F469979

General Info

Members Datasets Scaffolds Average Seq Length
621 271 1242 140

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100486512|Ga0070660_1004865122
Length 162
Sequence MAMSVGRDDGGDENPPMNEINTTPLVDVMLVLLIIFLITVPAIIQKVPVTLPKVVLEPTTTKPENVSLSIRVAANGTCEIYWNMTKVNATQLINLAVNKLRYEIKKQEAAGLPIELPEAHIRGDINTPYRCIGGAIFTMQRAGFARVGFISEPPAGYVVERI

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
143 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
144 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
145 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
146 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
147 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
163 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
164 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
167 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
175 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
176 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
206 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
207 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
208 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
209 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
210 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
211 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
212 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
226 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
227 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
228 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
229 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
230 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
231 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
232 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
233 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
234 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
235 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
236 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
237 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
238 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
239 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
240 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
241 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
242 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
243 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
244 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
245 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
246 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
247 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
248 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
249 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
250 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
251 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
252 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
255 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
256 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
257 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
258 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
261 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
264 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
265 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
266 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.04
Metatranscriptomes 5.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.38
Nodule 0
Rhizoplane 2.74
Rhizosphere 90.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100486512 3300005339 Bacteria 1026
2 LJQas_1004675 3300000549 Bacteria 1772
3 JGI24736J21556_1000004 3300001904 Bacteria 55308
4 JGI24741J21665_1033400 3300001915 Bacteria 766
5 JGI24741J21665_1037154 3300001915 Bacteria 721
6 JGI24752J21851_1009398 3300001976 Bacteria 1276
7 JGI24740J21852_10007386 3300001979 Bacteria 4471
8 JGI24740J21852_10010426 3300001979 Bacteria 3578
9 JGI24739J22299_10006755 3300001989 Bacteria 4321
10 JGI24739J22299_10023402 3300001989 Bacteria 2184
11 JGI24737J22298_10075513 3300001990 Bacteria 1005
12 JGI24737J22298_10080964 3300001990 Bacteria 966
13 JGI24735J21928_10102841 3300002067 Bacteria 821
14 JGI24750J21931_1000944 3300002070 Bacteria 3877
15 JGI24748J21848_1000032 3300002074 Bacteria 79791
16 JGI24738J21930_10000860 3300002075 Bacteria 8715
17 JGI24738J21930_10003947 3300002075 Bacteria 3691
18 JGI24738J21930_10007434 3300002075 Bacteria 2527
19 JGI24749J21850_1035962 3300002076 Bacteria 718
20 JGI24033J26618_1030503 3300002155 Bacteria 724
21 JGI24034J26672_10000022 3300002239 Bacteria 116342
22 JGI24034J26672_10047531 3300002239 Bacteria 732
23 JGI24742J22300_10065162 3300002244 Bacteria 673
24 JGI25405J52794_10004639 3300003911 Bacteria 2455
25 Ga0058859_11554536 3300004798 Bacteria 1362
26 Ga0065714_10029661 3300005288 Bacteria 1125
27 Ga0065714_10167068 3300005288 Bacteria 1022
28 Ga0065704_10084208 3300005289 Bacteria 3365
29 Ga0065704_10234281 3300005289 Bacteria 1034
30 Ga0065715_10300489 3300005293 Bacteria 1042
31 Ga0065715_10794117 3300005293 Bacteria 612
32 Ga0065715_11009482 3300005293 Bacteria 543
33 Ga0065707_10087564 3300005295 Bacteria 4980
34 Ga0065707_10404062 3300005295 Bacteria 849
35 Ga0065707_10816385 3300005295 Bacteria 592
36 Ga0070658_10007974 3300005327 Bacteria 8521
37 Ga0070658_10012095 3300005327 Bacteria 6929
38 Ga0070690_100000038 3300005330 Bacteria 60092
39 Ga0070670_100000021 3300005331 Bacteria 202776
40 Ga0070670_100001557 3300005331 Bacteria 18488
41 Ga0070670_100064435 3300005331 Bacteria 3144
42 Ga0070670_100136520 3300005331 Bacteria 2119
43 Ga0070670_100460596 3300005331 Bacteria 1128
44 Ga0070677_10001055 3300005333 Bacteria 8881
45 Ga0070677_10043015 3300005333 Bacteria 1792
46 Ga0070666_10000002 3300005335 Bacteria 478684
47 Ga0070680_100194871 3300005336 Bacteria 1708
48 Ga0070682_100416709 3300005337 Bacteria 1020
49 Ga0070660_100109413 3300005339 Bacteria 2197
50 Ga0070660_100985885 3300005339 Bacteria 712
51 Ga0070661_100027200 3300005344 Bacteria 4117
52 Ga0070661_100048780 3300005344 Bacteria 3100
