F469953

General Info

Members Datasets Scaffolds Average Seq Length
620 237 1240 365

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0023026|Ga0496114_0023026_3113_4306
Length 397
Sequence MLLRHAPPRRPIAAEVPGARRPIPRLEELPMHSRIQFDPLQIAKQFADFSQRLLQGSEMLRSVKDRDVQIATTPKTEVFRQDKTTLYHYEPMAKRAVAVPVLVVYGLVGRYTMADLQEDRSLIRNLLLQGVDLYAVDWGNPGRGDRWLTIDDYVNGYLNECIEFICRAHGLDSINVLGICEGGVFTLCHAALHPEQVRNLIVTITPVDFHADQAEGRTDHGFINLWTRSLTPEDVDRLIEANGNLPGELMSFVFSTMTPLSSLTKYNLGLLDVVDDEKKLLNFLRMEKWLADRPHHPGEAAKQWLKDLYQQNKLVKNQFELGGRKVELANITMPVLNIYAKEDHIIPPQCSRALAECVGTDDYSEIGLAGGHVGVFVSGKSQGILGKGIVDWLTERP

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
142 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
143 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
144 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
151 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
152 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
162 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
169 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
170 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
171 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
172 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
173 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
174 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
175 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
181 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
237 641522639 Methylobacterium sp. 4-46 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 4.68
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0.32
Rhizoplane 6.29
Rhizosphere 84.68
Stem 0
Stem Tuber 0
Unclassified 2.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0023026 3300048917 Bacteria 5078
2 Ga0065712_10079221 3300005290 Bacteria 3244
3 Ga0065715_10112976 3300005293 Bacteria 2508
4 Ga0065715_10125533 3300005293 Bacteria 2128
5 Ga0070676_10030873 3300005328 Bacteria 3058
6 Ga0070676_10191428 3300005328 Bacteria 1336
7 Ga0070683_100004260 3300005329 Bacteria 11739
8 Ga0070683_100116386 3300005329 Bacteria 2524
9 Ga0070683_100162797 3300005329 Bacteria 2117
10 Ga0070690_100012332 3300005330 Bacteria 5028
11 Ga0070670_100001453 3300005331 Bacteria 19038
12 Ga0070670_100006544 3300005331 Bacteria 9868
13 Ga0070670_100105316 3300005331 Bacteria 2430
14 Ga0070677_10033963 3300005333 Bacteria 1968
15 Ga0068869_100000658 3300005334 Bacteria 19543
16 Ga0068869_100029163 3300005334 Bacteria 3863
17 Ga0068869_100029977 3300005334 Bacteria 3815
18 Ga0068869_100038633 3300005334 Bacteria 3404
19 Ga0068869_100064088 3300005334 Bacteria 2702
20 Ga0070666_10010431 3300005335 Bacteria 5812
21 Ga0070666_10108298 3300005335 Bacteria 1920
22 Ga0068868_100028101 3300005338 Bacteria 4297
23 Ga0068868_100048355 3300005338 Bacteria 3336
24 Ga0068868_100059736 3300005338 Bacteria 3017
25 Ga0070689_100003136 3300005340 Bacteria 10933
26 Ga0070689_100102126 3300005340 Bacteria 2271
27 Ga0070689_100146716 3300005340 Bacteria 1901
28 Ga0070668_100006363 3300005347 Bacteria 8748
29 Ga0070668_100014263 3300005347 Bacteria 5938
30 Ga0070668_100068545 3300005347 Bacteria 2758
31 Ga0070669_100018367 3300005353 Bacteria 4998
32 Ga0070669_100021829 3300005353 Bacteria 4578
33 Ga0070669_100024472 3300005353 Bacteria 4328
34 Ga0070669_100043547 3300005353 Bacteria 3270
35 Ga0070669_100136204 3300005353 Bacteria 1889
36 Ga0070675_100000867 3300005354 Bacteria 21513
37 Ga0070675_100006150 3300005354 Bacteria 9200
38 Ga0070675_100015917 3300005354 Bacteria 5957
39 Ga0070675_100110924 3300005354 Bacteria 2321
40 Ga0070671_100001394 3300005355 Bacteria 18059
41 Ga0070671_100001982 3300005355 Bacteria 15714
42 Ga0070671_100040583 3300005355 Bacteria 3866
43 Ga0070671_100075608 3300005355 Bacteria 2814
44 Ga0070671_100105609 3300005355 Bacteria 2364
45 Ga0070671_100147446 3300005355 Bacteria 1987
46 Ga0070671_100158703 3300005355 Bacteria 1911
47 Ga0070674_100099959 3300005356 Bacteria 2111
48 Ga0070674_100125075 3300005356 Bacteria 1908
49 Ga0070673_100000636 3300005364 Bacteria 19252
50 Ga0070673_100015692 3300005364 Bacteria 5329
51 Ga0070673_100052452 3300005364 Bacteria 3200
52 Ga0070673_100125363 3300005364 Bacteria 2148
53 Ga0070673_100216894 3300005364 Bacteria 1654
54 Ga0070673_100261068 3300005364 Bacteria 1513
55 Ga0070688_100074325 3300005365 Bacteria 2183
56 Ga0070688_100120028 3300005365 Bacteria 1760
57 Ga0070667_100035965 3300005367 Bacteria 4150
58 Ga0070667_100057405 3300005367 Bacteria 3290
59 Ga0070713_100174168 3300005436 Bacteria 1929
60 Ga0070708_100053873 3300005445 Bacteria 3572
61 Ga0070678_100005995 3300005456 Bacteria 7083
62 Ga0070678_100056512 3300005456 Bacteria 2871
63 Ga0070678_100115311 3300005456 Bacteria 2109
64 Ga0070662_100022323 3300005457 Bacteria 4332
65 Ga0070662_100082786 3300005457 Bacteria 2393
66 Ga0070662_100103016 3300005457 Bacteria 2163
67 Ga0070662_100124086 3300005457 Bacteria 1982
68 Ga0068867_100000943 3300005459 Bacteria 19781
69 Ga0068867_100008734 3300005459 Bacteria 7152
70 Ga0068867_100022606 3300005459 Bacteria 4495
71 Ga0068867_100110048 3300005459 Bacteria 2116
72 Ga0068867_100167687 3300005459 Bacteria 1737
73 Ga0070685_10089773 3300005466 Bacteria 1858
74 Ga0070685_10110701 3300005466 Bacteria 1691
75 Ga0070706_100024698 3300005467 Bacteria 5533
76 Ga0070698_100244995 3300005471 Bacteria 1725
77 Ga0070699_100032178 3300005518 Bacteria 4529
78 Ga0070699_100038672 3300005518 Bacteria 4131
79 Ga0070684_100063906 3300005535 Bacteria 3228
80 Ga0070684_100096321 3300005535 Bacteria 2638
81 Ga0070697_100004899 3300005536 Bacteria 10275
82 Ga0070697_100149160 3300005536 Bacteria 1970
83 Ga0068853_100398883 3300005539 Bacteria 1287
84 Ga0070672_100000883 3300005543 Bacteria 17987
85 Ga0070672_100002149 3300005543 Bacteria 12437
86 Ga0070672_100035363 3300005543 Bacteria 3797
87 Ga0070672_100051690 3300005543 Bacteria 3206
88 Ga0070672_100062447 3300005543 Unclassified 2940
89 Ga0070672_100105170 3300005543 Bacteria 2295
90 Ga0070672_100117373 3300005543 Bacteria 2175
91 Ga0070672_100134358 3300005543 Bacteria 2036
92 Ga0070672_100146601 3300005543 Bacteria 1950
93 Ga0070672_100227019 3300005543 Bacteria 1567
94 Ga0070672_100288083 3300005543 Bacteria 1390
95 Ga0070686_100016626 3300005544 Bacteria 4283
96 Ga0070696_100038217 3300005546 Bacteria 3312
97 Ga0070665_100026118 3300005548 Bacteria 5880
98 Ga0070665_100037031 3300005548 Bacteria 4906
99 Ga0070665_100101995 3300005548 Bacteria 2873
100 Ga0070665_100102315 3300005548 Unclassified 2868
101 Ga0070664_100058167 3300005564 Bacteria 3288
