F469980

General Info

Members Datasets Scaffolds Average Seq Length
621 214 621 156

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100000406|Ga0070675_1000004064
Length 184
Sequence MFGRTSTSPLSFLRAFNEKLRRNREEYMTDDDLYRRSVGVMLLNREGKVFVGARIDNTDEAWQMPQGGIDKGEEPWATAQRELEEETGIPPHLVERIAKCPERLRYDLPEGARQRLWGGKWRGQLQDWYVARFLGEDRDVNIATKHPEFREWKWVEPEQLPDLIVPFKRDMYRRLLDEFAEYLN

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
182 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
183 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
207 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
208 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.96
Rhizosphere 93.72
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10033536 3300001989 Bacteria 1756
2 JGI24737J22298_10006347 3300001990 Bacteria 4042
3 JGI24735J21928_10105853 3300002067 Bacteria 808
4 JGI24744J21845_10002777 3300002077 Bacteria 3577
5 JGI24034J26672_10034511 3300002239 Bacteria 834
6 Ga0065715_10036426 3300005293 Bacteria 1390
7 Ga0065715_10578853 3300005293 Bacteria 722
8 Ga0070658_10017100 3300005327 Bacteria 5804
9 Ga0070658_10138385 3300005327 Bacteria 2033
10 Ga0070658_10254878 3300005327 Bacteria 1489
11 Ga0070683_100171960 3300005329 Bacteria 2056
12 Ga0070690_100006117 3300005330 Bacteria 6812
13 Ga0070690_100007444 3300005330 Bacteria 6273
14 Ga0070670_100006931 3300005331 Bacteria 9606
15 Ga0070670_100062929 3300005331 Bacteria 3185
16 Ga0070677_10031744 3300005333 Bacteria 2021
17 Ga0070677_10061302 3300005333 Bacteria 1552
18 Ga0068869_100451986 3300005334 Bacteria 1065
19 Ga0070666_10000555 3300005335 Bacteria 22543
20 Ga0070666_10000788 3300005335 Bacteria 19216
21 Ga0070666_10005791 3300005335 Bacteria 7592
22 Ga0070666_10044201 3300005335 Bacteria 2983
23 Ga0070666_10203544 3300005335 Bacteria 1393
24 Ga0070680_100578402 3300005336 Bacteria 963
25 Ga0068868_100000211 3300005338 Bacteria 39269
26 Ga0068868_100174617 3300005338 Bacteria 1780
27 Ga0070660_100005925 3300005339 Bacteria 8452
28 Ga0070660_100015688 3300005339 Bacteria 5477
29 Ga0070660_100062127 3300005339 Bacteria 2901
30 Ga0070660_100420387 3300005339 Bacteria 1107
31 Ga0070689_100276132 3300005340 Bacteria 1393
32 Ga0070661_100008952 3300005344 Bacteria 6929
33 Ga0070661_100057827 3300005344 Bacteria 2841
34 Ga0070661_100298901 3300005344 Bacteria 1253
35 Ga0070661_100659957 3300005344 Bacteria 849
36 Ga0070661_101147391 3300005344 Bacteria 649
37 Ga0070661_101327881 3300005344 Bacteria 604
38 Ga0070692_10130468 3300005345 Bacteria 1412
39 Ga0070668_101086876 3300005347 Bacteria 721
40 Ga0070669_100043759 3300005353 Bacteria 3262
41 Ga0070669_100322518 3300005353 Bacteria 1248
42 Ga0070669_101597975 3300005353 Bacteria 568
43 Ga0070675_100000406 3300005354 Bacteria 29300
44 Ga0070671_100000906 3300005355 Bacteria 21613
45 Ga0070671_100002991 3300005355 Bacteria 13155
46 Ga0070671_100016359 3300005355 Bacteria 5998
47 Ga0070671_100020477 3300005355 Bacteria 5395
48 Ga0070671_100225821 3300005355 Bacteria 1589
49 Ga0070671_101162100 3300005355 Bacteria 679
50 Ga0070674_100002387 3300005356 Bacteria 10377
51 Ga0070673_100003428 3300005364 Bacteria 9877
52 Ga0070673_100008746 3300005364 Bacteria 6758
53 Ga0070673_100021593 3300005364 Bacteria 4671
54 Ga0070673_100031392 3300005364 Bacteria 3986
55 Ga0070673_100648210 3300005364 Bacteria 966
56 Ga0070659_100034545 3300005366 Bacteria 3933
57 Ga0070659_100077044 3300005366 Bacteria 2659
58 Ga0070659_100148860 3300005366 Bacteria 1909
59 Ga0070659_100169778 3300005366 Bacteria 1786
60 Ga0070659_100359143 3300005366 Bacteria 1223
61 Ga0070667_100000368 3300005367 Bacteria 49069
62 Ga0070667_100001014 3300005367 Bacteria 25719
63 Ga0070667_100003689 3300005367 Bacteria 13031
64 Ga0070667_100007895 3300005367 Bacteria 8828
65 Ga0070667_100046252 3300005367 Bacteria 3661
66 Ga0070667_100551016 3300005367 Bacteria 1060
67 Ga0070714_100023000 3300005435 Bacteria 5115
68 Ga0070714_100040304 3300005435 Bacteria 3936
69 Ga0070713_100008902 3300005436 Bacteria 7149
70 Ga0070713_100403213 3300005436 Bacteria 1277
71 Ga0070694_100050138 3300005444 Bacteria 2813
72 Ga0070663_100116197 3300005455 Bacteria 2016
73 Ga0070663_100129435 3300005455 Bacteria 1915
74 Ga0070663_100309076 3300005455 Bacteria 1268
75 Ga0070663_100631777 3300005455 Bacteria 904
76 Ga0070678_100124780 3300005456 Bacteria 2036
77 Ga0070678_100180842 3300005456 Bacteria 1726
78 Ga0070678_100186883 3300005456 Bacteria 1701
79 Ga0070662_100000826 3300005457 Bacteria 19065
80 Ga0070662_100015643 3300005457 Bacteria 5086
81 Ga0070662_100037214 3300005457 Bacteria 3449
82 Ga0070662_100041680 3300005457 Bacteria 3276
83 Ga0070662_100371416 3300005457 Bacteria 1175
84 Ga0070662_100389310 3300005457 Bacteria 1149
85 Ga0070662_100665787 3300005457 Bacteria 879
86 Ga0068867_100002635 3300005459 Bacteria 12659
87 Ga0068867_100325487 3300005459 Bacteria 1275
88 Ga0070685_10440693 3300005466 Bacteria 910
89 Ga0070679_100714389 3300005530 Bacteria 945