53 Ga0070668_100000005 3300005347 Bacteria 187511
54 Ga0070668_100099042 3300005347 Bacteria 2308
55 Ga0070668_100136916 3300005347 Bacteria 1970
56 Ga0070668_100339080 3300005347 Bacteria 1269
57 Ga0070668_100455169 3300005347 Bacteria 1101
58 Ga0070669_100000237 3300005353 Bacteria 45913
59 Ga0070669_100082855 3300005353 Bacteria 2392
60 Ga0070675_100000201 3300005354 Bacteria 37824
61 Ga0070671_100000069 3300005355 Bacteria 67279
62 Ga0070671_100000091 3300005355 Bacteria 58077
63 Ga0070671_100017355 3300005355 Bacteria 5828
64 Ga0070671_100068843 3300005355 Bacteria 2952
65 Ga0070671_100239399 3300005355 Bacteria 1540
66 Ga0070671_100506508 3300005355 Bacteria 1039
67 Ga0070674_100068973 3300005356 Bacteria 2493
68 Ga0070674_100085075 3300005356 Bacteria 2269
69 Ga0070673_100100626 3300005364 Bacteria 2380
70 Ga0070673_100181571 3300005364 Bacteria 1802
71 Ga0070659_100045648 3300005366 Bacteria 3433
72 Ga0070659_100854071 3300005366 Bacteria 794
73 Ga0070667_100000004 3300005367 Bacteria 444091
74 Ga0070667_100000750 3300005367 Bacteria 30912
75 Ga0070667_100042896 3300005367 Bacteria 3795
76 Ga0070667_100218550 3300005367 Bacteria 1696
77 Ga0070663_100077899 3300005455 Bacteria 2428
78 Ga0070662_100001625 3300005457 Bacteria 13862
79 Ga0070662_100059818 3300005457 Bacteria 2776
80 Ga0070662_100140835 3300005457 Bacteria 1869
81 Ga0070662_100227256 3300005457 Bacteria 1491
82 Ga0070681_10403193 3300005458 Bacteria 1279
83 Ga0070685_10000425 3300005466 Bacteria 24783
84 Ga0070698_101153562 3300005471 Bacteria 724
85 Ga0070684_100268509 3300005535 Bacteria 1561
86 Ga0068853_100001339 3300005539 Bacteria 17745
87 Ga0068853_100051305 3300005539 Bacteria 3550
88 Ga0068853_100213079 3300005539 Bacteria 1761
89 Ga0070672_100000850 3300005543 Bacteria 18272
90 Ga0070672_100199315 3300005543 Bacteria 1674
91 Ga0070686_100000003 3300005544 Bacteria 308397
92 Ga0070693_100399196 3300005547 Bacteria 953
93 Ga0070665_100000036 3300005548 Bacteria 314603
94 Ga0070665_100000773 3300005548 Bacteria 42151
95 Ga0070665_100083502 3300005548 Bacteria 3199
96 Ga0068855_100457039 3300005563 Bacteria 1393
97 Ga0068855_101298210 3300005563 Bacteria 753
98 Ga0070664_100000322 3300005564 Bacteria 34843
99 Ga0070664_100037606 3300005564 Bacteria 4069
100 Ga0070664_100351742 3300005564 Bacteria 1340
101 Ga0070664_100555531 3300005564 Bacteria 1062
102 Ga0068857_100016950 3300005577 Bacteria 6383
103 Ga0068857_100397907 3300005577 Bacteria 1281
104 Ga0068854_100037321 3300005578 Bacteria 3410
105 Ga0068854_100117570 3300005578 Bacteria 2013
106 Ga0068852_100122630 3300005616 Bacteria 2382
107 Ga0068852_100380409 3300005616 Bacteria 1385
108 Ga0068852_101436059 3300005616 Bacteria 712
109 Ga0068859_100002979 3300005617 Bacteria 17164
110 Ga0068859_100008591 3300005617 Bacteria 10326
111 Ga0068859_100010149 3300005617 Bacteria 9485
112 Ga0068859_100012216 3300005617 Bacteria 8634
113 Ga0068864_100000004 3300005618 Bacteria 489341
114 Ga0068864_100001120 3300005618 Bacteria 22422
115 Ga0068864_100187595 3300005618 Bacteria 1894
116 Ga0068864_102363418 3300005618 Bacteria 538
117 Ga0068861_100016249 3300005719 Bacteria 5261
118 Ga0068870_10247858 3300005840 Bacteria 1103
119 Ga0068863_100000002 3300005841 Bacteria 489510
120 Ga0068863_100000095 3300005841 Bacteria 96080
121 Ga0068863_100008674 3300005841 Bacteria 9933
122 Ga0068858_100000248 3300005842 Bacteria 57728
123 Ga0068858_100000953 3300005842 Bacteria 29927
124 Ga0068860_100000001 3300005843 Bacteria 703043
125 Ga0068860_100000002 3300005843 Bacteria 627849
126 Ga0068862_100000002 3300005844 Bacteria 489341
127 Ga0068862_100000255 3300005844 Bacteria 59738
128 Ga0068862_100000752 3300005844 Bacteria 32470
129 Ga0068862_100006106 3300005844 Bacteria 10025
130 Ga0068862_100099532 3300005844 Bacteria 2541
131 Ga0081455_10000175 3300005937 Bacteria 80027
132 Ga0081539_10022719 3300005985 Bacteria 4136
133 Ga0068871_100755697 3300006358 Bacteria 894
134 Ga0097620_100002979 3300006931 Bacteria 17164
135 Ga0097620_100008591 3300006931 Bacteria 10326
136 Ga0097620_100012216 3300006931 Bacteria 8634
137 Ga0105251_10001587 3300009011 Bacteria 19417
138 Ga0105250_10281195 3300009092 Bacteria 716
139 Ga0105240_10099334 3300009093 Bacteria 3543
140 Ga0111539_11838095 3300009094 Bacteria 702
141 Ga0105247_10005445 3300009101 Bacteria 8019
142 Ga0105247_10006701 3300009101 Bacteria 7109
143 Ga0105243_10008012 3300009148 Bacteria 8113
144 Ga0105241_10614672 3300009174 Bacteria 983
145 Ga0105248_10000010 3300009177 Bacteria 344314
146 Ga0105248_10002587 3300009177 Bacteria 20121
147 Ga0105248_10010464 3300009177 Bacteria 10217
148 Ga0105248_10152285 3300009177 Bacteria 2609
149 Ga0105248_10333762 3300009177 Bacteria 1707
150 Ga0105248_10506019 3300009177 Bacteria 1362
151 Ga0105237_10834793 3300009545 Bacteria 928
152 Ga0105238_10014105 3300009551 Bacteria 8080
153 Ga0105249_10000026 3300009553 Bacteria 232053
154 Ga0105249_10000041 3300009553 Bacteria 195999
155 Ga0105249_10014970 3300009553 Bacteria 6860
156 Ga0105249_10373991 3300009553 Bacteria 1449
157 Ga0105148_100938 3300009978 Bacteria 2102
158 Ga0105239_10396584 3300010375 Bacteria 1561
159 Ga0105239_11159798 3300010375 Bacteria 890
160 Ga0157373_10009675 3300013100 Bacteria 7115
161 Ga0157373_10097146 3300013100 Bacteria 2074
162 Ga0157373_10364994 3300013100 Bacteria 1031
163 Ga0157371_10565101 3300013102 Bacteria 844
164 Ga0157371_10654180 3300013102 Bacteria 784
165 Ga0157370_10201198 3300013104 Bacteria 1848
166 Ga0157369_10006710 3300013105 Bacteria 13284
167 Ga0157378_10324481 3300013297 Bacteria 1496
168 Ga0163162_10299641 3300013306 Bacteria 1739
169 Ga0163162_10890999 3300013306 Bacteria 1003
170 Ga0157375_10034919 3300013308 Bacteria 4795
171 Ga0163163_10024725 3300014325 Bacteria 5719
172 Ga0163163_10220627 3300014325 Bacteria 1944
173 Ga0157380_10001300 3300014326 Bacteria 16241
174 Ga0157380_10002341 3300014326 Bacteria 12732
175 Ga0157380_10329304 3300014326 Bacteria 1420
176 Ga0157379_10028716 3300014968 Bacteria 4947
177 Ga0157379_10063113 3300014968 Bacteria 3312
178 Ga0157376_10309880 3300014969 Bacteria 1497
179 Ga0163161_10000008 3300017792 Bacteria 294642