102 Ga0070664_100239439 3300005564 Bacteria 1629
103 Ga0070664_100278865 3300005564 Bacteria 1507
104 Ga0068857_100003951 3300005577 Bacteria 12481
105 Ga0068857_100070891 3300005577 Bacteria 3105
106 Ga0068854_100075399 3300005578 Bacteria 2476
107 Ga0068852_100011458 3300005616 Bacteria 6676
108 Ga0068859_100010428 3300005617 Bacteria 9349
109 Ga0068859_100011716 3300005617 Bacteria 8810
110 Ga0068859_100032168 3300005617 Bacteria 5269
111 Ga0068859_100264767 3300005617 Bacteria 1811
112 Ga0068864_100000531 3300005618 Bacteria 32744
113 Ga0068864_100002136 3300005618 Bacteria 16347
114 Ga0068864_100015192 3300005618 Bacteria 6403
115 Ga0068864_100070114 3300005618 Bacteria 3049
116 Ga0068866_10052668 3300005718 Bacteria 2077
117 Ga0068866_10087698 3300005718 Bacteria 1687
118 Ga0068861_100009062 3300005719 Bacteria 6859
119 Ga0068861_100014585 3300005719 Bacteria 5517
120 Ga0068861_100287165 3300005719 Bacteria 1419
121 Ga0068851_10086500 3300005834 Bacteria 1645
122 Ga0068851_10092001 3300005834 Bacteria 1598
123 Ga0068870_10004001 3300005840 Bacteria 6291
124 Ga0068870_10023269 3300005840 Bacteria 3054
125 Ga0068870_10080899 3300005840 Bacteria 1796
126 Ga0068863_100001722 3300005841 Bacteria 21666
127 Ga0068863_100003233 3300005841 Bacteria 16132
128 Ga0068863_100015344 3300005841 Bacteria 7363
129 Ga0068863_100036433 3300005841 Bacteria 4685
130 Ga0068863_100240627 3300005841 Bacteria 1747
131 Ga0068858_100021205 3300005842 Bacteria 6067
132 Ga0068860_100160427 3300005843 Bacteria 2168
133 Ga0068860_100233654 3300005843 Bacteria 1787
134 Ga0068860_100368787 3300005843 Bacteria 1416
135 Ga0068862_100009144 3300005844 Bacteria 8204
136 Ga0068862_100091750 3300005844 Bacteria 2646
137 Ga0070717_10043752 3300006028 Bacteria 3655
138 Ga0075432_10016231 3300006058 Bacteria 2542
139 Ga0075366_10018676 3300006195 Bacteria 4004
140 Ga0075366_10036643 3300006195 Bacteria 2892
141 Ga0097621_100062407 3300006237 Bacteria 3059
142 Ga0097621_100070253 3300006237 Bacteria 2892
143 Ga0097621_100244669 3300006237 Bacteria 1569
144 Ga0075370_10003416 3300006353 Bacteria 7557
145 Ga0068871_100012244 3300006358 Bacteria 6317
146 Ga0068871_100119175 3300006358 Bacteria 2227
147 Ga0075428_100030246 3300006844 Bacteria 5990
148 Ga0075428_100084890 3300006844 Bacteria 3454
149 Ga0075431_100000305 3300006847 Bacteria 38524
150 Ga0075434_100014844 3300006871 Bacteria 7452
151 Ga0075434_100036671 3300006871 Bacteria 4851
152 Ga0075434_100044568 3300006871 Bacteria 4400
153 Ga0075429_100008764 3300006880 Bacteria 8795
154 Ga0075429_100042233 3300006880 Bacteria 3969
155 Ga0068865_100014338 3300006881 Bacteria 5035
156 Ga0075436_100047347 3300006914 Bacteria 2966
157 Ga0097620_100010429 3300006931 Bacteria 9349
158 Ga0097620_100011716 3300006931 Bacteria 8810
159 Ga0097620_100032169 3300006931 Bacteria 5269
160 Ga0097620_100264762 3300006931 Bacteria 1811
161 Ga0105251_10005484 3300009011 Bacteria 8272
162 Ga0111539_10000072 3300009094 Bacteria 100461
163 Ga0111539_10006114 3300009094 Bacteria 15542
164 Ga0111539_10010175 3300009094 Bacteria 11853
165 Ga0111539_10074439 3300009094 Bacteria 4001
166 Ga0111539_10193944 3300009094 Bacteria 2369
167 Ga0105245_10013889 3300009098 Bacteria 7015
168 Ga0105245_10070987 3300009098 Bacteria 3162
169 Ga0105245_10130890 3300009098 Unclassified 2353
170 Ga0105247_10037030 3300009101 Bacteria 2975
171 Ga0105247_10081447 3300009101 Bacteria 2041
172 Ga0114129_10000134 3300009147 Bacteria 76265
173 Ga0114129_10092735 3300009147 Bacteria 4184
174 Ga0105243_10026088 3300009148 Bacteria 4471
175 Ga0105243_10058050 3300009148 Unclassified 3083
176 Ga0105243_10099430 3300009148 Bacteria 2411
177 Ga0105241_10156290 3300009174 Bacteria 1870
178 Ga0105248_10014971 3300009177 Bacteria 8538
179 Ga0105248_10017014 3300009177 Bacteria 8007
180 Ga0105248_10058646 3300009177 Bacteria 4323
181 Ga0105248_10061244 3300009177 Bacteria 4225
182 Ga0105248_10076679 3300009177 Bacteria 3757
183 Ga0105248_10121409 3300009177 Bacteria 2947
184 Ga0105237_10001612 3300009545 Bacteria 29291
185 Ga0105238_10088353 3300009551 Bacteria 3086
186 Ga0105238_10134723 3300009551 Bacteria 2448
187 Ga0105238_10453605 3300009551 Bacteria 1279
188 Ga0105249_10056690 3300009553 Bacteria 3587
189 Ga0105239_10001663 3300010375 Bacteria 29291
190 Ga0105239_10544441 3300010375 Bacteria 1322
191 Ga0105246_10032883 3300011119 Bacteria 3443
192 Ga0105246_10044600 3300011119 Bacteria 3014
193 Ga0105246_10151969 3300011119 Bacteria 1753
194 Ga0105246_10158782 3300011119 Bacteria 1720
195 Ga0105246_10190393 3300011119 Unclassified 1587
196 Ga0157371_10108175 3300013102 Bacteria 1973
197 Ga0157374_10048069 3300013296 Bacteria 3958
198 Ga0157374_10067567 3300013296 Bacteria 3361
199 Ga0157374_10167187 3300013296 Bacteria 2144
200 Ga0157374_10224212 3300013296 Bacteria 1845
201 Ga0157378_10007650 3300013297 Bacteria 9431
202 Ga0157378_10044905 3300013297 Bacteria 3925
203 Ga0157378_10156800 3300013297 Bacteria 2126
204 Ga0157378_10244611 3300013297 Bacteria 1715
205 Ga0157378_10305300 3300013297 Bacteria 1541
206 Ga0163162_10007507 3300013306 Bacteria 10615
207 Ga0163162_10055129 3300013306 Bacteria 4001
208 Ga0163162_10078772 3300013306 Bacteria 3361
209 Ga0163162_10133501 3300013306 Bacteria 2592
210 Ga0163162_10298659 3300013306 Bacteria 1742
211 Ga0163162_10581543 3300013306 Bacteria 1247
212 Ga0157375_10011120 3300013308 Bacteria 7937
213 Ga0157375_10053186 3300013308 Bacteria 3983
214 Ga0157375_10070832 3300013308 Bacteria 3498
215 Ga0157375_10154877 3300013308 Bacteria 2430
216 Ga0163163_10000768 3300014325 Bacteria 27220
217 Ga0163163_10003121 3300014325 Bacteria 14040
218 Ga0163163_10004780 3300014325 Bacteria 11624
219 Ga0163163_10132363 3300014325 Bacteria 2534
220 Ga0157380_10024617 3300014326 Bacteria 4558
221 Ga0157380_10113857 3300014326 Bacteria 2278
222 Ga0157379_10000156 3300014968 Bacteria 50624
223 Ga0157379_10041261 3300014968 Bacteria 4120
224 Ga0157379_10056307 3300014968 Bacteria 3513
225 Ga0157379_10173090 3300014968 Bacteria 1949
226 Ga0163161_10023947 3300017792 Bacteria 4309
227 Ga0163161_10048800 3300017792 Bacteria 3058
228 Ga0163161_10200697 3300017792 Bacteria 1537
229 Ga0163161_10202947 3300017792 Bacteria 1529
230 Ga0213875_10004217 3300021388 Bacteria 7936
231 Ga0207697_10002074 3300025315 Bacteria 10548
232 Ga0207656_10005166 3300025321 Bacteria 4591
233 Ga0207656_10060575 3300025321 Bacteria 1660
234 Ga0207713_1031020 3300025735 Bacteria 2370
235 Ga0207682_10001704 3300025893 Bacteria 10057
236 Ga0207688_10034876 3300025901 Unclassified 2786