90 Ga0070684_101374650 3300005535 Bacteria 665
91 Ga0068853_100084977 3300005539 Bacteria 2773
92 Ga0068853_100414729 3300005539 Bacteria 1262
93 Ga0070672_100012235 3300005543 Bacteria 6014
94 Ga0070672_100036320 3300005543 Bacteria 3754
95 Ga0070672_100057547 3300005543 Bacteria 3052
96 Ga0070672_100069704 3300005543 Bacteria 2793
97 Ga0070672_100285504 3300005543 Bacteria 1396
98 Ga0070672_100355481 3300005543 Bacteria 1249
99 Ga0070686_100264114 3300005544 Bacteria 1263
100 Ga0070695_101143359 3300005545 Bacteria 639
101 Ga0070665_100000511 3300005548 Bacteria 55709
102 Ga0070665_100153075 3300005548 Bacteria 2308
103 Ga0068855_100251824 3300005563 Bacteria 1970
104 Ga0068855_100505938 3300005563 Bacteria 1312
105 Ga0068855_101483552 3300005563 Bacteria 697
106 Ga0070664_100001180 3300005564 Bacteria 20792
107 Ga0070664_100002666 3300005564 Bacteria 14399
108 Ga0070664_100007769 3300005564 Bacteria 8658
109 Ga0070664_100139965 3300005564 Bacteria 2130
110 Ga0070664_100143066 3300005564 Bacteria 2107
111 Ga0068857_100034319 3300005577 Bacteria 4487
112 Ga0068857_100083334 3300005577 Bacteria 2856
113 Ga0068857_100421557 3300005577 Bacteria 1244
114 Ga0068857_101244150 3300005577 Bacteria 721
115 Ga0068854_100089841 3300005578 Bacteria 2283
116 Ga0068854_100162154 3300005578 Bacteria 1733
117 Ga0068854_100255352 3300005578 Bacteria 1401
118 Ga0068856_100056502 3300005614 Bacteria 3873
119 Ga0068856_100094984 3300005614 Bacteria 2969
120 Ga0068856_100706371 3300005614 Bacteria 1029
121 Ga0068852_100010871 3300005616 Bacteria 6819
122 Ga0068852_100750374 3300005616 Bacteria 988
123 Ga0068852_101072000 3300005616 Bacteria 826
124 Ga0068859_100000221 3300005617 Bacteria 56589
125 Ga0068859_100064332 3300005617 Bacteria 3700
126 Ga0068859_100100324 3300005617 Bacteria 2951
127 Ga0068864_100000721 3300005618 Bacteria 27640
128 Ga0068864_100013419 3300005618 Bacteria 6791
129 Ga0068864_100039553 3300005618 Bacteria 4031
130 Ga0068864_100052021 3300005618 Bacteria 3530
131 Ga0068866_10050692 3300005718 Bacteria 2109
132 Ga0068866_10067856 3300005718 Bacteria 1873
133 Ga0068866_10196673 3300005718 Bacteria 1202
134 Ga0068866_10418121 3300005718 Bacteria 869
135 Ga0068861_100337986 3300005719 Bacteria 1317
136 Ga0068861_101378960 3300005719 Bacteria 688
137 Ga0068851_10002496 3300005834 Bacteria 8088
138 Ga0068851_10181507 3300005834 Bacteria 1166
139 Ga0068863_100008573 3300005841 Bacteria 9990
140 Ga0068863_100010798 3300005841 Bacteria 8856
141 Ga0068863_100063563 3300005841 Bacteria 3491
142 Ga0068863_100235114 3300005841 Bacteria 1768
143 Ga0068863_101059780 3300005841 Bacteria 815
144 Ga0068858_100000919 3300005842 Bacteria 30552
145 Ga0068858_100004134 3300005842 Bacteria 14284
146 Ga0068858_100008371 3300005842 Bacteria 9949
147 Ga0068858_100055226 3300005842 Bacteria 3671
148 Ga0068860_100004735 3300005843 Bacteria 13869
149 Ga0068860_100007585 3300005843 Bacteria 10857
150 Ga0068860_100041104 3300005843 Bacteria 4417
151 Ga0068860_100167921 3300005843 Bacteria 2119
152 Ga0068860_100252781 3300005843 Bacteria 1717
153 Ga0068860_100303757 3300005843 Bacteria 1564
154 Ga0068860_100348048 3300005843 Bacteria 1458
155 Ga0068862_100023550 3300005844 Bacteria 5161
156 Ga0068862_100040267 3300005844 Bacteria 3972
157 Ga0070717_10035121 3300006028 Bacteria 4056
158 Ga0070716_100282663 3300006173 Bacteria 1146
159 Ga0097621_100141304 3300006237 Bacteria 2057
160 Ga0097621_100547643 3300006237 Bacteria 1053
161 Ga0097621_100776106 3300006237 Bacteria 887
162 Ga0097621_101150706 3300006237 Bacteria 730
163 Ga0068871_100010804 3300006358 Bacteria 6681
164 Ga0068871_100074962 3300006358 Bacteria 2792
165 Ga0068871_100631970 3300006358 Bacteria 976
166 Ga0068871_101270334 3300006358 Bacteria 692
167 Ga0075431_100287860 3300006847 Bacteria 1663
168 Ga0075433_10011356 3300006852 Bacteria 7169
169 Ga0068865_100004204 3300006881 Bacteria 8673
170 Ga0097620_100000221 3300006931 Bacteria 56589
171 Ga0097620_100064331 3300006931 Bacteria 3700
172 Ga0097620_100100324 3300006931 Bacteria 2951
173 Ga0105251_10189926 3300009011 Bacteria 925
174 Ga0105240_10314455 3300009093 Bacteria 1787
175 Ga0105245_10018371 3300009098 Bacteria 6114
176 Ga0105245_10156131 3300009098 Bacteria 2161
177 Ga0105245_10171976 3300009098 Bacteria 2063
178 Ga0105245_11006832 3300009098 Bacteria 878
179 Ga0105247_10057624 3300009101 Bacteria 2402
180 Ga0105247_10243311 3300009101 Bacteria 1227
181 Ga0105247_10319650 3300009101 Bacteria 1082
182 Ga0105243_10219656 3300009148 Bacteria 1679
183 Ga0105243_10759310 3300009148 Bacteria 951
184 Ga0105242_10245568 3300009176 Bacteria 1611
185 Ga0105242_11012603 3300009176 Bacteria 839
186 Ga0105248_10000442 3300009177 Bacteria 47089
187 Ga0105248_10000502 3300009177 Bacteria 44596
188 Ga0105248_10001111 3300009177 Bacteria 29874
189 Ga0105248_10030286 3300009177 Bacteria 6043
190 Ga0105248_10106400 3300009177 Bacteria 3163
191 Ga0105248_10138802 3300009177 Bacteria 2742