180 Ga0197907_10673825 3300020069 Bacteria 2652
181 Ga0207656_10009908 3300025321 Bacteria 3550
182 Ga0207713_1002813 3300025735 Bacteria 12275
183 Ga0207682_10004238 3300025893 Bacteria 6058
184 Ga0207682_10040239 3300025893 Bacteria 1903
185 Ga0207710_10040171 3300025900 Bacteria 2072
186 Ga0207680_10000004 3300025903 Bacteria 827324
187 Ga0207680_10117363 3300025903 Bacteria 1735
188 Ga0207647_10000952 3300025904 Bacteria 22408
189 Ga0207647_10254128 3300025904 Bacteria 1007
190 Ga0207705_10085385 3300025909 Bacteria 2306
191 Ga0207705_10134332 3300025909 Bacteria 1843
192 Ga0207654_10000698 3300025911 Bacteria 18736
193 Ga0207707_10290482 3300025912 Bacteria 1415
194 Ga0207695_10003217 3300025913 Bacteria 23248
195 Ga0207695_10095932 3300025913 Bacteria 2968
196 Ga0207671_10002254 3300025914 Bacteria 20881
197 Ga0207660_10428718 3300025917 Bacteria 1067
198 Ga0207657_10021190 3300025919 Bacteria 6123
199 Ga0207657_10896206 3300025919 Bacteria 683
200 Ga0207657_10900438 3300025919 Bacteria 682
201 Ga0207649_10026807 3300025920 Bacteria 3375
202 Ga0207681_10001005 3300025923 Bacteria 18414
203 Ga0207681_10060838 3300025923 Bacteria 2594
204 Ga0207681_10277010 3300025923 Bacteria 1319
205 Ga0207681_10732991 3300025923 Bacteria 823
206 Ga0207694_10001423 3300025924 Bacteria 20509
207 Ga0207694_10035546 3300025924 Bacteria 3823
208 Ga0207650_10000083 3300025925 Bacteria 127270
209 Ga0207650_10002361 3300025925 Bacteria 13125
210 Ga0207650_10003110 3300025925 Bacteria 11433
211 Ga0207650_10186516 3300025925 Bacteria 1655
212 Ga0207650_10308900 3300025925 Bacteria 1293
213 Ga0207659_10002979 3300025926 Bacteria 10089
214 Ga0207644_10002369 3300025931 Bacteria 12167
215 Ga0207644_10011440 3300025931 Bacteria 5871
216 Ga0207644_10025092 3300025931 Bacteria 4096
217 Ga0207644_10207873 3300025931 Bacteria 1546
218 Ga0207644_10248577 3300025931 Bacteria 1418
219 Ga0207644_10296829 3300025931 Bacteria 1301
220 Ga0207690_10078439 3300025932 Bacteria 2298
221 Ga0207690_10158410 3300025932 Bacteria 1685
222 Ga0207690_10722484 3300025932 Bacteria 820
223 Ga0207706_10000920 3300025933 Bacteria 30195
224 Ga0207706_10005149 3300025933 Bacteria 12202
225 Ga0207706_10016224 3300025933 Bacteria 6731
226 Ga0207706_10224217 3300025933 Bacteria 1645
227 Ga0207709_10014494 3300025935 Bacteria 4354
228 Ga0207669_10044485 3300025937 Bacteria 2609
229 Ga0207669_10062638 3300025937 Bacteria 2292
230 Ga0207669_10924197 3300025937 Bacteria 730
231 Ga0207691_10000434 3300025940 Bacteria 41612
232 Ga0207691_10206078 3300025940 Bacteria 1710
233 Ga0207711_10000038 3300025941 Bacteria 163520
234 Ga0207711_10008481 3300025941 Bacteria 8599
235 Ga0207711_10049958 3300025941 Bacteria 3580
236 Ga0207711_10119735 3300025941 Bacteria 2349
237 Ga0207711_10158043 3300025941 Bacteria 2050
238 Ga0207711_11096331 3300025941 Bacteria 737
239 Ga0207679_10004851 3300025945 Bacteria 8391
240 Ga0207679_10051231 3300025945 Bacteria 3021
241 Ga0207679_10685728 3300025945 Bacteria 929
242 Ga0207667_10000464 3300025949 Bacteria 54597
243 Ga0207667_10003138 3300025949 Bacteria 20458
244 Ga0207651_10019903 3300025960 Bacteria 4036
245 Ga0207651_10339011 3300025960 Bacteria 1262
246 Ga0207712_10000001 3300025961 Bacteria 750309
247 Ga0207712_10000386 3300025961 Bacteria 38294
248 Ga0207712_11183295 3300025961 Bacteria 682
249 Ga0207668_10000008 3300025972 Bacteria 189904
250 Ga0207668_10062577 3300025972 Bacteria 2621
251 Ga0207668_10338540 3300025972 Bacteria 1254
252 Ga0207668_10354746 3300025972 Bacteria 1227
253 Ga0207640_10014896 3300025981 Bacteria 4487
254 Ga0207640_10021734 3300025981 Bacteria 3828
255 Ga0207658_10000002 3300025986 Bacteria 1364188
256 Ga0207658_10000474 3300025986 Bacteria 37159
257 Ga0207658_10000832 3300025986 Bacteria 25782
258 Ga0207658_10108301 3300025986 Bacteria 2191
259 Ga0207703_10009728 3300026035 Bacteria 7546
260 Ga0207703_10024137 3300026035 Bacteria 4784
261 Ga0207639_10093496 3300026041 Bacteria 2411
262 Ga0207639_10177181 3300026041 Bacteria 1811
263 Ga0207678_10004471 3300026067 Bacteria 12567
264 Ga0207678_10389395 3300026067 Bacteria 1206
265 Ga0207702_10001800 3300026078 Bacteria 21115
266 Ga0207702_12215993 3300026078 Bacteria 538
267 Ga0207641_10000002 3300026088 Bacteria 981004
268 Ga0207641_10000148 3300026088 Bacteria 99601
269 Ga0207641_10002467 3300026088 Bacteria 17084
270 Ga0207648_10455342 3300026089 Bacteria 1166
271 Ga0207676_10000005 3300026095 Bacteria 698744
272 Ga0207676_10000479 3300026095 Bacteria 33652
273 Ga0207676_10021206 3300026095 Bacteria 4766
274 Ga0207674_10006918 3300026116 Bacteria 13286
275 Ga0207674_10010906 3300026116 Bacteria 10233
276 Ga0207675_100013763 3300026118 Bacteria 7546
277 Ga0207675_100023127 3300026118 Bacteria 5779
278 Ga0207675_100163383 3300026118 Bacteria 2125
279 Ga0207675_101395015 3300026118 Bacteria 721
280 Ga0207698_10021358 3300026142 Bacteria 4475
281 Ga0207698_10271076 3300026142 Bacteria 1565
282 Ga0207698_10347034 3300026142 Bacteria 1400
283 Ga0207698_10590218 3300026142 Bacteria 1094
284 Ga0209967_1030314 3300027364 Bacteria 808
285 Ga0209967_1043278 3300027364 Bacteria 686
286 Ga0209983_1023553 3300027665 Bacteria 1293
287 Ga0209974_10164843 3300027876 Bacteria 805
288 Ga0268266_10000042 3300028379 Bacteria 316826
289 Ga0268266_10000432 3300028379 Bacteria 62927
290 Ga0268266_10069754 3300028379 Bacteria 3046
291 Ga0268265_10000003 3300028380 Bacteria 949201
292 Ga0268265_10000994 3300028380 Bacteria 25764
293 Ga0268265_10001122 3300028380 Bacteria 23704
294 Ga0268264_10000001 3300028381 Bacteria 1221000
295 Ga0268264_10000006 3300028381 Bacteria 827324
296 Ga0307517_10188290 3300028786 Bacteria 1316
297 Ga0316177_1205919 3300030731 Bacteria 1015
298 Ga0314311_1138735 3300030733 Bacteria 1807
299 Ga0316178_1108504 3300030735 Bacteria 2310
300 Ga0316183_1202968 3300030742 Bacteria 3164
301 Ga0316181_1240666 3300030744 Bacteria 1405
302 Ga0316182_1085230 3300030745 Bacteria 2124
303 Ga0307408_100034819 3300031548 Bacteria 3530
304 Ga0307408_100049463 3300031548 Bacteria 3019
305 Ga0307408_100053439 3300031548 Bacteria 2917
306 Ga0307408_100127232 3300031548 Bacteria 1983