237 Ga0207688_10054178 3300025901 Bacteria 2250
238 Ga0207688_10130143 3300025901 Bacteria 1475
239 Ga0207680_10001914 3300025903 Bacteria 9762
240 Ga0207680_10002597 3300025903 Bacteria 8423
241 Ga0207680_10089514 3300025903 Bacteria 1954
242 Ga0207680_10199531 3300025903 Bacteria 1363
243 Ga0207645_10000414 3300025907 Bacteria 35437
244 Ga0207645_10016052 3300025907 Bacteria 4961
245 Ga0207645_10083039 3300025907 Unclassified 2054
246 Ga0207643_10002598 3300025908 Bacteria 9765
247 Ga0207643_10032008 3300025908 Bacteria 2935
248 Ga0207643_10032414 3300025908 Bacteria 2918
249 Ga0207643_10041464 3300025908 Bacteria 2594
250 Ga0207643_10062626 3300025908 Bacteria 2126
251 Ga0207654_10093020 3300025911 Bacteria 1842
252 Ga0207695_10013032 3300025913 Bacteria 9930
253 Ga0207671_10001301 3300025914 Bacteria 29299
254 Ga0207693_10102183 3300025915 Bacteria 2248
255 Ga0207662_10004844 3300025918 Bacteria 7119
256 Ga0207681_10016714 3300025923 Bacteria 4597
257 Ga0207681_10050422 3300025923 Bacteria 2816
258 Ga0207694_10103787 3300025924 Bacteria 2255
259 Ga0207694_10113807 3300025924 Bacteria 2154
260 Ga0207650_10000323 3300025925 Bacteria 46579
261 Ga0207650_10013374 3300025925 Bacteria 5682
262 Ga0207659_10000751 3300025926 Bacteria 19207
263 Ga0207659_10001308 3300025926 Bacteria 14874
264 Ga0207659_10077569 3300025926 Bacteria 2445
265 Ga0207659_10136742 3300025926 Unclassified 1898
266 Ga0207687_10005059 3300025927 Bacteria 8727
267 Ga0207687_10030806 3300025927 Bacteria 3620
268 Ga0207664_10084831 3300025929 Bacteria 2584
269 Ga0207644_10009313 3300025931 Bacteria 6446
270 Ga0207644_10011403 3300025931 Bacteria 5880
271 Ga0207644_10026747 3300025931 Bacteria 3980
272 Ga0207644_10211926 3300025931 Bacteria 1532
273 Ga0207706_10003772 3300025933 Bacteria 14457
274 Ga0207706_10006828 3300025933 Bacteria 10552
275 Ga0207706_10022080 3300025933 Bacteria 5712
276 Ga0207686_10151926 3300025934 Bacteria 1613
277 Ga0207709_10200934 3300025935 Bacteria 1423
278 Ga0207670_10085382 3300025936 Bacteria 2218
279 Ga0207669_10007003 3300025937 Bacteria 5188
280 Ga0207669_10036429 3300025937 Unclassified 2811
281 Ga0207669_10058167 3300025937 Bacteria 2358
282 Ga0207669_10083484 3300025937 Bacteria 2055
283 Ga0207669_10086706 3300025937 Unclassified 2025
284 Ga0207669_10104730 3300025937 Bacteria 1880
285 Ga0207669_10264131 3300025937 Bacteria 1289
286 Ga0207704_10024664 3300025938 Bacteria 3267
287 Ga0207665_10000931 3300025939 Bacteria 19800
288 Ga0207691_10002236 3300025940 Bacteria 18957
289 Ga0207691_10008903 3300025940 Bacteria 9637
290 Ga0207691_10020011 3300025940 Bacteria 6331
291 Ga0207691_10034179 3300025940 Bacteria 4729
292 Ga0207691_10076184 3300025940 Bacteria 3023
293 Ga0207691_10114932 3300025940 Bacteria 2391
294 Ga0207691_10149331 3300025940 Bacteria 2055
295 Ga0207691_10215323 3300025940 Unclassified 1667
296 Ga0207691_10290006 3300025940 Bacteria 1407
297 Ga0207711_10004936 3300025941 Bacteria 11328
298 Ga0207711_10200609 3300025941 Bacteria 1820
299 Ga0207711_10219875 3300025941 Bacteria 1737
300 Ga0207689_10000065 3300025942 Bacteria 84074
301 Ga0207689_10012718 3300025942 Bacteria 7190
302 Ga0207689_10025421 3300025942 Bacteria 4963
303 Ga0207661_10007541 3300025944 Bacteria 7736
304 Ga0207661_10024120 3300025944 Bacteria 4605
305 Ga0207679_10195162 3300025945 Bacteria 1687
306 Ga0207651_10000398 3300025960 Bacteria 18449
307 Ga0207651_10016929 3300025960 Bacteria 4290
308 Ga0207651_10030751 3300025960 Unclassified 3423
309 Ga0207651_10108756 3300025960 Bacteria 2076
310 Ga0207712_10032842 3300025961 Bacteria 3505
311 Ga0207712_10083417 3300025961 Bacteria 2333
312 Ga0207668_10003961 3300025972 Bacteria 8728
313 Ga0207668_10006172 3300025972 Bacteria 7070
314 Ga0207668_10010608 3300025972 Bacteria 5575
315 Ga0207668_10137248 3300025972 Bacteria 1875
316 Ga0207668_10263941 3300025972 Bacteria 1404
317 Ga0207658_10002681 3300025986 Bacteria 12869
318 Ga0207658_10003363 3300025986 Bacteria 11334
319 Ga0207658_10082805 3300025986 Bacteria 2465
320 Ga0207658_10100963 3300025986 Bacteria 2260
321 Ga0207677_10016464 3300026023 Bacteria 4382
322 Ga0207677_10039051 3300026023 Bacteria 3117
323 Ga0207703_10000794 3300026035 Bacteria 31109
324 Ga0207703_10002510 3300026035 Bacteria 15864
325 Ga0207703_10009555 3300026035 Bacteria 7614
326 Ga0207639_10047316 3300026041 Bacteria 3250
327 Ga0207678_10020501 3300026067 Bacteria 5795
328 Ga0207678_10094755 3300026067 Bacteria 2551
329 Ga0207708_10019833 3300026075 Bacteria 5070
330 Ga0207708_10074393 3300026075 Unclassified 2604
331 Ga0207708_10099949 3300026075 Bacteria 2244
332 Ga0207641_10028567 3300026088 Bacteria 4609
333 Ga0207641_10058104 3300026088 Bacteria 3291
334 Ga0207641_10091252 3300026088 Bacteria 2665
335 Ga0207641_10320542 3300026088 Bacteria 1469
336 Ga0207648_10000762 3300026089 Bacteria 36143
337 Ga0207648_10006353 3300026089 Bacteria 11751
338 Ga0207648_10011107 3300026089 Bacteria 8496
339 Ga0207648_10014587 3300026089 Bacteria 7257
340 Ga0207648_10045635 3300026089 Bacteria 3843
341 Ga0207648_10063788 3300026089 Bacteria 3211
342 Ga0207648_10070349 3300026089 Bacteria 3050
343 Ga0207676_10000082 3300026095 Bacteria 92500
344 Ga0207676_10001002 3300026095 Bacteria 21742
345 Ga0207676_10001071 3300026095 Bacteria 20802
346 Ga0207676_10091549 3300026095 Unclassified 2499
347 Ga0207676_10184115 3300026095 Bacteria 1831
348 Ga0207676_10339954 3300026095 Bacteria 1385
349 Ga0207674_10008442 3300026116 Bacteria 11900
350 Ga0207674_10072773 3300026116 Bacteria 3452
351 Ga0207674_10119163 3300026116 Bacteria 2609
352 Ga0207674_10144291 3300026116 Bacteria 2340
353 Ga0207675_100002547 3300026118 Bacteria 18043
354 Ga0207675_100007248 3300026118 Bacteria 10483
355 Ga0207675_100015907 3300026118 Bacteria 7017
356 Ga0207675_100018121 3300026118 Bacteria 6565
357 Ga0207675_100018316 3300026118 Bacteria 6530
358 Ga0207675_100101351 3300026118 Bacteria 2713
359 Ga0207675_100276684 3300026118 Bacteria 1630
360 Ga0207683_10009352 3300026121 Bacteria 8349
361 Ga0207683_10014545 3300026121 Bacteria 6703
362 Ga0207683_10015187 3300026121 Bacteria 6553
363 Ga0207683_10049483 3300026121 Bacteria 3680
364 Ga0207683_10134736 3300026121 Bacteria 2223
365 Ga0207683_10315185 3300026121 Bacteria 1432
366 Ga0207698_10051194 3300026142 Bacteria 3156
367 Ga0207428_10001757 3300027907 Bacteria 22207
368 Ga0207428_10024725 3300027907 Bacteria 5042
369 Ga0268266_10012936 3300028379 Bacteria 7197
370 Ga0268266_10085514 3300028379 Unclassified 2756
371 Ga0268266_10168687 3300028379 Bacteria 1985