192 Ga0105248_10214055 3300009177 Bacteria 2171
193 Ga0105248_10606714 3300009177 Bacteria 1235
194 Ga0105238_10004331 3300009551 Bacteria 14084
195 Ga0105249_10013266 3300009553 Bacteria 7272
196 Ga0105249_10018924 3300009553 Bacteria 6138
197 Ga0105249_10109045 3300009553 Bacteria 2614
198 Ga0105249_11019249 3300009553 Bacteria 897
199 Ga0105239_10648141 3300010375 Bacteria 1206
200 Ga0105239_11725453 3300010375 Bacteria 725
201 Ga0105246_10100888 3300011119 Bacteria 2101
202 Ga0105246_10361649 3300011119 Bacteria 1193
203 Ga0157370_10004644 3300013104 Bacteria 15698
204 Ga0157369_10053404 3300013105 Bacteria 4368
205 Ga0157374_10295185 3300013296 Bacteria 1603
206 Ga0157374_10372088 3300013296 Bacteria 1422
207 Ga0157378_10113488 3300013297 Bacteria 2488
208 Ga0163162_10068607 3300013306 Bacteria 3597
209 Ga0163162_10268318 3300013306 Bacteria 1838
210 Ga0157375_10032612 3300013308 Bacteria 4941
211 Ga0157375_10042947 3300013308 Bacteria 4380
212 Ga0157375_10073886 3300013308 Bacteria 3429
213 Ga0157375_10184646 3300013308 Bacteria 2238
214 Ga0157375_10527432 3300013308 Bacteria 1344
215 Ga0157375_10718682 3300013308 Bacteria 1152
216 Ga0163163_10000164 3300014325 Bacteria 69244
217 Ga0163163_11840318 3300014325 Bacteria 665
218 Ga0157377_10020587 3300014745 Bacteria 3459
219 Ga0157377_10155783 3300014745 Bacteria 1416
220 Ga0157379_10030141 3300014968 Bacteria 4826
221 Ga0157379_10082317 3300014968 Bacteria 2884
222 Ga0157379_10142557 3300014968 Bacteria 2160
223 Ga0157379_10217605 3300014968 Bacteria 1730
224 Ga0157376_10036609 3300014969 Bacteria 3977
225 Ga0163161_10258303 3300017792 Bacteria 1360
226 Ga0163161_10635517 3300017792 Bacteria 883
227 Ga0207697_10031976 3300025315 Bacteria 2153
228 Ga0207697_10388847 3300025315 Bacteria 619
229 Ga0207656_10004393 3300025321 Bacteria 4922
230 Ga0207656_10102432 3300025321 Bacteria 1314
231 Ga0207682_10235729 3300025893 Bacteria 849
232 Ga0207682_10320688 3300025893 Bacteria 728
233 Ga0207682_10476605 3300025893 Bacteria 591
234 Ga0207642_10099107 3300025899 Bacteria 1458
235 Ga0207642_10668231 3300025899 Bacteria 652
236 Ga0207710_10093261 3300025900 Bacteria 1412
237 Ga0207680_10001520 3300025903 Bacteria 10929
238 Ga0207680_10021479 3300025903 Bacteria 3493
239 Ga0207680_10032911 3300025903 Bacteria 2952
240 Ga0207647_10006533 3300025904 Bacteria 8472
241 Ga0207647_10014408 3300025904 Bacteria 5452
242 Ga0207647_10057408 3300025904 Bacteria 2386
243 Ga0207645_10079335 3300025907 Bacteria 2104
244 Ga0207705_10006093 3300025909 Bacteria 8975
245 Ga0207705_10130912 3300025909 Bacteria 1867
246 Ga0207705_10153720 3300025909 Bacteria 1725
247 Ga0207705_10294132 3300025909 Bacteria 1244
248 Ga0207695_10868984 3300025913 Bacteria 782
249 Ga0207662_10141256 3300025918 Bacteria 1525
250 Ga0207662_10188241 3300025918 Bacteria 1331
251 Ga0207657_10005157 3300025919 Bacteria 13704
252 Ga0207657_10025850 3300025919 Bacteria 5406
253 Ga0207657_10026293 3300025919 Bacteria 5351
254 Ga0207657_10052286 3300025919 Bacteria 3546
255 Ga0207657_10069737 3300025919 Bacteria 2982
256 Ga0207657_10727047 3300025919 Bacteria 770
257 Ga0207657_10840901 3300025919 Bacteria 708
258 Ga0207649_10004475 3300025920 Bacteria 7584
259 Ga0207649_10032471 3300025920 Bacteria 3112
260 Ga0207649_10162750 3300025920 Bacteria 1547
261 Ga0207649_10244484 3300025920 Bacteria 1290
262 Ga0207681_10030079 3300025923 Bacteria 3537
263 Ga0207681_10030398 3300025923 Bacteria 3521
264 Ga0207681_10122773 3300025923 Bacteria 1907
265 Ga0207681_11528258 3300025923 Bacteria 559
266 Ga0207694_10007521 3300025924 Bacteria 8255
267 Ga0207650_10008430 3300025925 Bacteria 7035
268 Ga0207650_10114145 3300025925 Bacteria 2095
269 Ga0207650_10232118 3300025925 Bacteria 1488
270 Ga0207659_10002500 3300025926 Bacteria 10963
271 Ga0207687_10165684 3300025927 Bacteria 1700
272 Ga0207700_10088331 3300025928 Bacteria 2440
273 Ga0207700_10161306 3300025928 Bacteria 1862
274 Ga0207664_10016602 3300025929 Bacteria 5376
275 Ga0207664_10205708 3300025929 Bacteria 1701
276 Ga0207644_10000616 3300025931 Bacteria 22668
277 Ga0207644_10085493 3300025931 Bacteria 2340
278 Ga0207644_10089383 3300025931 Bacteria 2292
279 Ga0207644_10193005 3300025931 Bacteria 1602
280 Ga0207644_10212461 3300025931 Bacteria 1530
281 Ga0207690_10022837 3300025932 Bacteria 3896
282 Ga0207690_10037622 3300025932 Bacteria 3143
283 Ga0207690_10040317 3300025932 Bacteria 3052
284 Ga0207690_10056299 3300025932 Bacteria 2652
285 Ga0207690_10079667 3300025932 Bacteria 2283
286 Ga0207690_10382434 3300025932 Bacteria 1119
287 Ga0207706_10000479 3300025933 Bacteria 42802
288 Ga0207706_10001812 3300025933 Bacteria 20983
289 Ga0207706_10008086 3300025933 Bacteria 9707
290 Ga0207706_10009763 3300025933 Bacteria 8809
291 Ga0207706_10051884 3300025933 Bacteria 3621
292 Ga0207706_10061818 3300025933 Bacteria 3299
293 Ga0207706_10161991 3300025933 Bacteria 1966
294 Ga0207706_10231777 3300025933 Bacteria 1615
