713_100003178 205
612 3300041411 Ga0439466_0002287 Ga0439466_0002287_2195_2812 205
613 3300042013 Ga0439456_033697 Ga0439456_033697_331_948 205
614 3300042016 Ga0439463_000725 Ga0439463_000725_6347_6964 205
615 3300042993 Ga0439440_0001551 Ga0439440_0001551_1028_1645 205
616 3300046453 Ga0495627_001267 Ga0495627_001267_6966_7610 205
617 3300046518 Ga0495631_0004118 Ga0495631_0004118_4700_5344 205
618 3300046519 Ga0495632_0018058 Ga0495632_0018058_1468_2112 205
619 3300046530 Ga0495654_0002879 Ga0495654_0002879_3652_4296 205
620 3300049571 Ga0501034_0043398 Ga0501034_0043398_3775_4431 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04350

PilO

Pilus assembly protein, PilO

51

193

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uvr-assembly1.cif.gz_A the core region of pilo from the type iv pilus system of pseudomonas aeruginosa 0.9232 110 201
5uvr-assembly1.cif.gz_A the core region of pilo from the type iv pilus system of pseudomonas aeruginosa 0.8611 110 201
6lad-assembly8.cif.gz_F crystal structure of amuc_1100 from akkermansia muciniphila 0.8224 116 203
6lad-assembly7.cif.gz_A crystal structure of amuc_1100 from akkermansia muciniphila 0.7977 116 204
6lad-assembly8.cif.gz_D crystal structure of amuc_1100 from akkermansia muciniphila 0.7902 116 205
ID Description Score Start End Superfamily
2rjzB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.977 108 201 3.30.70.60
2rjzB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.9468 108 201 3.30.70.60
af_I1JQN9_795_861_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8611 111 167 3.30.70.260
af_Q46832_101_178_3.30.1360.100 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;General secretion pathway protein M, EpsM 0.8026 112 197 3.30.1360.100
af_P0AG24_623_702_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7853 111 170 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A455U627-F1-model_v4 Pilus assembly protein PilO 0.9794 113 203 GO:0043107
GO:0043683
AF-A0A655Q5A6-F1-model_v4 deleted 0.9584 105 203
AF-A0A3N5PJI3-F1-model_v4 Pilus assembly protein PilO 0.9517 103 205 GO:0043107
GO:0043683
AF-A0A850R049-F1-model_v4 Type 4a pilus biogenesis protein PilO 0.9491 116 204 GO:0043107
GO:0043683
AF-A0A7U6KSB1-F1-model_v4 Type IV pilus assembly protein PilO 0.9333 93 205 GO:0043107
GO:0043683

Feature Viewer

pLDDT pTM Quality
81.75 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map