372 Ga0268265_10020365 3300028380 Bacteria 4628
373 Ga0268265_10033735 3300028380 Bacteria 3724
374 Ga0268264_10000535 3300028381 Bacteria 48055
375 Ga0268264_10044435 3300028381 Bacteria 3685
376 Ga0307515_10088540 3300028794 Bacteria 3911
377 Ga0307408_100187699 3300031548 Bacteria 1663
378 Ga0316575_10000755 3300031665 Bacteria 9727
379 Ga0316575_10015929 3300031665 Bacteria 2838
380 Ga0316575_10016794 3300031665 Bacteria 2774
381 Ga0316575_10029740 3300031665 Bacteria 2133
382 Ga0316579_10000040 3300031691 Bacteria 29928
383 Ga0316579_10001650 3300031691 Bacteria 8190
384 Ga0316579_10007205 3300031691 Bacteria 4582
385 Ga0316576_10002652 3300031727 Bacteria 10215
386 Ga0316576_10004911 3300031727 Bacteria 8090
387 Ga0316576_10007946 3300031727 Bacteria 6717
388 Ga0316576_10027939 3300031727 Bacteria 3970
389 Ga0316576_10029089 3300031727 Bacteria 3901
390 Ga0316576_10085932 3300031727 Bacteria 2338
391 Ga0316576_10128213 3300031727 Bacteria 1908
392 Ga0316576_10228674 3300031727 Bacteria 1398
393 Ga0316578_10000080 3300031728 Bacteria 21643
394 Ga0316578_10002614 3300031728 Bacteria 7977
395 Ga0316578_10005625 3300031728 Bacteria 6101
396 Ga0316578_10020106 3300031728 Bacteria 3684
397 Ga0316578_10021315 3300031728 Bacteria 3595
398 Ga0316578_10059878 3300031728 Bacteria 2240
399 Ga0316578_10062085 3300031728 Bacteria 2202
400 Ga0316578_10095795 3300031728 Bacteria 1776
401 Ga0307516_10003397 3300031730 Bacteria 20497
402 Ga0307516_10152781 3300031730 Bacteria 2067
403 Ga0316577_10000081 3300031733 Bacteria 25181
404 Ga0316577_10000177 3300031733 Bacteria 20563
405 Ga0316577_10000769 3300031733 Bacteria 13806
406 Ga0316577_10002085 3300031733 Bacteria 9778
407 Ga0316577_10094359 3300031733 Bacteria 1675
408 Ga0316577_10111829 3300031733 Bacteria 1532
409 Ga0307412_10118354 3300031911 Bacteria 1903
410 Ga0307416_100083381 3300032002 Bacteria 2712
411 Ga0307416_100278165 3300032002 Bacteria 1648
412 Ga0307411_10003702 3300032005 Bacteria 7164
413 Ga0316585_10000066 3300032137 Bacteria 17424
414 Ga0316585_10000855 3300032137 Bacteria 7757
415 Ga0316585_10001399 3300032137 Bacteria 6359
416 Ga0316585_10018724 3300032137 Bacteria 2104
417 Ga0316580_10000055 3300032139 Bacteria 18377
418 Ga0316580_10000198 3300032139 Bacteria 12273
419 Ga0316580_10000931 3300032139 Bacteria 7234
420 Ga0316580_10005847 3300032139 Bacteria 3610
421 Ga0316580_10028971 3300032139 Bacteria 1712
422 Ga0316580_10049116 3300032139 Bacteria 1300
423 Ga0316593_10000155 3300032168 Bacteria 9820
424 Ga0316593_10005894 3300032168 Bacteria 3271
425 Ga0316593_10007281 3300032168 Bacteria 3031
426 Ga0316593_10007863 3300032168 Bacteria 2947
427 Ga0316593_10017565 3300032168 Bacteria 2184
428 Ga0316593_10046206 3300032168 Bacteria 1461
429 Ga0316593_10054902 3300032168 Bacteria 1353
430 Ga0316592_1001736 3300033524 Bacteria 3622
431 Ga0316592_1003080 3300033524 Bacteria 2959
432 Ga0316592_1005521 3300033524 Bacteria 2405
433 Ga0316592_1007464 3300033524 Bacteria 2137
434 Ga0316592_1010208 3300033524 Bacteria 1891
435 Ga0316586_1000706 3300033527 Bacteria 3393
436 Ga0316586_1003537 3300033527 Bacteria 2059
437 Ga0316586_1010740 3300033527 Bacteria 1393
438 Ga0316588_1000121 3300033528 Bacteria 7891
439 Ga0316588_1000267 3300033528 Bacteria 6412
440 Ga0316588_1003276 3300033528 Bacteria 2930
441 Ga0316588_1004996 3300033528 Bacteria 2552
442 Ga0316588_1012306 3300033528 Bacteria 1843
443 Ga0316587_1001085 3300033529 Bacteria 3189
444 Ga0316587_1001824 3300033529 Bacteria 2730
445 Ga0316587_1002183 3300033529 Bacteria 2575
446 Ga0316596_1001013 3300033541 Bacteria 5410
447 Ga0316596_1006146 3300033541 Bacteria 2780
448 Ga0316596_1007675 3300033541 Bacteria 2553
449 Ga0316596_1010871 3300033541 Bacteria 2214
450 Ga0316596_1011035 3300033541 Bacteria 2199
451 Ga0316596_1014659 3300033541 Bacteria 1946
452 Ga0316574_0000001 3300035398 Bacteria 74476
453 Ga0316574_0003594 3300035398 Bacteria 8023
454 Ga0316574_0008005 3300035398 Bacteria 5837
455 Ga0316574_0015175 3300035398 Bacteria 4468
456 Ga0316574_0018746 3300035398 Bacteria 4072
457 Ga0316574_0022161 3300035398 Bacteria 3781
458 Ga0316574_0066242 3300035398 Bacteria 2275
459 Ga0373927_0037337 3300035695 Bacteria 3157
460 Ga0373947_0139389 3300035725 Bacteria 1554
461 Ga0316582_0000003 3300036647 Bacteria 54635
462 Ga0316582_0008153 3300036647 Bacteria 5616
463 Ga0316582_0014699 3300036647 Bacteria 4452
464 Ga0316582_0016559 3300036647 Bacteria 4241
465 Ga0316584_0000037 3300036712 Bacteria 47995
466 Ga0316584_0005084 3300036712 Bacteria 8773
467 Ga0316584_0023709 3300036712 Bacteria 4484
468 Ga0316584_0030253 3300036712 Bacteria 4001
469 Ga0316584_0034538 3300036712 Bacteria 3748
470 Ga0316584_0065575 3300036712 Bacteria 2720
471 Ga0316584_0141961 3300036712 Bacteria 1790
472 Ga0316584_0289396 3300036712 Bacteria 1189
473 Ga0373925_0009439 3300037068 Bacteria 7101
474 Ga0373925_0050457 3300037068 Bacteria 3103
475 Ga0395898_0122482 3300037466 Bacteria 2492
476 Ga0395905_0076663 3300037471 Bacteria 3133
477 Ga0436364_0806484 3300037853 Bacteria 19382
478 Ga0395901_0037265 3300038443 Bacteria 5030
479 Ga0400484_02195 3300038725 Bacteria 9346
480 Ga0400484_03438 3300038725 Bacteria 12206
481 Ga0400484_11101 3300038725 Bacteria 1448
482 Ga0400484_27474 3300038725 Bacteria 17898
483 Ga0400484_41208 3300038725 Bacteria 3490
484 Ga0400490_12730 3300038726 Bacteria 19745
485 Ga0400490_18697 3300038726 Bacteria 9985
486 Ga0400490_28075 3300038726 Bacteria 10056
487 Ga0400490_28970 3300038726 Bacteria 3254
488 Ga0400490_35425 3300038726 Bacteria 1271
489 Ga0400490_44655 3300038726 Bacteria 35811
490 Ga0400491_01623 3300038727 Bacteria 2992
491 Ga0400491_02495 3300038727 Bacteria 9012
492 Ga0400491_05049 3300038727 Bacteria 6396
493 Ga0400485_15985 3300038735 Bacteria 9406
494 Ga0400485_16813 3300038735 Bacteria 2248
495 Ga0400488_14323 3300038741 Bacteria 4751
496 Ga0400488_31351 3300038741 Bacteria 2936
497 Ga0400488_46139 3300038741 Bacteria 4275
498 Ga0400486_00212 3300038742 Bacteria 8219
499 Ga0400486_09197 3300038742 Bacteria 9853
500 Ga0400486_25697 3300038742 Bacteria 8389
501 Ga0400483_008145 3300039062 Bacteria 29202
502 Ga0400483_011703 3300039062 Bacteria 5250
503 Ga0400483_019410 3300039062 Bacteria 16630
504 Ga0400483_026308 3300039062 Bacteria 223136
505 Ga0400483_066608 3300039062 Unclassified 4418
506 Ga0400483_101968 3300039062 Bacteria 7764
507 Ga0400483_121452 3300039062 Bacteria 46379
508 Ga0400483_160770 3300039062 Bacteria 4359
509 Ga0400483_231691 3300039062 Bacteria 15751
510 Ga0400483_242187 3300039062 Bacteria 26595