295 Ga0207706_10403158 3300025933 Bacteria 1186
296 Ga0207706_10894411 3300025933 Bacteria 750
297 Ga0207686_10151615 3300025934 Bacteria 1614
298 Ga0207709_10117503 3300025935 Bacteria 1790
299 Ga0207709_10291946 3300025935 Bacteria 1209
300 Ga0207670_10339724 3300025936 Bacteria 1186
301 Ga0207669_10017274 3300025937 Bacteria 3696
302 Ga0207669_10180851 3300025937 Bacteria 1511
303 Ga0207704_10004322 3300025938 Bacteria 6493
304 Ga0207704_10102253 3300025938 Bacteria 1913
305 Ga0207704_10141771 3300025938 Bacteria 1682
306 Ga0207704_10168646 3300025938 Bacteria 1567
307 Ga0207665_10126971 3300025939 Bacteria 1807
308 Ga0207691_10005014 3300025940 Bacteria 12769
309 Ga0207691_10015125 3300025940 Bacteria 7343
310 Ga0207691_10044575 3300025940 Bacteria 4081
311 Ga0207691_10057904 3300025940 Bacteria 3526
312 Ga0207691_10070581 3300025940 Bacteria 3154
313 Ga0207691_10235640 3300025940 Bacteria 1583
314 Ga0207711_10000042 3300025941 Bacteria 158782
315 Ga0207711_10000526 3300025941 Bacteria 39259
316 Ga0207711_10010774 3300025941 Bacteria 7601
317 Ga0207711_10057251 3300025941 Bacteria 3351
318 Ga0207711_10062000 3300025941 Bacteria 3225
319 Ga0207711_10076715 3300025941 Bacteria 2911
320 Ga0207689_10235776 3300025942 Bacteria 1512
321 Ga0207689_10458846 3300025942 Bacteria 1065
322 Ga0207661_10136313 3300025944 Bacteria 2108
323 Ga0207679_10004310 3300025945 Bacteria 8850
324 Ga0207679_10006770 3300025945 Bacteria 7260
325 Ga0207679_10012568 3300025945 Bacteria 5524
326 Ga0207679_10014999 3300025945 Bacteria 5107
327 Ga0207679_10558926 3300025945 Bacteria 1027
328 Ga0207667_10021080 3300025949 Bacteria 7228
329 Ga0207667_10534416 3300025949 Bacteria 1187
330 Ga0207667_11973220 3300025949 Bacteria 544
331 Ga0207651_10002050 3300025960 Bacteria 9483
332 Ga0207651_10026383 3300025960 Bacteria 3628
333 Ga0207651_10034714 3300025960 Bacteria 3270
334 Ga0207651_10092783 3300025960 Bacteria 2215
335 Ga0207712_10001308 3300025961 Bacteria 17062
336 Ga0207712_10006872 3300025961 Bacteria 7184
337 Ga0207668_10564496 3300025972 Bacteria 987
338 Ga0207640_10010718 3300025981 Bacteria 5170
339 Ga0207640_10114059 3300025981 Bacteria 1922
340 Ga0207640_11131577 3300025981 Bacteria 694
341 Ga0207658_10001750 3300025986 Bacteria 16338
342 Ga0207658_10007960 3300025986 Bacteria 7218
343 Ga0207658_10024551 3300025986 Bacteria 4218
344 Ga0207658_10047697 3300025986 Bacteria 3136
345 Ga0207658_10053870 3300025986 Bacteria 2974
346 Ga0207658_10206595 3300025986 Bacteria 1643
347 Ga0207677_10001325 3300026023 Bacteria 13285
348 Ga0207677_10015460 3300026023 Bacteria 4491
349 Ga0207703_10000774 3300026035 Bacteria 31453
350 Ga0207703_10002018 3300026035 Bacteria 17909
351 Ga0207703_10002526 3300026035 Bacteria 15808
352 Ga0207703_10005559 3300026035 Bacteria 10116
353 Ga0207703_10432815 3300026035 Bacteria 1226
354 Ga0207639_10102172 3300026041 Bacteria 2320
355 Ga0207639_10157400 3300026041 Bacteria 1910
356 Ga0207639_10325779 3300026041 Bacteria 1365
357 Ga0207678_10011742 3300026067 Bacteria 7687
358 Ga0207678_10079840 3300026067 Bacteria 2801
359 Ga0207678_10274943 3300026067 Bacteria 1445
360 Ga0207678_10287211 3300026067 Bacteria 1412
361 Ga0207678_10677550 3300026067 Bacteria 907
362 Ga0207702_10075862 3300026078 Bacteria 2905
363 Ga0207702_10113023 3300026078 Bacteria 2418
364 Ga0207702_10147182 3300026078 Bacteria 2138
365 Ga0207641_10000415 3300026088 Bacteria 49760
366 Ga0207641_10009684 3300026088 Bacteria 7939
367 Ga0207641_10045031 3300026088 Bacteria 3713
368 Ga0207641_10209735 3300026088 Bacteria 1801
369 Ga0207641_10404758 3300026088 Bacteria 1311
370 Ga0207641_11038499 3300026088 Bacteria 817
371 Ga0207648_10005222 3300026089 Bacteria 13134
372 Ga0207648_10052091 3300026089 Bacteria 3578
373 Ga0207648_10132670 3300026089 Bacteria 2192
374 Ga0207676_10000456 3300026095 Bacteria 34458
375 Ga0207676_10015775 3300026095 Bacteria 5461
376 Ga0207676_10026126 3300026095 Bacteria 4340
377 Ga0207676_10038503 3300026095 Bacteria 3651
378 Ga0207676_10048861 3300026095 Bacteria 3287
379 Ga0207676_10059651 3300026095 Bacteria 3014
380 Ga0207674_10034993 3300026116 Bacteria 5244
381 Ga0207674_10044158 3300026116 Bacteria 4592
382 Ga0207674_10058956 3300026116 Bacteria 3887
383 Ga0207683_10002818 3300026121 Bacteria 15185
384 Ga0207683_10073255 3300026121 Bacteria 3030
385 Ga0207683_10087317 3300026121 Bacteria 2773
386 Ga0207683_10288106 3300026121 Bacteria 1501
387 Ga0207698_10088692 3300026142 Bacteria 2523
388 Ga0207698_10104679 3300026142 Bacteria 2355
389 Ga0207698_10150225 3300026142 Bacteria 2021
390 Ga0207698_10423547 3300026142 Bacteria 1278
391 Ga0268266_10002822 3300028379 Bacteria 18125
392 Ga0268266_10019148 3300028379 Bacteria 5829
393 Ga0268266_10184745 3300028379 Bacteria 1900
394 Ga0268265_10025502 3300028380 Bacteria 4198
395 Ga0268265_10045818 3300028380 Bacteria 3266
396 Ga0268264_10000710 3300028381 Bacteria 38345
397 Ga0268264_10000750 3300028381 Bacteria 36591