307 Ga0307408_100207963 3300031548 Bacteria 1588
308 Ga0307408_100284829 3300031548 Bacteria 1377
309 Ga0307408_100634148 3300031548 Bacteria 953
310 Ga0307408_100659435 3300031548 Bacteria 936
311 Ga0307408_101002271 3300031548 Bacteria 770
312 Ga0307405_10076986 3300031731 Bacteria 2166
313 Ga0307405_10163001 3300031731 Bacteria 1581
314 Ga0307405_10199270 3300031731 Bacteria 1452
315 Ga0307405_10259799 3300031731 Bacteria 1296
316 Ga0307405_10382242 3300031731 Bacteria 1096
317 Ga0307405_10437585 3300031731 Bacteria 1033
318 Ga0307405_10649265 3300031731 Bacteria 867
319 Ga0307405_10681278 3300031731 Bacteria 849
320 Ga0307405_10859880 3300031731 Bacteria 764
321 Ga0307405_11386576 3300031731 Bacteria 614
322 Ga0307413_10005699 3300031824 Bacteria 5593
323 Ga0307413_10011941 3300031824 Bacteria 4298
324 Ga0307413_10022083 3300031824 Bacteria 3421
325 Ga0307413_10046478 3300031824 Bacteria 2581
326 Ga0307413_10081261 3300031824 Bacteria 2077
327 Ga0307413_10092062 3300031824 Bacteria 1977
328 Ga0307413_10096167 3300031824 Bacteria 1943
329 Ga0307413_10133211 3300031824 Bacteria 1704
330 Ga0307413_10256172 3300031824 Bacteria 1301
331 Ga0307413_10388762 3300031824 Bacteria 1089
332 Ga0307413_10807222 3300031824 Bacteria 789
333 Ga0307413_10861265 3300031824 Bacteria 766
334 Ga0307413_11078513 3300031824 Bacteria 692
335 Ga0307410_10050561 3300031852 Bacteria 2796
336 Ga0307410_10074178 3300031852 Bacteria 2368
337 Ga0307410_10099642 3300031852 Bacteria 2080
338 Ga0307410_10128166 3300031852 Bacteria 1860
339 Ga0307410_10236050 3300031852 Bacteria 1414
340 Ga0307410_10529670 3300031852 Bacteria 973
341 Ga0307410_10538999 3300031852 Bacteria 965
342 Ga0307410_10613652 3300031852 Bacteria 908
343 Ga0307410_10615057 3300031852 Bacteria 907
344 Ga0307410_10659510 3300031852 Bacteria 878
345 Ga0307410_10992741 3300031852 Bacteria 723
346 Ga0307410_11132568 3300031852 Bacteria 679
347 Ga0307406_10003999 3300031901 Bacteria 8015
348 Ga0307406_10111741 3300031901 Bacteria 1883
349 Ga0307406_10119809 3300031901 Bacteria 1827
350 Ga0307406_10126736 3300031901 Bacteria 1785
351 Ga0307406_10133936 3300031901 Bacteria 1743
352 Ga0307406_10137135 3300031901 Bacteria 1726
353 Ga0307406_10207287 3300031901 Bacteria 1448
354 Ga0307406_10373054 3300031901 Bacteria 1122
355 Ga0307406_10629261 3300031901 Bacteria 888
356 Ga0307406_10934897 3300031901 Bacteria 740
357 Ga0307407_10009986 3300031903 Bacteria 4452
358 Ga0307407_10028924 3300031903 Bacteria 2969
359 Ga0307407_10079783 3300031903 Bacteria 1975
360 Ga0307407_10113941 3300031903 Bacteria 1702
361 Ga0307407_10158406 3300031903 Bacteria 1479
362 Ga0307407_10413654 3300031903 Bacteria 970
363 Ga0307407_10477611 3300031903 Bacteria 910
364 Ga0307407_10545917 3300031903 Bacteria 856
365 Ga0307407_10661270 3300031903 Bacteria 783
366 Ga0307407_10865946 3300031903 Bacteria 691
367 Ga0307412_10023150 3300031911 Bacteria 3818
368 Ga0307412_10027380 3300031911 Bacteria 3553
369 Ga0307412_10146666 3300031911 Bacteria 1736
370 Ga0307412_10220517 3300031911 Bacteria 1453
371 Ga0307412_10240377 3300031911 Bacteria 1400
372 Ga0307412_10251492 3300031911 Bacteria 1372
373 Ga0307412_10273048 3300031911 Bacteria 1324
374 Ga0307412_10306354 3300031911 Bacteria 1258
375 Ga0307412_10335854 3300031911 Bacteria 1207
376 Ga0307412_10355206 3300031911 Bacteria 1178
377 Ga0307412_10383706 3300031911 Bacteria 1138
378 Ga0307412_10407512 3300031911 Bacteria 1109
379 Ga0307412_10486490 3300031911 Bacteria 1024
380 Ga0307412_11513207 3300031911 Bacteria 610
381 Ga0307409_100003415 3300031995 Bacteria 8627
382 Ga0307409_100028984 3300031995 Bacteria 3954
383 Ga0307409_100141068 3300031995 Bacteria 2076
384 Ga0307409_100177403 3300031995 Bacteria 1882
385 Ga0307409_100212241 3300031995 Bacteria 1740
386 Ga0307409_100371418 3300031995 Bacteria 1356
387 Ga0307409_100500490 3300031995 Bacteria 1183
388 Ga0307409_100760337 3300031995 Bacteria 973
389 Ga0307409_101189133 3300031995 Bacteria 785
390 Ga0307409_102487652 3300031995 Bacteria 546
391 Ga0307416_100001716 3300032002 Bacteria 12124
392 Ga0307416_100009079 3300032002 Bacteria 6475
393 Ga0307416_100053022 3300032002 Bacteria 3251
394 Ga0307416_100057730 3300032002 Bacteria 3142
395 Ga0307416_100087313 3300032002 Bacteria 2662
396 Ga0307416_100099624 3300032002 Bacteria 2524
397 Ga0307416_100465992 3300032002 Bacteria 1320
398 Ga0307416_100518227 3300032002 Bacteria 1260
399 Ga0307416_100691980 3300032002 Bacteria 1108
400 Ga0307416_100943158 3300032002 Bacteria 964
401 Ga0307416_101004214 3300032002 Bacteria 937
402 Ga0307416_101544035 3300032002 Bacteria 769
403 Ga0307414_10043188 3300032004 Bacteria 3069
404 Ga0307414_10054441 3300032004 Bacteria 2796
405 Ga0307414_10060146 3300032004 Bacteria 2685
406 Ga0307414_10097538 3300032004 Bacteria 2202
407 Ga0307414_10114539 3300032004 Bacteria 2060
408 Ga0307414_10150332 3300032004 Bacteria 1836
409 Ga0307414_10171018 3300032004 Bacteria 1737
410 Ga0307414_10172877 3300032004 Bacteria 1729
411 Ga0307414_10181179 3300032004 Bacteria 1694
412 Ga0307414_10250873 3300032004 Bacteria 1471
413 Ga0307414_10324142 3300032004 Bacteria 1312
414 Ga0307414_10378512 3300032004 Bacteria 1223
415 Ga0307414_10396202 3300032004 Bacteria 1198
416 Ga0307414_10466620 3300032004 Bacteria 1110
417 Ga0307414_10523470 3300032004 Bacteria 1053
418 Ga0307414_10534322 3300032004 Bacteria 1042
419 Ga0307414_10566390 3300032004 Bacteria 1014
420 Ga0307414_10600877 3300032004 Bacteria 986
421 Ga0307414_10848890 3300032004 Bacteria 835
422 Ga0307414_10864517 3300032004 Bacteria 827
423 Ga0307414_10942110 3300032004 Bacteria 793
424 Ga0307414_11401456 3300032004 Bacteria 649
425 Ga0307411_10001850 3300032005 Bacteria 8989
426 Ga0307411_10003196 3300032005 Bacteria 7542
427 Ga0307411_10042748 3300032005 Bacteria 2894
428 Ga0307411_10062536 3300032005 Bacteria 2483
429 Ga0307411_10091222 3300032005 Bacteria 2128
430 Ga0307411_10131045 3300032005 Bacteria 1832
431 Ga0307411_10135760 3300032005 Bacteria 1805
432 Ga0307411_10183209 3300032005 Bacteria 1591
433 Ga0307411_10351888 3300032005 Bacteria 1201
434 Ga0307411_10486540 3300032005 Bacteria 1040