511 Ga0400483_250036 3300039062 Bacteria 396353
512 Ga0400487_07919 3300039110 Bacteria 8190
513 Ga0400487_16416 3300039110 Bacteria 12461
514 Ga0400487_31396 3300039110 Bacteria 5882
515 Ga0400487_32316 3300039110 Bacteria 43418
516 Ga0400487_33913 3300039110 Bacteria 1933
517 Ga0400487_43717 3300039110 Bacteria 2703
518 Ga0436365_1290723 3300039437 Bacteria 2839
519 Ga0436360_0862198 3300039438 Bacteria 4494
520 Ga0436360_1075771 3300039438 Bacteria 3318
521 Ga0436363_1591010 3300039450 Bacteria 2553
522 Ga0436362_0492786 3300039453 Bacteria 1160
523 Ga0451793_1504300 3300041452 Bacteria 2056
524 Ga0439441_016760 3300042001 Bacteria 1309
525 Ga0439464_0004055 3300042439 Bacteria 3727
526 Ga0495603_0031623 3300046455 Bacteria 3186
527 Ga0495603_0135071 3300046455 Bacteria 1436
528 Ga0495580_0124478 3300046472 Bacteria 1789
529 Ga0495594_0019507 3300046499 Bacteria 3603
530 Ga0495596_0037862 3300046500 Bacteria 1907
531 Ga0495661_0023562 3300046665 Bacteria 3995
532 Ga0495588_0016257 3300046674 Bacteria 3595
533 Ga0495647_0044682 3300046681 Bacteria 1700
534 Ga0495624_0012723 3300046690 Bacteria 5747
535 Ga0495676_0009475 3300047321 Bacteria 8871
536 Ga0496100_0008089 3300048903 Bacteria 5849
537 Ga0496100_0133496 3300048903 Bacteria 1751
538 Ga0496100_0159354 3300048903 Bacteria 1617
539 Ga0496101_0019088 3300048904 Bacteria 4673
540 Ga0496102_0001715 3300048905 Bacteria 19171
541 Ga0496102_0007329 3300048905 Bacteria 9419
542 Ga0496102_0111293 3300048905 Bacteria 2553
543 Ga0496102_0279074 3300048905 Bacteria 1575
544 Ga0496103_0014639 3300048906 Bacteria 4661
545 Ga0496103_0115346 3300048906 Bacteria 1708
546 Ga0496104_0090857 3300048907 Bacteria 2918
547 Ga0496104_0115345 3300048907 Bacteria 2577
548 Ga0496105_0061165 3300048908 Bacteria 3107
549 Ga0496105_0081208 3300048908 Unclassified 2678
550 Ga0496106_0000984 3300048909 Bacteria 20785
551 Ga0496106_0127080 3300048909 Bacteria 1997
552 Ga0496107_0004801 3300048910 Bacteria 9178
553 Ga0496108_0006190 3300048911 Bacteria 9687
554 Ga0496108_0015846 3300048911 Bacteria 6145
555 Ga0496108_0198722 3300048911 Bacteria 1740
556 Ga0496109_0010401 3300048912 Bacteria 7946
557 Ga0496109_0017886 3300048912 Bacteria 6220
558 Ga0496109_0019579 3300048912 Bacteria 5970
559 Ga0496109_0033530 3300048912 Bacteria 4619
560 Ga0496109_0053262 3300048912 Bacteria 3690
561 Ga0496110_0009089 3300048913 Bacteria 8019
562 Ga0496110_0014110 3300048913 Bacteria 6624
563 Ga0496110_0038234 3300048913 Bacteria 4174
564 Ga0496110_0038666 3300048913 Unclassified 4153
565 Ga0496110_0200188 3300048913 Bacteria 1815
566 Ga0496112_0010993 3300048915 Bacteria 8246
567 Ga0496112_0022087 3300048915 Bacteria 6060
568 Ga0496112_0122800 3300048915 Bacteria 2567
569 Ga0496113_0003395 3300048916 Bacteria 9525
570 Ga0496113_0006566 3300048916 Bacteria 7388
571 Ga0496114_0089331 3300048917 Bacteria 2615
572 Ga0496115_0025269 3300048918 Bacteria 4624
573 Ga0496123_0019054 3300048926 Bacteria 5419
574 Ga0496124_0112910 3300048927 Bacteria 2184
575 Ga0496125_0009317 3300048928 Bacteria 10123
576 Ga0501031_0053326 3300049568 Bacteria 2635
577 Ga0501033_0009077 3300049570 Bacteria 7670
578 Ga0501036_0007997 3300049572 Bacteria 8655
579 Ga0501036_0093383 3300049572 Bacteria 2542
580 Ga0501037_0000284 3300049573 Bacteria 42983
581 Ga0501038_0000436 3300049574 Bacteria 36343
582 Ga0501038_0017669 3300049574 Bacteria 6447
583 Ga0501038_0328514 3300049574 Bacteria 1195
584 Ga0501039_0002468 3300049575 Bacteria 13771
585 Ga0501039_0023394 3300049575 Bacteria 4742
586 Ga0501040_0162534 3300049576 Bacteria 1579
587 Ga0501043_0001230 3300049579 Bacteria 22592
588 Ga0501047_0068392 3300049581 Bacteria 3421
589 Ga0501048_0102210 3300049582 Bacteria 2022
590 Ga0501048_0106464 3300049582 Bacteria 1979
591 Ga0501067_0036777 3300049583 Bacteria 2718
592 Ga0501069_0154027 3300049585 Bacteria 1322
593 Ga0501070_0001556 3300049586 Bacteria 20405
594 Ga0501076_0087117 3300049592 Bacteria 2510
595 Ga0501035_0115515 3300049822 Bacteria 2349
596 Ga0501044_0037087 3300049823 Bacteria 5097
597 Ga0501044_0048744 3300049823 Bacteria 4374
598 Ga0501044_0193968 3300049823 Bacteria 1992
599 Ga0501045_0027613 3300049824 Bacteria 4092
600 nmdc:mga0k408_45183_c1 3300050493 Bacteria 2541
601 nmdc:mga07m45_3860_c1 3300050496 Bacteria 7264
602 nmdc:mga05p37_34525_c1 3300050507 Bacteria 6195
603 nmdc:mga05p37_51_c1 3300050507 Bacteria 103396
604 nmdc:mga05p37_9671_c1 3300050507 Bacteria 11428
605 nmdc:mga09592_7514_c1 3300050508 Bacteria 8867
606 nmdc:mga06r32_16_c1 3300050510 Bacteria 101899
607 nmdc:mga08y16_11143_c1 3300050511 Bacteria 9441
608 nmdc:mga08y16_11371_c1 3300050511 Bacteria 9352
609 nmdc:mga08y16_497432_c1 3300050511 Bacteria 1239
610 nmdc:mga08y16_500300_c1 3300050511 Bacteria 1235
611 nmdc:mga08y16_79_c2 3300050511 Bacteria 54400
612 nmdc:mga0n895_12914_c1 3300050512 Bacteria 7508
613 nmdc:mga0n895_38306_c1 3300050512 Bacteria 4644
614 nmdc:mga0rr50_14727_c1 3300050513 Bacteria 5141
615 nmdc:mga0rr50_7870_c1 3300050513 Bacteria 6610
616 nmdc:mga08x19_14089_c1 3300050514 Bacteria 4845
617 nmdc:mga0a205_35289_c1 3300050515 Bacteria 4801
618 nmdc:mga0a205_65630_c1 3300050515 Bacteria 3507
619 2545675272 2545555834 Bacteria 8130841
620 641641094 641522639 Bacteria 7737025
621 Ga0496114_0023026
622 Ga0065712_10079221
623 Ga0065715_10112976
624 Ga0065715_10125533
625 Ga0070676_10030873
626 Ga0070676_10191428
627 Ga0070683_100004260
628 Ga0070683_100116386
629 Ga0070683_100162797
630 Ga0070690_100012332
631 Ga0070670_100001453
632 Ga0070670_100006544
633 Ga0070670_100105316
634 Ga0070677_10033963
635 Ga0068869_100000658
636 Ga0068869_100029163
637 Ga0068869_100029977
638 Ga0068869_100038633
639 Ga0068869_100064088
640 Ga0070666_10010431
641 Ga0070666_10108298
642 Ga0068868_100028101
643 Ga0068868_100048355
644 Ga0068868_100059736
645 Ga0070689_100003136
646 Ga0070689_100102126
647 Ga0070689_100146716
648 Ga0070668_100006363
649 Ga0070668_100014263
650 Ga0070668_100068545
651 Ga0070669_100018367
652 Ga0070669_100021829
653 Ga0070669_100024472
654 Ga0070669_100043547
655 Ga0070669_100136204
656 Ga0070675_100000867
657 Ga0070675_100006150
658 Ga0070675_100015917
659 Ga0070675_100110924
660 Ga0070671_100001394
661 Ga0070671_100001982
662 Ga0070671_100040583
663 Ga0070671_100075608
664 Ga0070671_100105609
665 Ga0070671_100147446
666 Ga0070671_100158703
667 Ga0070674_100099959
668 Ga0070674_100125075
669 Ga0070673_100000636
670 Ga0070673_100015692
671 Ga0070673_100052452
672 Ga0070673_100125363
673 Ga0070673_100216894
674 Ga0070673_100261068
675 Ga0070688_100074325
676 Ga0070688_100120028