398 Ga0268264_10117548 3300028381 Bacteria 2339
399 Ga0268264_10130689 3300028381 Bacteria 2225
400 Ga0268264_10142950 3300028381 Bacteria 2136
401 Ga0268264_10160411 3300028381 Bacteria 2025
402 Ga0268264_10248826 3300028381 Bacteria 1650
403 Ga0268264_10256809 3300028381 Bacteria 1626
404 Ga0268264_11915197 3300028381 Bacteria 602
405 Ga0307408_100292763 3300031548 Bacteria 1360
406 Ga0307408_100673122 3300031548 Bacteria 927
407 Ga0307408_100685451 3300031548 Bacteria 920
408 Ga0307405_10011231 3300031731 Bacteria 4682
409 Ga0307405_10031034 3300031731 Bacteria 3141
410 Ga0307405_10314613 3300031731 Bacteria 1193
411 Ga0307413_10049136 3300031824 Bacteria 2526
412 Ga0307413_10063116 3300031824 Bacteria 2296
413 Ga0307413_10079475 3300031824 Bacteria 2096
414 Ga0307413_10239543 3300031824 Bacteria 1338
415 Ga0307413_10364375 3300031824 Bacteria 1120
416 Ga0307413_11046525 3300031824 Bacteria 702
417 Ga0307410_10009323 3300031852 Bacteria 5499
418 Ga0307410_10038637 3300031852 Bacteria 3128
419 Ga0307410_10061165 3300031852 Bacteria 2576
420 Ga0307410_10168031 3300031852 Bacteria 1650
421 Ga0307410_10310543 3300031852 Bacteria 1247
422 Ga0307406_10084904 3300031901 Bacteria 2115
423 Ga0307406_10239820 3300031901 Bacteria 1359
424 Ga0307407_10017326 3300031903 Bacteria 3611
425 Ga0307407_10063338 3300031903 Bacteria 2169
426 Ga0307407_10170891 3300031903 Bacteria 1431
427 Ga0307407_10272250 3300031903 Bacteria 1169
428 Ga0307407_10854635 3300031903 Bacteria 695
429 Ga0307412_10410255 3300031911 Bacteria 1105
430 Ga0307409_100007554 3300031995 Bacteria 6514
431 Ga0307409_100027003 3300031995 Bacteria 4060
432 Ga0307409_100047357 3300031995 Bacteria 3262
433 Ga0307409_100097134 3300031995 Bacteria 2432
434 Ga0307409_100126283 3300031995 Bacteria 2176
435 Ga0307409_100654363 3300031995 Bacteria 1045
436 Ga0307409_101313762 3300031995 Bacteria 748
437 Ga0307409_101620888 3300031995 Bacteria 675
438 Ga0307416_100014635 3300032002 Bacteria 5387
439 Ga0307416_100341033 3300032002 Bacteria 1511
440 Ga0307416_100799892 3300032002 Bacteria 1038
441 Ga0307416_101402646 3300032002 Bacteria 804
442 Ga0307414_10003073 3300032004 Bacteria 8856
443 Ga0307414_10064401 3300032004 Bacteria 2610
444 Ga0307414_10154709 3300032004 Bacteria 1813
445 Ga0307414_10436290 3300032004 Bacteria 1145
446 Ga0307414_10515867 3300032004 Bacteria 1060
447 Ga0307411_10001507 3300032005 Bacteria 9583
448 Ga0307411_10016978 3300032005 Bacteria 4133
449 Ga0307411_10104879 3300032005 Bacteria 2008
450 Ga0307411_10150549 3300032005 Bacteria 1728
451 Ga0307411_10259408 3300032005 Bacteria 1371
452 Ga0307411_10660689 3300032005 Bacteria 906
453 Ga0307415_100014964 3300032126 Bacteria 4579
454 Ga0307415_100403788 3300032126 Bacteria 1167
455 Ga0307415_100513342 3300032126 Bacteria 1050
456 Ga0307415_100591470 3300032126 Bacteria 986
457 Ga0307415_100915693 3300032126 Unclassified 809
458 Ga0373929_0023594 3300035085 Bacteria 1265
459 Ga0373951_0075368 3300035091 Bacteria 865
460 Ga0373932_0031024 3300035112 Bacteria 1486
461 Ga0373942_0047216 3300035207 Bacteria 1196
462 Ga0373935_0052714 3300035692 Bacteria 2587
463 Ga0395899_0019397 3300037312 Bacteria 5167
464 Ga0395899_0029173 3300037312 Bacteria 4150
465 Ga0395899_0041369 3300037312 Bacteria 3443
466 Ga0395899_0056551 3300037312 Bacteria 2899
467 Ga0395899_0138586 3300037312 Bacteria 1732
468 Ga0395899_0179827 3300037312 Bacteria 1485
469 Ga0395899_0459874 3300037312 Bacteria 832
470 Ga0395899_0653982 3300037312 Bacteria 664
471 Ga0395899_0786936 3300037312 Bacteria 589
472 Ga0395900_0035040 3300037418 Bacteria 5169
473 Ga0395900_0041989 3300037418 Bacteria 4712
474 Ga0395900_0057318 3300037418 Bacteria 4010
475 Ga0395900_0082995 3300037418 Bacteria 3292
476 Ga0395900_0113474 3300037418 Bacteria 2781
477 Ga0395900_0167469 3300037418 Unclassified 2239
478 Ga0395900_0176242 3300037418 Bacteria 2174
479 Ga0395900_0219304 3300037418 Bacteria 1918
480 Ga0395900_0312196 3300037418 Bacteria 1555
481 Ga0395900_0337519 3300037418 Bacteria 1483
482 Ga0395900_0392518 3300037418 Bacteria 1353
483 Ga0395900_0429053 3300037418 Bacteria 1281
484 Ga0395900_0793106 3300037418 Bacteria 875
485 Ga0395900_0796015 3300037418 Bacteria 873
486 Ga0395900_0997746 3300037418 Bacteria 757
487 Ga0395900_1231314 3300037418 Bacteria 663
488 Ga0395898_0021736 3300037466 Bacteria 6502
489 Ga0395898_0050528 3300037466 Bacteria 4068
490 Ga0395898_0088271 3300037466 Bacteria 2985
491 Ga0395898_0157197 3300037466 Bacteria 2174
492 Ga0395898_0222430 3300037466 Bacteria 1800
493 Ga0395898_0498248 3300037466 Bacteria 1158
494 Ga0395898_0560965 3300037466 Bacteria 1084
495 Ga0395905_0002298 3300037471 Bacteria 21443
496 Ga0395905_0008567 3300037471 Bacteria 10083
497 Ga0395905_0026597 3300037471 Bacteria 5455
498 Ga0395905_0028256 3300037471 Bacteria 5287
499 Ga0395905_0041077 3300037471 Bacteria 4340
500 Ga0395905_0067620 3300037471 Bacteria 3346
501 Ga0395905_0091823 3300037471 Bacteria 2846
502 Ga0395905_0111465 3300037471 Bacteria 2569