435 Ga0307411_10513604 3300032005 Bacteria 1015
436 Ga0307411_10517003 3300032005 Bacteria 1012
437 Ga0307411_10823126 3300032005 Bacteria 819
438 Ga0307411_10838921 3300032005 Bacteria 812
439 Ga0307411_11444325 3300032005 Bacteria 631
440 Ga0307411_11773154 3300032005 Bacteria 572
441 Ga0307411_11827610 3300032005 Bacteria 564
442 Ga0307411_11932443 3300032005 Bacteria 550
443 Ga0307415_100002874 3300032126 Bacteria 8622
444 Ga0307415_100028330 3300032126 Bacteria 3562
445 Ga0307415_100046408 3300032126 Bacteria 2918
446 Ga0307415_100060617 3300032126 Bacteria 2615
447 Ga0307415_100340943 3300032126 Bacteria 1258
448 Ga0307415_100393700 3300032126 Bacteria 1180
449 Ga0307415_100492741 3300032126 Bacteria 1069
450 Ga0395905_1537549 3300037471 Bacteria 570
451 Ga0436364_0135559 3300037853 Bacteria 1512
452 Ga0439466_0079064 3300041411 Bacteria 1039
453 Ga0439465_0096460 3300041413 Bacteria 1017
454 Ga0451798_0874212 3300041458 Bacteria 625
455 Ga0439449_0254380 3300042007 Bacteria 660
456 Ga0450912_027241 3300042116 Bacteria 579
457 Ga0439434_0020032 3300042435 Bacteria 2008
458 Ga0439434_0054684 3300042435 Bacteria 1242
459 Ga0495650_0210282 3300046471 Bacteria 673
460 Ga0495585_0369866 3300046492 Bacteria 694
461 Ga0495606_0015264 3300046507 Bacteria 5928
462 Ga0495606_0027801 3300046507 Bacteria 4003
463 Ga0495620_0077701 3300046515 Bacteria 1347
464 Ga0495632_0173627 3300046519 Bacteria 989
465 Ga0495648_0052884 3300046524 Bacteria 2464
466 Ga0495663_0007026 3300046525 Bacteria 3107
467 Ga0495663_0093541 3300046525 Bacteria 982
468 Ga0495654_0000264 3300046530 Bacteria 47686
469 Ga0495654_0062312 3300046530 Bacteria 1788
470 Ga0495654_0294495 3300046530 Bacteria 664
471 Ga0495598_0202889 3300046537 Bacteria 717
472 Ga0495668_0000984 3300046616 Bacteria 31110
473 Ga0495668_0007734 3300046616 Bacteria 6826
474 Ga0495668_0149626 3300046616 Bacteria 1278
475 Ga0495625_0740818 3300046660 Bacteria 577
476 Ga0495669_0008296 3300046684 Bacteria 4363
477 Ga0495669_0160686 3300046684 Bacteria 1066
478 Ga0495671_0025586 3300046692 Bacteria 3066
479 Ga0495589_0061780 3300046794 Bacteria 1838
480 Ga0495686_0001180 3300047472 Bacteria 30452
481 Ga0495686_0018090 3300047472 Bacteria 4735
482 Ga0495686_0026515 3300047472 Bacteria 3790
483 Ga0495686_0287246 3300047472 Bacteria 912
484 Ga0496100_0239148 3300048903 Bacteria 1339
485 Ga0496101_0281784 3300048904 Bacteria 1299
486 Ga0496102_0000049 3300048905 Bacteria 179480
487 Ga0496103_0000037 3300048906 Bacteria 179474
488 Ga0496103_0001627 3300048906 Bacteria 14740
489 Ga0496103_0816797 3300048906 Bacteria 587
490 Ga0496105_0049260 3300048908 Bacteria 3478
491 Ga0496105_0379336 3300048908 Bacteria 1125
492 Ga0496106_0093367 3300048909 Bacteria 2325
493 Ga0496107_0444279 3300048910 Bacteria 963
494 Ga0496109_0700577 3300048912 Bacteria 950
495 Ga0496109_1281450 3300048912 Bacteria 669
496 Ga0496110_0117644 3300048913 Bacteria 2393
497 Ga0496110_0632438 3300048913 Bacteria 969
498 Ga0496111_0259724 3300048914 Bacteria 1289
499 Ga0496114_0044764 3300048917 Bacteria 3674
500 Ga0496116_0002470 3300048919 Bacteria 19367
501 Ga0496116_0014040 3300048919 Bacteria 6416
502 Ga0496117_0000115 3300048920 Bacteria 179488
503 Ga0496117_0005604 3300048920 Bacteria 13115
504 Ga0496117_0016989 3300048920 Bacteria 6096
505 Ga0496117_0053363 3300048920 Bacteria 2841
506 Ga0496117_0246903 3300048920 Bacteria 976
507 Ga0496118_0000086 3300048921 Bacteria 179488
508 Ga0496118_0000463 3300048921 Bacteria 67382
509 Ga0496118_0001090 3300048921 Bacteria 42296
510 Ga0496118_0071245 3300048921 Bacteria 2503
511 Ga0496118_0204361 3300048921 Bacteria 1166
512 Ga0496119_0159034 3300048922 Bacteria 1203
513 Ga0496119_0187205 3300048922 Bacteria 1081
514 Ga0496121_0540442 3300048924 Bacteria 731
515 Ga0496122_0494303 3300048925 Bacteria 596
516 Ga0496124_0000102 3300048927 Bacteria 179488
517 Ga0496124_0215432 3300048927 Bacteria 1449
518 Ga0501306_093845 3300049127 Bacteria 530
519 Ga0501309_023361 3300049129 Bacteria 879
520 Ga0501310_023215 3300049130 Bacteria 788
521 Ga0501305_062556 3300049161 Bacteria 643
522 Ga0501290_000843 3300049513 Bacteria 4505
523 Ga0501290_005933 3300049513 Bacteria 1523
524 Ga0501292_000051 3300049515 Bacteria 24863
525 Ga0501293_013287 3300049516 Bacteria 738
526 Ga0501294_002939 3300049517 Bacteria 1609
527 Ga0501297_004852 3300049520 Bacteria 1390
528 Ga0501300_002856 3300049523 Bacteria 2581
529 Ga0501300_008763 3300049523 Bacteria 1480
530 Ga0501301_006738 3300049524 Bacteria 872
531 Ga0501315_000151 3300049531 Bacteria 3953
532 Ga0501315_006847 3300049531 Bacteria 1282
533 Ga0501315_056215 3300049531 Bacteria 628
534 Ga0501317_000163 3300049533 Bacteria 3813
535 Ga0501321_002879 3300049537 Bacteria 1534
536 Ga0501321_004264 3300049537 Bacteria 1359
537 Ga0501321_011337 3300049537 Bacteria 993
538 Ga0501322_001805 3300049538 Bacteria 1252
539 Ga0501323_005245 3300049539 Bacteria 1409
540 Ga0501323_043581 3300049539 Bacteria 664
541 Ga0501325_006917 3300049541 Bacteria 947
542 Ga0501325_028440 3300049541 Bacteria 628
543 Ga0501328_01423 3300049544 Bacteria 951
544 Ga0501332_00987 3300049548 Bacteria 1404
545 Ga0501332_03662 3300049548 Bacteria 895
546 Ga0501333_000673 3300049549 Bacteria 1658
547 Ga0501333_000992 3300049549 Bacteria 1452
548 Ga0501334_00317 3300049550 Bacteria 2092
549 Ga0501335_003435 3300049551 Bacteria 1343
550 Ga0501335_007673 3300049551 Bacteria 1002
551 Ga0501336_002953 3300049552 Bacteria 1123
552 Ga0501336_003548 3300049552 Bacteria 1060
553 Ga0501336_005438 3300049552 Bacteria 920
554 Ga0501337_001436 3300049553 Bacteria 1364
555 Ga0501337_009739 3300049553 Bacteria 693
556 Ga0501202_023695 3300049652 Bacteria 1240
557 Ga0501202_241881 3300049652 Bacteria 505
558 Ga0501206_000971 3300049653 Bacteria 3562
559 Ga0501207_059461 3300049654 Bacteria 697
560 Ga0501222_001339 3300049662 Bacteria 3457
561 Ga0501222_089714 3300049662 Bacteria 500
562 Ga0501223_004059 3300049663 Bacteria 3152
563 Ga0501223_031564 3300049663 Bacteria 1031
564 Ga0501224_005136 3300049664 Bacteria 1869
565 Ga0501227_008888 3300049665 Bacteria 2159
566 Ga0501233_080782 3300049668 Bacteria 837