677 Ga0070667_100035965
678 Ga0070667_100057405
679 Ga0070713_100174168
680 Ga0070708_100053873
681 Ga0070678_100005995
682 Ga0070678_100056512
683 Ga0070678_100115311
684 Ga0070662_100022323
685 Ga0070662_100082786
686 Ga0070662_100103016
687 Ga0070662_100124086
688 Ga0068867_100000943
689 Ga0068867_100008734
690 Ga0068867_100022606
691 Ga0068867_100110048
692 Ga0068867_100167687
693 Ga0070685_10089773
694 Ga0070685_10110701
695 Ga0070706_100024698
696 Ga0070698_100244995
697 Ga0070699_100032178
698 Ga0070699_100038672
699 Ga0070684_100063906
700 Ga0070684_100096321
701 Ga0070697_100004899
702 Ga0070697_100149160
703 Ga0068853_100398883
704 Ga0070672_100000883
705 Ga0070672_100002149
706 Ga0070672_100035363
707 Ga0070672_100051690
708 Ga0070672_100062447
709 Ga0070672_100105170
710 Ga0070672_100117373
711 Ga0070672_100134358
712 Ga0070672_100146601
713 Ga0070672_100227019
714 Ga0070672_100288083
715 Ga0070686_100016626
716 Ga0070696_100038217
717 Ga0070665_100026118
718 Ga0070665_100037031
719 Ga0070665_100101995
720 Ga0070665_100102315
721 Ga0070664_100058167
722 Ga0070664_100239439
723 Ga0070664_100278865
724 Ga0068857_100003951
725 Ga0068857_100070891
726 Ga0068854_100075399
727 Ga0068852_100011458
728 Ga0068859_100010428
729 Ga0068859_100011716
730 Ga0068859_100032168
731 Ga0068859_100264767
732 Ga0068864_100000531
733 Ga0068864_100002136
734 Ga0068864_100015192
735 Ga0068864_100070114
736 Ga0068866_10052668
737 Ga0068866_10087698
738 Ga0068861_100009062
739 Ga0068861_100014585
740 Ga0068861_100287165
741 Ga0068851_10086500
742 Ga0068851_10092001
743 Ga0068870_10004001
744 Ga0068870_10023269
745 Ga0068870_10080899
746 Ga0068863_100001722
747 Ga0068863_100003233
748 Ga0068863_100015344
749 Ga0068863_100036433
750 Ga0068863_100240627
751 Ga0068858_100021205
752 Ga0068860_100160427
753 Ga0068860_100233654
754 Ga0068860_100368787
755 Ga0068862_100009144
756 Ga0068862_100091750
757 Ga0070717_10043752
758 Ga0075432_10016231
759 Ga0075366_10018676
760 Ga0075366_10036643
761 Ga0097621_100062407
762 Ga0097621_100070253
763 Ga0097621_100244669
764 Ga0075370_10003416
765 Ga0068871_100012244
766 Ga0068871_100119175
767 Ga0075428_100030246
768 Ga0075428_100084890
769 Ga0075431_100000305
770 Ga0075434_100014844
771 Ga0075434_100036671
772 Ga0075434_100044568
773 Ga0075429_100008764
774 Ga0075429_100042233
775 Ga0068865_100014338
776 Ga0075436_100047347
777 Ga0097620_100010429
778 Ga0097620_100011716
779 Ga0097620_100032169
780 Ga0097620_100264762
781 Ga0105251_10005484
782 Ga0111539_10000072
783 Ga0111539_10006114
784 Ga0111539_10010175
785 Ga0111539_10074439
786 Ga0111539_10193944
787 Ga0105245_10013889
788 Ga0105245_10070987
789 Ga0105245_10130890
790 Ga0105247_10037030
791 Ga0105247_10081447
792 Ga0114129_10000134
793 Ga0114129_10092735
794 Ga0105243_10026088
795 Ga0105243_10058050
796 Ga0105243_10099430
797 Ga0105241_10156290
798 Ga0105248_10014971
799 Ga0105248_10017014
800 Ga0105248_10058646
801 Ga0105248_10061244
802 Ga0105248_10076679
803 Ga0105248_10121409
804 Ga0105237_10001612
805 Ga0105238_10088353
806 Ga0105238_10134723
807 Ga0105238_10453605
808 Ga0105249_10056690
809 Ga0105239_10001663
810 Ga0105239_10544441
811 Ga0105246_10032883
812 Ga0105246_10044600
813 Ga0105246_10151969
814 Ga0105246_10158782
815 Ga0105246_10190393
816 Ga0157371_10108175
817 Ga0157374_10048069
818 Ga0157374_10067567
819 Ga0157374_10167187
820 Ga0157374_10224212
821 Ga0157378_10007650
822 Ga0157378_10044905
823 Ga0157378_10156800
824 Ga0157378_10244611
825 Ga0157378_10305300
826 Ga0163162_10007507
827 Ga0163162_10055129
828 Ga0163162_10078772
829 Ga0163162_10133501
830 Ga0163162_10298659
831 Ga0163162_10581543
832 Ga0157375_10011120
833 Ga0157375_10053186
834 Ga0157375_10070832
835 Ga0157375_10154877
836 Ga0163163_10000768
837 Ga0163163_10003121
838 Ga0163163_10004780
839 Ga0163163_10132363
840 Ga0157380_10024617
841 Ga0157380_10113857
842 Ga0157379_10000156
843 Ga0157379_10041261
844 Ga0157379_10056307
845 Ga0157379_10173090
846 Ga0163161_10023947
847 Ga0163161_10048800
848 Ga0163161_10200697
849 Ga0163161_10202947
850 Ga0213875_10004217
851 Ga0207697_10002074
852 Ga0207656_10005166
853 Ga0207656_10060575
854 Ga0207713_1031020
855 Ga0207682_10001704
856 Ga0207688_10034876
857 Ga0207688_10054178
858 Ga0207688_10130143
859 Ga0207680_10001914
860 Ga0207680_10002597
861 Ga0207680_10089514
862 Ga0207680_10199531
863 Ga0207645_10000414
864 Ga0207645_10016052
865 Ga0207645_10083039
866 Ga0207643_10002598
867 Ga0207643_10032008
868 Ga0207643_10032414
869 Ga0207643_10041464
870 Ga0207643_10062626
871 Ga0207654_10093020
872 Ga0207695_10013032
873 Ga0207671_10001301
874 Ga0207693_10102183
875 Ga0207662_10004844
876 Ga0207681_10016714
877 Ga0207681_10050422
878 Ga0207694_10103787
879 Ga0207694_10113807
880 Ga0207650_10000323
881 Ga0207650_10013374
882 Ga0207659_10000751
883 Ga0207659_10001308
884 Ga0207659_10077569
885 Ga0207659_10136742
886 Ga0207687_10005059
887 Ga0207687_10030806
888 Ga0207664_10084831
889 Ga0207644_10009313
890 Ga0207644_10011403
891 Ga0207644_10026747
892 Ga0207644_10211926
893 Ga0207706_10003772
894 Ga0207706_10006828
895 Ga0207706_10022080
896 Ga0207686_10151926
897 Ga0207709_10200934
898 Ga0207670_10085382
899 Ga0207669_10007003
900 Ga0207669_10036429
901 Ga0207669_10058167
902 Ga0207669_10083484
903 Ga0207669_10086706
904 Ga0207669_10104730
905 Ga0207669_10264131
906 Ga0207704_10024664
907 Ga0207665_10000931
908 Ga0207691_10002236
909 Ga0207691_10008903
910 Ga0207691_10020011
911 Ga0207691_10034179
912 Ga0207691_10076184
913 Ga0207691_10114932
914 Ga0207691_10149331
915 Ga0207691_10215323
916 Ga0207691_10290006
917 Ga0207711_10004936
918 Ga0207711_10200609
919 Ga0207711_10219875
920 Ga0207689_10000065
921 Ga0207689_10012718
922 Ga0207689_10025421
923 Ga0207661_10007541
924 Ga0207661_10024120
925 Ga0207679_10195162
926 Ga0207651_10000398
927 Ga0207651_10016929
928 Ga0207651_10030751
929 Ga0207651_10108756
930 Ga0207712_10032842
931 Ga0207712_10083417
932 Ga0207668_10003961
933 Ga0207668_10006172
934 Ga0207668_10010608
935 Ga0207668_10137248
936 Ga0207668_10263941
937 Ga0207658_10002681
938 Ga0207658_10003363
939 Ga0207658_10082805
940 Ga0207658_10100963
941 Ga0207677_10016464
942 Ga0207677_10039051
943 Ga0207703_10000794
944 Ga0207703_10002510
945 Ga0207703_10009555
946 Ga0207639_10047316
947 Ga0207678_10020501
948 Ga0207678_10094755
949 Ga0207708_10019833
950 Ga0207708_10074393
951 Ga0207708_10099949
952 Ga0207641_10028567
953 Ga0207641_10058104
954 Ga0207641_10091252
955 Ga0207641_10320542
956 Ga0207648_10000762
957 Ga0207648_10006353