503 Ga0395905_0131286 3300037471 Bacteria 2356
504 Ga0395905_0163075 3300037471 Bacteria 2094
505 Ga0395905_0206167 3300037471 Bacteria 1842
506 Ga0395905_0356176 3300037471 Bacteria 1356
507 Ga0395905_0633681 3300037471 Bacteria 971
508 Ga0395905_0757347 3300037471 Bacteria 873
509 Ga0395905_0757369 3300037471 Bacteria 873
510 Ga0395905_0836823 3300037471 Bacteria 823
511 Ga0395905_1857979 3300037471 Bacteria 508
512 Ga0436364_0131383 3300037853 Bacteria 812
513 Ga0395901_0029596 3300038443 Bacteria 5639
514 Ga0395901_0056909 3300038443 Bacteria 4067
515 Ga0395901_0064902 3300038443 Bacteria 3801
516 Ga0395901_0087060 3300038443 Bacteria 3266
517 Ga0395901_0146597 3300038443 Bacteria 2480
518 Ga0395901_0158839 3300038443 Bacteria 2374
519 Ga0395901_0169030 3300038443 Bacteria 2294
520 Ga0395901_0203025 3300038443 Bacteria 2077
521 Ga0395901_0241700 3300038443 Bacteria 1883
522 Ga0395901_0394142 3300038443 Bacteria 1423
523 Ga0395901_0547151 3300038443 Bacteria 1173
524 Ga0395901_0762026 3300038443 Bacteria 960
525 Ga0395901_1023344 3300038443 Bacteria 800
526 Ga0436365_0277830 3300039437 Bacteria 1227
527 Ga0450914_029667 3300042118 Bacteria 653
528 Ga0466972_0049943 3300044658 Bacteria 2020
529 Ga0466972_0287617 3300044658 Bacteria 768
530 Ga0466965_0130090 3300044683 Bacteria 1305
531 Ga0466966_0121825 3300044684 Bacteria 1601
532 Ga0466966_0406542 3300044684 Bacteria 818
533 Ga0466961_0115788 3300044693 Bacteria 1685
534 Ga0466961_0134437 3300044693 Bacteria 1550
535 Ga0466963_0012668 3300044694 Bacteria 5166
536 Ga0466963_0045689 3300044694 Bacteria 2885
537 Ga0466971_0017102 3300044719 Bacteria 3204
538 Ga0466971_0132619 3300044719 Bacteria 1157
539 Ga0466957_0014646 3300044842 Bacteria 4569
540 Ga0466957_0167558 3300044842 Bacteria 1429
541 Ga0466957_0282915 3300044842 Bacteria 1110
542 Ga0466960_0273337 3300044901 Bacteria 945
543 Ga0466959_0025239 3300045049 Bacteria 4404
544 Ga0466959_0637825 3300045049 Bacteria 715
545 Ga0466958_0136692 3300045836 Bacteria 1542
546 Ga0466967_0061021 3300045976 Bacteria 3344
547 Ga0466967_0127345 3300045976 Bacteria 2360
548 Ga0466967_0179685 3300045976 Bacteria 1995
549 Ga0466967_0207178 3300045976 Bacteria 1859
550 Ga0466967_0362097 3300045976 Bacteria 1405
551 Ga0466967_1234453 3300045976 Bacteria 745
552 Ga0466967_1339646 3300045976 Bacteria 713
553 Ga0495617_274544 3300046452 Bacteria 517
554 Ga0495585_0162772 3300046492 Bacteria 1157
555 Ga0495663_0002089 3300046525 Bacteria 6111
556 Ga0495642_0146081 3300046528 Bacteria 1022
557 Ga0495598_0002444 3300046537 Bacteria 3841
558 Ga0495621_0000267 3300046539 Bacteria 12474
559 Ga0495621_0114068 3300046539 Bacteria 1039
560 Ga0495621_0218827 3300046539 Bacteria 770
561 Ga0495633_0033176 3300046558 Bacteria 2490
562 Ga0495656_0498575 3300046615 Bacteria 646
563 Ga0495669_0001549 3300046684 Bacteria 9448
564 Ga0495669_0003119 3300046684 Bacteria 6819
565 Ga0495669_0106765 3300046684 Bacteria 1305
566 Ga0495669_0178732 3300046684 Bacteria 1011
567 Ga0495669_0317816 3300046684 Bacteria 751
568 Ga0495683_0399899 3300047323 Bacteria 571
569 Ga0495677_0006908 3300047445 Bacteria 4266
570 Ga0495677_0066373 3300047445 Bacteria 1342
571 Ga0496100_0034924 3300048903 Bacteria 3159
572 Ga0496101_0028388 3300048904 Bacteria 3905
573 Ga0496101_0037026 3300048904 Bacteria 3459
574 Ga0496102_0020190 3300048905 Bacteria 5884
575 Ga0496102_0321543 3300048905 Bacteria 1458
576 Ga0496102_0932291 3300048905 Bacteria 790
577 Ga0496104_0016210 3300048907 Bacteria 6766
578 Ga0496105_0036620 3300048908 Bacteria 4043
579 Ga0496106_0164526 3300048909 Bacteria 1755
580 Ga0496106_0289972 3300048909 Bacteria 1312
581 Ga0496107_0081220 3300048910 Bacteria 2364
582 Ga0496107_0108037 3300048910 Bacteria 2043
583 Ga0496108_0002917 3300048911 Bacteria 13750
584 Ga0496108_0004008 3300048911 Bacteria 11812
585 Ga0496108_0013160 3300048911 Bacteria 6742
586 Ga0496108_0190267 3300048911 Bacteria 1778
587 Ga0496109_0012164 3300048912 Bacteria 7422
588 Ga0496109_0015582 3300048912 Bacteria 6629
589 Ga0496109_0033815 3300048912 Bacteria 4601
590 Ga0496109_0380171 3300048912 Bacteria 1334
591 Ga0496110_0000713 3300048913 Bacteria 22938
592 Ga0496110_0003336 3300048913 Bacteria 12270
593 Ga0496110_0031828 3300048913 Bacteria 4553
594 Ga0496111_0009133 3300048914 Bacteria 6598
595 Ga0496111_0015908 3300048914 Bacteria 5174
596 Ga0496111_0087854 3300048914 Bacteria 2276
597 Ga0496111_0135593 3300048914 Bacteria 1823
598 Ga0496112_0014176 3300048915 Bacteria 7386
599 Ga0496112_0025516 3300048915 Bacteria 5675
600 Ga0496112_0037146 3300048915 Bacteria 4754
601 Ga0496112_0044022 3300048915 Bacteria 4371
602 Ga0496112_0215334 3300048915 Bacteria 1877
603 Ga0496113_0000844 3300048916 Bacteria 16051
604 Ga0496113_0008357 3300048916 Bacteria 6742
605 Ga0496113_0414776 3300048916 Bacteria 1081
606 Ga0496114_0394393 3300048917 Bacteria 1226
607 Ga0496114_0907594 3300048917 Bacteria 762
608 Ga0501299_090404 3300049522 Bacteria 695