567 Ga0501235_001639 3300049669 Bacteria 4809
568 Ga0501242_014919 3300049674 Bacteria 965
569 Ga0501251_018583 3300049681 Bacteria 903
570 Ga0501252_019401 3300049682 Bacteria 878
571 Ga0501257_000127 3300049686 Bacteria 17543
572 Ga0501257_016925 3300049686 Bacteria 1694
573 Ga0501257_250001 3300049686 Bacteria 525
574 Ga0501259_004767 3300049688 Bacteria 2151
575 Ga0501259_130552 3300049688 Bacteria 606
576 Ga0501261_000034 3300049690 Bacteria 28674
577 Ga0501221_230188 3300049704 Bacteria 526
578 Ga0501225_0002879 3300049705 Bacteria 5283
579 Ga0501229_012183 3300049706 Bacteria 1096
580 Ga0501245_016223 3300049708 Bacteria 1127
581 Ga0501264_011125 3300049761 Bacteria 872
582 Ga0501268_007585 3300049765 Bacteria 1621
583 Ga0501268_035980 3300049765 Bacteria 915
584 Ga0501268_064555 3300049765 Bacteria 731
585 Ga0501273_032166 3300049770 Bacteria 751
586 Ga0501273_050320 3300049770 Bacteria 636
587 Ga0501276_001940 3300049773 Bacteria 1439
588 Ga0501279_000036 3300049775 Bacteria 31545
589 Ga0501280_000020 3300049776 Bacteria 52521
590 Ga0501281_00214 3300049777 Bacteria 6537
591 Ga0501282_000015 3300049778 Bacteria 25078
592 Ga0501283_036394 3300049779 Bacteria 841
593 nmdc:mga08y16_923861_c1 3300050511 Bacteria 857
594 Ga0500643_000030 3300053087 Bacteria 206784
595 Ga0500643_000241 3300053087 Bacteria 50801
596 Ga0500643_069346 3300053087 Bacteria 980
597 Ga0500646_0044176 3300053090 Bacteria 1264
598 Ga0500592_000121 3300053116 Bacteria 16954
599 Ga0500592_005167 3300053116 Bacteria 2073
600 Ga0500594_0010509 3300053118 Bacteria 2150
601 Ga0500559_0170875 3300053136 Bacteria 1022
602 Ga0500568_0010173 3300053139 Bacteria 4421
603 Ga0500568_0040812 3300053139 Bacteria 1867
604 Ga0500577_0056447 3300053142 Bacteria 1495
605 Ga0500604_0000017 3300053151 Bacteria 82010
606 Ga0500604_0006520 3300053151 Bacteria 3087
607 Ga0500604_0022836 3300053151 Bacteria 1780
608 Ga0500604_0022931 3300053151 Bacteria 1777
609 Ga0500616_0000711 3300053153 Bacteria 38558
610 Ga0500616_0099575 3300053153 Bacteria 1423
611 Ga0500627_0000199 3300053158 Bacteria 17319
612 Ga0500627_0001004 3300053158 Bacteria 7685
613 Ga0500611_021825 3300053727 Bacteria 1227
614 Ga0500587_018211 3300053739 Bacteria 903
615 Ga0590075_058011 3300059424 Bacteria 997
616 Ga0587077_000971 3300059493 Bacteria 2858
617 Ga0587077_031327 3300059493 Bacteria 1015
618 Ga0587082_002336 3300059504 Bacteria 2127
619 Ga0587101_001137 3300059623 Bacteria 2191
620 Ga0587128_008756 3300059630 Bacteria 1316
621 Ga0587076_002302 3300059645 Bacteria 2121
622 Ga0070660_100486512
623 LJQas_1004675
624 JGI24736J21556_1000004
625 JGI24741J21665_1033400
626 JGI24741J21665_1037154
627 JGI24752J21851_1009398
628 JGI24740J21852_10007386
629 JGI24740J21852_10010426
630 JGI24739J22299_10006755
631 JGI24739J22299_10023402
632 JGI24737J22298_10075513
633 JGI24737J22298_10080964
634 JGI24735J21928_10102841
635 JGI24750J21931_1000944
636 JGI24748J21848_1000032
637 JGI24738J21930_10000860
638 JGI24738J21930_10003947
639 JGI24738J21930_10007434
640 JGI24749J21850_1035962
641 JGI24033J26618_1030503
642 JGI24034J26672_10000022
643 JGI24034J26672_10047531
644 JGI24742J22300_10065162
645 JGI25405J52794_10004639
646 Ga0058859_11554536
647 Ga0065714_10029661
648 Ga0065714_10167068
649 Ga0065704_10084208
650 Ga0065704_10234281
651 Ga0065715_10300489
652 Ga0065715_10794117
653 Ga0065715_11009482
654 Ga0065707_10087564
655 Ga0065707_10404062
656 Ga0065707_10816385
657 Ga0070658_10007974
658 Ga0070658_10012095
659 Ga0070690_100000038
660 Ga0070670_100000021
661 Ga0070670_100001557
662 Ga0070670_100064435
663 Ga0070670_100136520
664 Ga0070670_100460596
665 Ga0070677_10001055
666 Ga0070677_10043015
667 Ga0070666_10000002
668 Ga0070680_100194871
669 Ga0070682_100416709
670 Ga0070660_100109413
671 Ga0070660_100985885
672 Ga0070661_100027200
673 Ga0070661_100048780
674 Ga0070668_100000005
675 Ga0070668_100099042
676 Ga0070668_100136916
677 Ga0070668_100339080
678 Ga0070668_100455169
679 Ga0070669_100000237
680 Ga0070669_100082855
681 Ga0070675_100000201
682 Ga0070671_100000069
683 Ga0070671_100000091
684 Ga0070671_100017355
685 Ga0070671_100068843
686 Ga0070671_100239399
687 Ga0070671_100506508
688 Ga0070674_100068973
689 Ga0070674_100085075
690 Ga0070673_100100626
691 Ga0070673_100181571
692 Ga0070659_100045648
693 Ga0070659_100854071
694 Ga0070667_100000004
695 Ga0070667_100000750
696 Ga0070667_100042896
697 Ga0070667_100218550
698 Ga0070663_100077899
699 Ga0070662_100001625
700 Ga0070662_100059818
701 Ga0070662_100140835
702 Ga0070662_100227256
703 Ga0070681_10403193
704 Ga0070685_10000425
705 Ga0070698_101153562
706 Ga0070684_100268509
707 Ga0068853_100001339
708 Ga0068853_100051305
709 Ga0068853_100213079
710 Ga0070672_100000850
711 Ga0070672_100199315
712 Ga0070686_100000003
713 Ga0070693_100399196
714 Ga0070665_100000036
715 Ga0070665_100000773
716 Ga0070665_100083502
717 Ga0068855_100457039
718 Ga0068855_101298210
719 Ga0070664_100000322
720 Ga0070664_100037606
721 Ga0070664_100351742
722 Ga0070664_100555531
723 Ga0068857_100016950
724 Ga0068857_100397907
725 Ga0068854_100037321
726 Ga0068854_100117570
727 Ga0068852_100122630
728 Ga0068852_100380409
729 Ga0068852_101436059
730 Ga0068859_100002979
731 Ga0068859_100008591
732 Ga0068859_100010149
733 Ga0068859_100012216
734 Ga0068864_100000004
735 Ga0068864_100001120
736 Ga0068864_100187595
737 Ga0068864_102363418
738 Ga0068861_100016249
739 Ga0068870_10247858
740 Ga0068863_100000002
741 Ga0068863_100000095
742 Ga0068863_100008674
743 Ga0068858_100000248
744 Ga0068858_100000953
745 Ga0068860_100000001
746 Ga0068860_100000002
747 Ga0068862_100000002
748 Ga0068862_100000255
749 Ga0068862_100000752
750 Ga0068862_100006106
751 Ga0068862_100099532
752 Ga0081455_10000175
753 Ga0081539_10022719
754 Ga0068871_100755697
755 Ga0097620_100002979
756 Ga0097620_100008591
757 Ga0097620_100012216
758 Ga0105251_10001587
759 Ga0105250_10281195
760 Ga0105240_10099334
761 Ga0111539_11838095
762 Ga0105247_10005445
763 Ga0105247_10006701
764 Ga0105243_10008012
765 Ga0105241_10614672
766 Ga0105248_10000010
767 Ga0105248_10002587
768 Ga0105248_10010464
769 Ga0105248_10152285
770 Ga0105248_10333762