958 Ga0207648_10011107
959 Ga0207648_10014587
960 Ga0207648_10045635
961 Ga0207648_10063788
962 Ga0207648_10070349
963 Ga0207676_10000082
964 Ga0207676_10001002
965 Ga0207676_10001071
966 Ga0207676_10091549
967 Ga0207676_10184115
968 Ga0207676_10339954
969 Ga0207674_10008442
970 Ga0207674_10072773
971 Ga0207674_10119163
972 Ga0207674_10144291
973 Ga0207675_100002547
974 Ga0207675_100007248
975 Ga0207675_100015907
976 Ga0207675_100018121
977 Ga0207675_100018316
978 Ga0207675_100101351
979 Ga0207675_100276684
980 Ga0207683_10009352
981 Ga0207683_10014545
982 Ga0207683_10015187
983 Ga0207683_10049483
984 Ga0207683_10134736
985 Ga0207683_10315185
986 Ga0207698_10051194
987 Ga0207428_10001757
988 Ga0207428_10024725
989 Ga0268266_10012936
990 Ga0268266_10085514
991 Ga0268266_10168687
992 Ga0268265_10020365
993 Ga0268265_10033735
994 Ga0268264_10000535
995 Ga0268264_10044435
996 Ga0307515_10088540
997 Ga0307408_100187699
998 Ga0316575_10000755
999 Ga0316575_10015929
1000 Ga0316575_10016794
1001 Ga0316575_10029740
1002 Ga0316579_10000040
1003 Ga0316579_10001650
1004 Ga0316579_10007205
1005 Ga0316576_10002652
1006 Ga0316576_10004911
1007 Ga0316576_10007946
1008 Ga0316576_10027939
1009 Ga0316576_10029089
1010 Ga0316576_10085932
1011 Ga0316576_10128213
1012 Ga0316576_10228674
1013 Ga0316578_10000080
1014 Ga0316578_10002614
1015 Ga0316578_10005625
1016 Ga0316578_10020106
1017 Ga0316578_10021315
1018 Ga0316578_10059878
1019 Ga0316578_10062085
1020 Ga0316578_10095795
1021 Ga0307516_10003397
1022 Ga0307516_10152781
1023 Ga0316577_10000081
1024 Ga0316577_10000177
1025 Ga0316577_10000769
1026 Ga0316577_10002085
1027 Ga0316577_10094359
1028 Ga0316577_10111829
1029 Ga0307412_10118354
1030 Ga0307416_100083381
1031 Ga0307416_100278165
1032 Ga0307411_10003702
1033 Ga0316585_10000066
1034 Ga0316585_10000855
1035 Ga0316585_10001399
1036 Ga0316585_10018724
1037 Ga0316580_10000055
1038 Ga0316580_10000198
1039 Ga0316580_10000931
1040 Ga0316580_10005847
1041 Ga0316580_10028971
1042 Ga0316580_10049116
1043 Ga0316593_10000155
1044 Ga0316593_10005894
1045 Ga0316593_10007281
1046 Ga0316593_10007863
1047 Ga0316593_10017565
1048 Ga0316593_10046206
1049 Ga0316593_10054902
1050 Ga0316592_1001736
1051 Ga0316592_1003080
1052 Ga0316592_1005521
1053 Ga0316592_1007464
1054 Ga0316592_1010208
1055 Ga0316586_1000706
1056 Ga0316586_1003537
1057 Ga0316586_1010740
1058 Ga0316588_1000121
1059 Ga0316588_1000267
1060 Ga0316588_1003276
1061 Ga0316588_1004996
1062 Ga0316588_1012306
1063 Ga0316587_1001085
1064 Ga0316587_1001824
1065 Ga0316587_1002183
1066 Ga0316596_1001013
1067 Ga0316596_1006146
1068 Ga0316596_1007675
1069 Ga0316596_1010871
1070 Ga0316596_1011035
1071 Ga0316596_1014659
1072 Ga0316574_0000001
1073 Ga0316574_0003594
1074 Ga0316574_0008005
1075 Ga0316574_0015175
1076 Ga0316574_0018746
1077 Ga0316574_0022161
1078 Ga0316574_0066242
1079 Ga0373927_0037337
1080 Ga0373947_0139389
1081 Ga0316582_0000003
1082 Ga0316582_0008153
1083 Ga0316582_0014699
1084 Ga0316582_0016559
1085 Ga0316584_0000037
1086 Ga0316584_0005084
1087 Ga0316584_0023709
1088 Ga0316584_0030253
1089 Ga0316584_0034538
1090 Ga0316584_0065575
1091 Ga0316584_0141961
1092 Ga0316584_0289396
1093 Ga0373925_0009439
1094 Ga0373925_0050457
1095 Ga0395898_0122482
1096 Ga0395905_0076663
1097 Ga0436364_0806484
1098 Ga0395901_0037265
1099 Ga0400484_02195
1100 Ga0400484_03438
1101 Ga0400484_11101
1102 Ga0400484_27474
1103 Ga0400484_41208
1104 Ga0400490_12730
1105 Ga0400490_18697
1106 Ga0400490_28075
1107 Ga0400490_28970
1108 Ga0400490_35425
1109 Ga0400490_44655
1110 Ga0400491_01623
1111 Ga0400491_02495
1112 Ga0400491_05049
1113 Ga0400485_15985
1114 Ga0400485_16813
1115 Ga0400488_14323
1116 Ga0400488_31351
1117 Ga0400488_46139
1118 Ga0400486_00212
1119 Ga0400486_09197
1120 Ga0400486_25697
1121 Ga0400483_008145
1122 Ga0400483_011703
1123 Ga0400483_019410
1124 Ga0400483_026308
1125 Ga0400483_066608
1126 Ga0400483_101968
1127 Ga0400483_121452
1128 Ga0400483_160770
1129 Ga0400483_231691
1130 Ga0400483_242187
1131 Ga0400483_250036
1132 Ga0400487_07919
1133 Ga0400487_16416
1134 Ga0400487_31396
1135 Ga0400487_32316
1136 Ga0400487_33913
1137 Ga0400487_43717
1138 Ga0436365_1290723
1139 Ga0436360_0862198
1140 Ga0436360_1075771
1141 Ga0436363_1591010
1142 Ga0436362_0492786
1143 Ga0451793_1504300
1144 Ga0439441_016760
1145 Ga0439464_0004055
1146 Ga0495603_0031623
1147 Ga0495603_0135071
1148 Ga0495580_0124478
1149 Ga0495594_0019507
1150 Ga0495596_0037862
1151 Ga0495661_0023562
1152 Ga0495588_0016257
1153 Ga0495647_0044682
1154 Ga0495624_0012723
1155 Ga0495676_0009475
1156 Ga0496100_0008089
1157 Ga0496100_0133496
1158 Ga0496100_0159354
1159 Ga0496101_0019088
1160 Ga0496102_0001715
1161 Ga0496102_0007329
1162 Ga0496102_0111293
1163 Ga0496102_0279074
1164 Ga0496103_0014639
1165 Ga0496103_0115346
1166 Ga0496104_0090857
1167 Ga0496104_0115345
1168 Ga0496105_0061165
1169 Ga0496105_0081208
1170 Ga0496106_0000984
1171 Ga0496106_0127080
1172 Ga0496107_0004801
1173 Ga0496108_0006190
1174 Ga0496108_0015846
1175 Ga0496108_0198722
1176 Ga0496109_0010401
1177 Ga0496109_0017886
1178 Ga0496109_0019579
1179 Ga0496109_0033530
1180 Ga0496109_0053262
1181 Ga0496110_0009089
1182 Ga0496110_0014110
1183 Ga0496110_0038234
1184 Ga0496110_0038666
1185 Ga0496110_0200188
1186 Ga0496112_0010993
1187 Ga0496112_0022087
1188 Ga0496112_0122800
1189 Ga0496113_0003395
1190 Ga0496113_0006566
1191 Ga0496114_0089331
1192 Ga0496115_0025269
1193 Ga0496123_0019054
1194 Ga0496124_0112910
1195 Ga0496125_0009317
1196 Ga0501031_0053326
1197 Ga0501033_0009077
1198 Ga0501036_0007997
1199 Ga0501036_0093383
1200 Ga0501037_0000284
1201 Ga0501038_0000436
1202 Ga0501038_0017669
1203 Ga0501038_0328514
1204 Ga0501039_0002468
1205 Ga0501039_0023394
1206 Ga0501040_0162534
1207 Ga0501043_0001230
1208 Ga0501047_0068392
1209 Ga0501048_0102210
1210 Ga0501048_0106464
1211 Ga0501067_0036777
1212 Ga0501069_0154027
1213 Ga0501070_0001556
1214 Ga0501076_0087117
1215 Ga0501035_0115515
1216 Ga0501044_0037087
1217 Ga0501044_0048744
1218 Ga0501044_0193968
1219 Ga0501045_0027613
1220 nmdc:mga0k408_45183_c1
1221 nmdc:mga07m45_3860_c1
1222 nmdc:mga05p37_34525_c1
1223 nmdc:mga05p37_51_c1
1224 nmdc:mga05p37_9671_c1
1225 nmdc:mga09592_7514_c1
1226 nmdc:mga06r32_16_c1
1227 nmdc:mga08y16_11143_c1
1228 nmdc:mga08y16_11371_c1
1229 nmdc:mga08y16_497432_c1
1230 nmdc:mga08y16_500300_c1
1231 nmdc:mga08y16_79_c2
1232 nmdc:mga0n895_12914_c1
1233 nmdc:mga0n895_38306_c1
1234 nmdc:mga0rr50_14727_c1
1235 nmdc:mga0rr50_7870_c1
1236 nmdc:mga08x19_14089_c1
1237 nmdc:mga0a205_35289_c1
1238 nmdc:mga0a205_65630_c1
1239 2545675272
1240 641641094