609 Ga0501067_0484347 3300049583 Bacteria 692
610 Ga0501069_0237464 3300049585 Bacteria 1062
611 Ga0501217_095096 3300049661 Bacteria 841
612 Ga0501233_192252 3300049668 Bacteria 590
613 Ga0501249_113593 3300049679 Bacteria 656
614 Ga0501225_0077398 3300049705 Bacteria 952
615 Ga0501268_049976 3300049765 Bacteria 807
616 nmdc:mga06r32_250612_c1 3300050510 Bacteria 1758
617 nmdc:mga08x19_425055_c1 3300050514 Bacteria 933
618 nmdc:mga0a205_6815_c1 3300050515 Bacteria 10335
619 Ga0466962_0005552 3300061719 Bacteria 6053
620 Ga0466962_0078942 3300061719 Bacteria 1573
621 Ga0466962_0165950 3300061719 Bacteria 1074

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050514 nmdc:mga08x19_425055_c1 nmdc:mga08x19_425055_c1_513_923 129
2 3300037418 Ga0395900_0997746 Ga0395900_0997746_332_742 135
3 3300048915 Ga0496112_0025516 Ga0496112_0025516_2736_3209 145
4 3300025919 Ga0207657_10727047 Ga0207657_107270472 147
5 3300037418 Ga0395900_0312196 Ga0395900_0312196_331_801 148
6 3300001990 JGI24737J22298_10006347 JGI24737J22298_100063475 149
7 3300002067 JGI24735J21928_10105853 JGI24735J21928_101058531 149
8 3300005293 Ga0065715_10036426 Ga0065715_100364261 149
9 3300005339 Ga0070660_100005925 Ga0070660_1000059256 149
10 3300005340 Ga0070689_100276132 Ga0070689_1002761322 149
11 3300005345 Ga0070692_10130468 Ga0070692_101304682 149
12 3300005347 Ga0070668_101086876 Ga0070668_1010868761 149
13 3300005353 Ga0070669_100043759 Ga0070669_1000437592 149
14 3300005366 Ga0070659_100359143 Ga0070659_1003591433 149
15 3300005444 Ga0070694_100050138 Ga0070694_1000501382 149
16 3300005457 Ga0070662_100015643 Ga0070662_1000156432 149
17 3300005457 Ga0070662_100371416 Ga0070662_1003714161 149
18 3300005530 Ga0070679_100714389 Ga0070679_1007143892 149
19 3300005539 Ga0068853_100084977 Ga0068853_1000849772 149
20 3300005543 Ga0070672_100285504 Ga0070672_1002855042 149
21 3300005543 Ga0070672_100355481 Ga0070672_1003554812 149
22 3300005545 Ga0070695_101143359 Ga0070695_1011433591 149
23 3300005563 Ga0068855_101483552 Ga0068855_1014835522 149
24 3300005577 Ga0068857_100421557 Ga0068857_1004215573 149
25 3300005616 Ga0068852_101072000 Ga0068852_1010720001 149
26 3300005841 Ga0068863_101059780 Ga0068863_1010597801 149
27 3300005842 Ga0068858_100008371 Ga0068858_10000837110 149
28 3300005843 Ga0068860_100004735 Ga0068860_10000473515 149
29 3300005843 Ga0068860_100041104 Ga0068860_1000411046 149
30 3300006847 Ga0075431_100287860 Ga0075431_1002878602 149
31 3300006852 Ga0075433_10011356 Ga0075433_100113562 149
32 3300009098 Ga0105245_10156131 Ga0105245_101561313 149
33 3300009553 Ga0105249_10018924 Ga0105249_100189243 149
34 3300010375 Ga0105239_11725453 Ga0105239_117254532 149
35 3300013308 Ga0157375_10184646 Ga0157375_101846462 149
36 3300014745 Ga0157377_10155783 Ga0157377_101557832 149
37 3300025904 Ga0207647_10006533 Ga0207647_100065333 149
38 3300025919 Ga0207657_10005157 Ga0207657_1000515712 149
39 3300025923 Ga0207681_10122773 Ga0207681_101227732 149
40 3300025927 Ga0207687_10165684 Ga0207687_101656842 149
41 3300025932 Ga0207690_10040317 Ga0207690_100403172 149
42 3300025933 Ga0207706_10008086 Ga0207706_100080862 149
43 3300025933 Ga0207706_10231777 Ga0207706_102317772 149
44 3300025935 Ga0207709_10117503 Ga0207709_101175032 149
45 3300025936 Ga0207670_10339724 Ga0207670_103397243 149
46 3300025940 Ga0207691_10015125 Ga0207691_100151259 149
47 3300025940 Ga0207691_10235640 Ga0207691_102356402 149
48 3300025949 Ga0207667_10021080 Ga0207667_100210801 149
49 3300025961 Ga0207712_10001308 Ga0207712_100013085 149
50 3300025972 Ga0207668_10564496 Ga0207668_105644962 149
51 3300026035 Ga0207703_10005559 Ga0207703_100055594 149
52 3300026035 Ga0207703_10432815 Ga0207703_104328153 149
53 3300026041 Ga0207639_10157400 Ga0207639_101574003 149
54 3300026116 Ga0207674_10044158 Ga0207674_100441586 149
55 3300026116 Ga0207674_10058956 Ga0207674_100589562 149
56 3300026142 Ga0207698_10423547 Ga0207698_104235473 149
57 3300028381 Ga0268264_10000750 Ga0268264_1000075036 149
58 3300028381 Ga0268264_10248826 Ga0268264_102488263 149
59 3300050510 nmdc:mga06r32_250612_c1 nmdc:mga06r32_250612_c1_564_1037 149
60 3300050515 nmdc:mga0a205_6815_c1 nmdc:mga0a205_6815_c1_9063_9536 149
61 3300005577 Ga0068857_100034319 Ga0068857_1000343191 150
62 3300005577 Ga0068857_101244150 Ga0068857_1012441501 150
63 3300009148 Ga0105243_10219656 Ga0105243_102196562 150
64 3300009176 Ga0105242_10245568 Ga0105242_102455682 150
65 3300009553 Ga0105249_11019249 Ga0105249_110192492 150
66 3300025934 Ga0207686_10151615 Ga0207686_101516152 150
67 3300025935 Ga0207709_10291946 Ga0207709_102919462 150
68 3300025938 Ga0207704_10141771 Ga0207704_101417713 150
69 3300005455 Ga0070663_100309076 Ga0070663_1003090762 153
70 3300005457 Ga0070662_100665787 Ga0070662_1006657872 153
71 3300005459 Ga0068867_100325487 Ga0068867_1003254872 153
72 3300005539 Ga0068853_100414729 Ga0068853_1004147292 153
73 3300005578 Ga0068854_100162154 Ga0068854_1001621541 153