771 Ga0105248_10506019
772 Ga0105237_10834793
773 Ga0105238_10014105
774 Ga0105249_10000026
775 Ga0105249_10000041
776 Ga0105249_10014970
777 Ga0105249_10373991
778 Ga0105148_100938
779 Ga0105239_10396584
780 Ga0105239_11159798
781 Ga0157373_10009675
782 Ga0157373_10097146
783 Ga0157373_10364994
784 Ga0157371_10565101
785 Ga0157371_10654180
786 Ga0157370_10201198
787 Ga0157369_10006710
788 Ga0157378_10324481
789 Ga0163162_10299641
790 Ga0163162_10890999
791 Ga0157375_10034919
792 Ga0163163_10024725
793 Ga0163163_10220627
794 Ga0157380_10001300
795 Ga0157380_10002341
796 Ga0157380_10329304
797 Ga0157379_10028716
798 Ga0157379_10063113
799 Ga0157376_10309880
800 Ga0163161_10000008
801 Ga0197907_10673825
802 Ga0207656_10009908
803 Ga0207713_1002813
804 Ga0207682_10004238
805 Ga0207682_10040239
806 Ga0207710_10040171
807 Ga0207680_10000004
808 Ga0207680_10117363
809 Ga0207647_10000952
810 Ga0207647_10254128
811 Ga0207705_10085385
812 Ga0207705_10134332
813 Ga0207654_10000698
814 Ga0207707_10290482
815 Ga0207695_10003217
816 Ga0207695_10095932
817 Ga0207671_10002254
818 Ga0207660_10428718
819 Ga0207657_10021190
820 Ga0207657_10896206
821 Ga0207657_10900438
822 Ga0207649_10026807
823 Ga0207681_10001005
824 Ga0207681_10060838
825 Ga0207681_10277010
826 Ga0207681_10732991
827 Ga0207694_10001423
828 Ga0207694_10035546
829 Ga0207650_10000083
830 Ga0207650_10002361
831 Ga0207650_10003110
832 Ga0207650_10186516
833 Ga0207650_10308900
834 Ga0207659_10002979
835 Ga0207644_10002369
836 Ga0207644_10011440
837 Ga0207644_10025092
838 Ga0207644_10207873
839 Ga0207644_10248577
840 Ga0207644_10296829
841 Ga0207690_10078439
842 Ga0207690_10158410
843 Ga0207690_10722484
844 Ga0207706_10000920
845 Ga0207706_10005149
846 Ga0207706_10016224
847 Ga0207706_10224217
848 Ga0207709_10014494
849 Ga0207669_10044485
850 Ga0207669_10062638
851 Ga0207669_10924197
852 Ga0207691_10000434
853 Ga0207691_10206078
854 Ga0207711_10000038
855 Ga0207711_10008481
856 Ga0207711_10049958
857 Ga0207711_10119735
858 Ga0207711_10158043
859 Ga0207711_11096331
860 Ga0207679_10004851
861 Ga0207679_10051231
862 Ga0207679_10685728
863 Ga0207667_10000464
864 Ga0207667_10003138
865 Ga0207651_10019903
866 Ga0207651_10339011
867 Ga0207712_10000001
868 Ga0207712_10000386
869 Ga0207712_11183295
870 Ga0207668_10000008
871 Ga0207668_10062577
872 Ga0207668_10338540
873 Ga0207668_10354746
874 Ga0207640_10014896
875 Ga0207640_10021734
876 Ga0207658_10000002
877 Ga0207658_10000474
878 Ga0207658_10000832
879 Ga0207658_10108301
880 Ga0207703_10009728
881 Ga0207703_10024137
882 Ga0207639_10093496
883 Ga0207639_10177181
884 Ga0207678_10004471
885 Ga0207678_10389395
886 Ga0207702_10001800
887 Ga0207702_12215993
888 Ga0207641_10000002
889 Ga0207641_10000148
890 Ga0207641_10002467
891 Ga0207648_10455342
892 Ga0207676_10000005
893 Ga0207676_10000479
894 Ga0207676_10021206
895 Ga0207674_10006918
896 Ga0207674_10010906
897 Ga0207675_100013763
898 Ga0207675_100023127
899 Ga0207675_100163383
900 Ga0207675_101395015
901 Ga0207698_10021358
902 Ga0207698_10271076
903 Ga0207698_10347034
904 Ga0207698_10590218
905 Ga0209967_1030314
906 Ga0209967_1043278
907 Ga0209983_1023553
908 Ga0209974_10164843
909 Ga0268266_10000042
910 Ga0268266_10000432
911 Ga0268266_10069754
912 Ga0268265_10000003
913 Ga0268265_10000994
914 Ga0268265_10001122
915 Ga0268264_10000001
916 Ga0268264_10000006
917 Ga0307517_10188290
918 Ga0316177_1205919
919 Ga0314311_1138735
920 Ga0316178_1108504
921 Ga0316183_1202968
922 Ga0316181_1240666
923 Ga0316182_1085230
924 Ga0307408_100034819
925 Ga0307408_100049463
926 Ga0307408_100053439
927 Ga0307408_100127232
928 Ga0307408_100207963
929 Ga0307408_100284829
930 Ga0307408_100634148
931 Ga0307408_100659435
932 Ga0307408_101002271
933 Ga0307405_10076986
934 Ga0307405_10163001
935 Ga0307405_10199270
936 Ga0307405_10259799
937 Ga0307405_10382242
938 Ga0307405_10437585
939 Ga0307405_10649265
940 Ga0307405_10681278
941 Ga0307405_10859880
942 Ga0307405_11386576
943 Ga0307413_10005699
944 Ga0307413_10011941
945 Ga0307413_10022083
946 Ga0307413_10046478
947 Ga0307413_10081261
948 Ga0307413_10092062
949 Ga0307413_10096167
950 Ga0307413_10133211
951 Ga0307413_10256172
952 Ga0307413_10388762
953 Ga0307413_10807222
954 Ga0307413_10861265
955 Ga0307413_11078513
956 Ga0307410_10050561
957 Ga0307410_10074178
958 Ga0307410_10099642
959 Ga0307410_10128166
960 Ga0307410_10236050
961 Ga0307410_10529670
962 Ga0307410_10538999
963 Ga0307410_10613652
964 Ga0307410_10615057
965 Ga0307410_10659510
966 Ga0307410_10992741
967 Ga0307410_11132568
968 Ga0307406_10003999
969 Ga0307406_10111741
970 Ga0307406_10119809
971 Ga0307406_10126736
972 Ga0307406_10133936
973 Ga0307406_10137135
974 Ga0307406_10207287
975 Ga0307406_10373054
976 Ga0307406_10629261
977 Ga0307406_10934897
978 Ga0307407_10009986
979 Ga0307407_10028924
980 Ga0307407_10079783
981 Ga0307407_10113941
982 Ga0307407_10158406
983 Ga0307407_10413654
984 Ga0307407_10477611
985 Ga0307407_10545917
986 Ga0307407_10661270
987 Ga0307407_10865946
988 Ga0307412_10023150
989 Ga0307412_10027380
990 Ga0307412_10146666
991 Ga0307412_10220517
992 Ga0307412_10240377
993 Ga0307412_10251492
994 Ga0307412_10273048
995 Ga0307412_10306354
996 Ga0307412_10335854
997 Ga0307412_10355206
998 Ga0307412_10383706
999 Ga0307412_10407512
1000 Ga0307412_10486490
1001 Ga0307412_11513207
1002 Ga0307409_100003415
1003 Ga0307409_100028984
1004 Ga0307409_100141068
1005 Ga0307409_100177403
1006 Ga0307409_100212241
1007 Ga0307409_100371418
1008 Ga0307409_100500490
1009 Ga0307409_100760337
1010 Ga0307409_101189133
1011 Ga0307409_102487652
1012 Ga0307416_100001716
1013 Ga0307416_100009079
1014 Ga0307416_100053022
1015 Ga0307416_100057730
1016 Ga0307416_100087313
1017 Ga0307416_100099624
1018 Ga0307416_100465992
1019 Ga0307416_100518227
1020 Ga0307416_100691980
1021 Ga0307416_100943158
1022 Ga0307416_101004214
1023 Ga0307416_101544035
1024 Ga0307414_10043188
1025 Ga0307414_10054441
1026 Ga0307414_10060146
1027 Ga0307414_10097538
1028 Ga0307414_10114539
1029 Ga0307414_10150332
1030 Ga0307414_10171018
1031 Ga0307414_10172877
1032 Ga0307414_10181179
1033 Ga0307414_10250873
1034 Ga0307414_10324142