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07167

PhaC_N

Poly-beta-hydroxybutyrate polymerase (PhaC) N-terminus

46

126

0.95

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

99

376

0.83

PF11339

DUF3141

Protein of unknown function (DUF3141)

118

386

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xav-assembly1.cif.gz_A structure of phac from chromobacterium sp. usm2 0.86 40 344
6k3c-assembly1.cif.gz_A crystal structure of class i pha synthase (phac) mutant from chromobacterium sp. usm2 bound to coenzyme a. 0.8368 40 343
5xav-assembly1.cif.gz_B structure of phac from chromobacterium sp. usm2 0.8355 33 347
4ke6-assembly5.cif.gz_E crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol 0.7699 56 367
5t6o-assembly1.cif.gz_A structure of the catalytic domain of the class i polyhydroxybutyrate synthase from cupriavidus necator 0.769 33 344
ID Description Score Start End Superfamily
af_O33185_49_361_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8309 42 363 3.40.50.1820
af_O33185_49_361_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8237 42 363 3.40.50.1820
af_P47139_288_444_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7997 107 178 3.40.50.1820
4ke6E00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7699 56 367 3.40.50.1820
af_P41879_205_425_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7455 54 179 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A5C1B763-F1-model_v4 Poly(3-hydroxyalkanoate) polymerase subunit PhaC (PHB synthase subunit PhaC) 0.9749 12 366 GO:0016746
GO:0042619
AF-A0A7V0MEY8-F1-model_v4 Poly(3-hydroxyalkanoate) polymerase subunit PhaC (PHB synthase subunit PhaC) 0.9732 37 366 GO:0016020
GO:0016746
GO:0042619
AF-V4F8M5-F1-model_v4 deleted 0.9723 112 366
AF-A0A2A4QME6-F1-model_v4 Class III poly(R)-hydroxyalkanoic acid synthase subunit PhaC 0.9709 12 366
AF-A0A2A4NJ51-F1-model_v4 Class III poly(R)-hydroxyalkanoic acid synthase subunit PhaC 0.9699 10 366

Map