1035 Ga0307414_10378512
1036 Ga0307414_10396202
1037 Ga0307414_10466620
1038 Ga0307414_10523470
1039 Ga0307414_10534322
1040 Ga0307414_10566390
1041 Ga0307414_10600877
1042 Ga0307414_10848890
1043 Ga0307414_10864517
1044 Ga0307414_10942110
1045 Ga0307414_11401456
1046 Ga0307411_10001850
1047 Ga0307411_10003196
1048 Ga0307411_10042748
1049 Ga0307411_10062536
1050 Ga0307411_10091222
1051 Ga0307411_10131045
1052 Ga0307411_10135760
1053 Ga0307411_10183209
1054 Ga0307411_10351888
1055 Ga0307411_10486540
1056 Ga0307411_10513604
1057 Ga0307411_10517003
1058 Ga0307411_10823126
1059 Ga0307411_10838921
1060 Ga0307411_11444325
1061 Ga0307411_11773154
1062 Ga0307411_11827610
1063 Ga0307411_11932443
1064 Ga0307415_100002874
1065 Ga0307415_100028330
1066 Ga0307415_100046408
1067 Ga0307415_100060617
1068 Ga0307415_100340943
1069 Ga0307415_100393700
1070 Ga0307415_100492741
1071 Ga0395905_1537549
1072 Ga0436364_0135559
1073 Ga0439466_0079064
1074 Ga0439465_0096460
1075 Ga0451798_0874212
1076 Ga0439449_0254380
1077 Ga0450912_027241
1078 Ga0439434_0020032
1079 Ga0439434_0054684
1080 Ga0495650_0210282
1081 Ga0495585_0369866
1082 Ga0495606_0015264
1083 Ga0495606_0027801
1084 Ga0495620_0077701
1085 Ga0495632_0173627
1086 Ga0495648_0052884
1087 Ga0495663_0007026
1088 Ga0495663_0093541
1089 Ga0495654_0000264
1090 Ga0495654_0062312
1091 Ga0495654_0294495
1092 Ga0495598_0202889
1093 Ga0495668_0000984
1094 Ga0495668_0007734
1095 Ga0495668_0149626
1096 Ga0495625_0740818
1097 Ga0495669_0008296
1098 Ga0495669_0160686
1099 Ga0495671_0025586
1100 Ga0495589_0061780
1101 Ga0495686_0001180
1102 Ga0495686_0018090
1103 Ga0495686_0026515
1104 Ga0495686_0287246
1105 Ga0496100_0239148
1106 Ga0496101_0281784
1107 Ga0496102_0000049
1108 Ga0496103_0000037
1109 Ga0496103_0001627
1110 Ga0496103_0816797
1111 Ga0496105_0049260
1112 Ga0496105_0379336
1113 Ga0496106_0093367
1114 Ga0496107_0444279
1115 Ga0496109_0700577
1116 Ga0496109_1281450
1117 Ga0496110_0117644
1118 Ga0496110_0632438
1119 Ga0496111_0259724
1120 Ga0496114_0044764
1121 Ga0496116_0002470
1122 Ga0496116_0014040
1123 Ga0496117_0000115
1124 Ga0496117_0005604
1125 Ga0496117_0016989
1126 Ga0496117_0053363
1127 Ga0496117_0246903
1128 Ga0496118_0000086
1129 Ga0496118_0000463
1130 Ga0496118_0001090
1131 Ga0496118_0071245
1132 Ga0496118_0204361
1133 Ga0496119_0159034
1134 Ga0496119_0187205
1135 Ga0496121_0540442
1136 Ga0496122_0494303
1137 Ga0496124_0000102
1138 Ga0496124_0215432
1139 Ga0501306_093845
1140 Ga0501309_023361
1141 Ga0501310_023215
1142 Ga0501305_062556
1143 Ga0501290_000843
1144 Ga0501290_005933
1145 Ga0501292_000051
1146 Ga0501293_013287
1147 Ga0501294_002939
1148 Ga0501297_004852
1149 Ga0501300_002856
1150 Ga0501300_008763
1151 Ga0501301_006738
1152 Ga0501315_000151
1153 Ga0501315_006847
1154 Ga0501315_056215
1155 Ga0501317_000163
1156 Ga0501321_002879
1157 Ga0501321_004264
1158 Ga0501321_011337
1159 Ga0501322_001805
1160 Ga0501323_005245
1161 Ga0501323_043581
1162 Ga0501325_006917
1163 Ga0501325_028440
1164 Ga0501328_01423
1165 Ga0501332_00987
1166 Ga0501332_03662
1167 Ga0501333_000673
1168 Ga0501333_000992
1169 Ga0501334_00317
1170 Ga0501335_003435
1171 Ga0501335_007673
1172 Ga0501336_002953
1173 Ga0501336_003548
1174 Ga0501336_005438
1175 Ga0501337_001436
1176 Ga0501337_009739
1177 Ga0501202_023695
1178 Ga0501202_241881
1179 Ga0501206_000971
1180 Ga0501207_059461
1181 Ga0501222_001339
1182 Ga0501222_089714
1183 Ga0501223_004059
1184 Ga0501223_031564
1185 Ga0501224_005136
1186 Ga0501227_008888
1187 Ga0501233_080782
1188 Ga0501235_001639
1189 Ga0501242_014919
1190 Ga0501251_018583
1191 Ga0501252_019401
1192 Ga0501257_000127
1193 Ga0501257_016925
1194 Ga0501257_250001
1195 Ga0501259_004767
1196 Ga0501259_130552
1197 Ga0501261_000034
1198 Ga0501221_230188
1199 Ga0501225_0002879
1200 Ga0501229_012183
1201 Ga0501245_016223
1202 Ga0501264_011125
1203 Ga0501268_007585
1204 Ga0501268_035980
1205 Ga0501268_064555
1206 Ga0501273_032166
1207 Ga0501273_050320
1208 Ga0501276_001940
1209 Ga0501279_000036
1210 Ga0501280_000020
1211 Ga0501281_00214
1212 Ga0501282_000015
1213 Ga0501283_036394
1214 nmdc:mga08y16_923861_c1
1215 Ga0500643_000030
1216 Ga0500643_000241
1217 Ga0500643_069346
1218 Ga0500646_0044176
1219 Ga0500592_000121
1220 Ga0500592_005167
1221 Ga0500594_0010509
1222 Ga0500559_0170875
1223 Ga0500568_0010173
1224 Ga0500568_0040812
1225 Ga0500577_0056447
1226 Ga0500604_0000017
1227 Ga0500604_0006520
1228 Ga0500604_0022836
1229 Ga0500604_0022931
1230 Ga0500616_0000711
1231 Ga0500616_0099575
1232 Ga0500627_0000199
1233 Ga0500627_0001004
1234 Ga0500611_021825
1235 Ga0500587_018211
1236 Ga0590075_058011
1237 Ga0587077_000971
1238 Ga0587077_031327
1239 Ga0587082_002336
1240 Ga0587101_001137
1241 Ga0587128_008756
1242 Ga0587076_002302

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

13

153

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.7854 41 129
8pek-assembly1.cif.gz_B structure of the dimeric, periplasmic domain of exbd 0.7811 29 129
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.7569 41 129
1vdm-assembly1.cif.gz_I crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3 0.7447 97 130
6utp-assembly1.cif.gz_A lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase in complex with cobalt 0.713 65 131
ID Description Score Start End Superfamily
af_A0A144A1E9_126_211_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.7734 97 138 3.40.1350.10
af_A0A1D8PDD4_238_365_3.50.30.30 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; 0.7354 95 131 3.50.30.30
af_A4HWL8_27_158_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7239 66 132 3.30.420.40
af_A0A0R4IHF7_15_222_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7052 41 130 3.40.50.300
af_P9WK91_74_280_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.6881 70 136 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A520YAN4-F1-model_v4 Biopolymer transporter ExbD 0.9079 45 137
AF-A0A4Q3XPT4-F1-model_v4 Biopolymer transporter ExbD 0.9017 30 134 GO:0005886
GO:0015031
GO:0022857
AF-A0A2A4P3E7-F1-model_v4 deleted 0.8987 36 136
AF-A0A4Q6GDD9-F1-model_v4 deleted 0.8921 36 135
AF-A0A109LRX3-F1-model_v4 Uncharacterized protein 0.8851 41 135

Map