74 3300005616 Ga0068852_100750374 Ga0068852_1007503741 153
75 3300025933 Ga0207706_10894411 Ga0207706_108944112 153
76 3300025981 Ga0207640_10010718 Ga0207640_100107181 153
77 3300026067 Ga0207678_10287211 Ga0207678_102872112 153
78 3300026089 Ga0207648_10132670 Ga0207648_101326702 153
79 3300005353 Ga0070669_100322518 Ga0070669_1003225182 154
80 3300005364 Ga0070673_100021593 Ga0070673_1000215933 154
81 3300005367 Ga0070667_100000368 Ga0070667_10000036817 154
82 3300005455 Ga0070663_100631777 Ga0070663_1006317771 154
83 3300005617 Ga0068859_100000221 Ga0068859_10000022156 154
84 3300005617 Ga0068859_100100324 Ga0068859_1001003245 154
85 3300005618 Ga0068864_100000721 Ga0068864_1000007218 154
86 3300005841 Ga0068863_100010798 Ga0068863_1000107985 154
87 3300005841 Ga0068863_100235114 Ga0068863_1002351142 154
88 3300005842 Ga0068858_100000919 Ga0068858_10000091912 154
89 3300005843 Ga0068860_100007585 Ga0068860_1000075852 154
90 3300005843 Ga0068860_100348048 Ga0068860_1003480484 154
91 3300005844 Ga0068862_100040267 Ga0068862_1000402672 154
92 3300006931 Ga0097620_100000221 Ga0097620_10000022156 154
93 3300006931 Ga0097620_100100324 Ga0097620_1001003242 154
94 3300009101 Ga0105247_10319650 Ga0105247_103196501 154
95 3300009177 Ga0105248_10106400 Ga0105248_101064005 154
96 3300025900 Ga0207710_10093261 Ga0207710_100932612 154
97 3300025923 Ga0207681_10030398 Ga0207681_100303984 154
98 3300025941 Ga0207711_10000042 Ga0207711_10000042144 154
99 3300025941 Ga0207711_10062000 Ga0207711_100620002 154
100 3300025960 Ga0207651_10034714 Ga0207651_100347144 154
101 3300025961 Ga0207712_10006872 Ga0207712_100068722 154
102 3300025986 Ga0207658_10001750 Ga0207658_100017504 154
103 3300026035 Ga0207703_10002526 Ga0207703_100025262 154
104 3300026067 Ga0207678_10677550 Ga0207678_106775502 154
105 3300026088 Ga0207641_10000415 Ga0207641_1000041536 154
106 3300026088 Ga0207641_10209735 Ga0207641_102097354 154
107 3300026095 Ga0207676_10000456 Ga0207676_1000045613 154
108 3300028380 Ga0268265_10045818 Ga0268265_100458183 154
109 3300028381 Ga0268264_10000710 Ga0268264_1000071029 154
110 3300028381 Ga0268264_10142950 Ga0268264_101429502 154
111 3300037312 Ga0395899_0653982 Ga0395899_0653982_48_515 154
112 3300037418 Ga0395900_0035040 Ga0395900_0035040_1044_1511 154
113 3300038443 Ga0395901_0158839 Ga0395901_0158839_1262_1729 154
114 3300039437 Ga0436365_0277830 Ga0436365_0277830_617_1087 154
115 3300048911 Ga0496108_0002917 Ga0496108_0002917_13196_13669 154
116 3300005293 Ga0065715_10578853 Ga0065715_105788532 155
117 3300005327 Ga0070658_10138385 Ga0070658_101383852 155
118 3300005327 Ga0070658_10254878 Ga0070658_102548781 155
119 3300005329 Ga0070683_100171960 Ga0070683_1001719603 155
120 3300005331 Ga0070670_100006931 Ga0070670_1000069315 155
121 3300005333 Ga0070677_10031744 Ga0070677_100317441 155
122 3300005333 Ga0070677_10061302 Ga0070677_100613021 155
123 3300005334 Ga0068869_100451986 Ga0068869_1004519862 155
124 3300005335 Ga0070666_10000555 Ga0070666_100005555 155
125 3300005336 Ga0070680_100578402 Ga0070680_1005784022 155
126 3300005339 Ga0070660_100062127 Ga0070660_1000621275 155
127 3300005344 Ga0070661_100057827 Ga0070661_1000578272 155
128 3300005344 Ga0070661_100659957 Ga0070661_1006599572 155
129 3300005354 Ga0070675_100000406 Ga0070675_1000004064 155
130 3300005355 Ga0070671_100000906 Ga0070671_10000090622 155
131 3300005355 Ga0070671_100020477 Ga0070671_1000204773 155
132 3300005364 Ga0070673_100008746 Ga0070673_1000087462 155
133 3300005364 Ga0070673_100031392 Ga0070673_1000313924 155
134 3300005366 Ga0070659_100034545 Ga0070659_1000345453 155
135 3300005366 Ga0070659_100077044 Ga0070659_1000770444 155
136 3300005367 Ga0070667_100001014 Ga0070667_1000010145 155
137 3300005367 Ga0070667_100046252 Ga0070667_1000462524 155
138 3300005435 Ga0070714_100040304 Ga0070714_1000403044 155
139 3300005436 Ga0070713_100008902 Ga0070713_1000089025 155
140 3300005455 Ga0070663_100129435 Ga0070663_1001294353 155
141 3300005456 Ga0070678_100124780 Ga0070678_1001247802 155
142 3300005456 Ga0070678_100180842 Ga0070678_1001808422 155
143 3300005457 Ga0070662_100000826 Ga0070662_10000082617 155
144 3300005457 Ga0070662_100041680 Ga0070662_1000416802 155
145 3300005535 Ga0070684_101374650 Ga0070684_1013746501 155
146 3300005543 Ga0070672_100057547 Ga0070672_1000575473 155
147 3300005543 Ga0070672_100069704 Ga0070672_1000697043 155
148 3300005548 Ga0070665_100000511 Ga0070665_10000051138 155
149 3300005548 Ga0070665_100153075 Ga0070665_1001530754 155
150 3300005563 Ga0068855_100251824 Ga0068855_1002518242 155
151 3300005564 Ga0070664_100001180 Ga0070664_10000118014 155
152 3300005564 Ga0070664_100002666 Ga0070664_10000266615 155
153 3300005564 Ga0070664_100143066 Ga0070664_1001430663 155
154 3300005577 Ga0068857_100083334 Ga0068857_1000833345 155
155 3300005578 Ga0068854_100255352 Ga0068854_1002553522 155
156 3300005618 Ga0068864_100052021 Ga0068864_1000520215 155
157 3300005718 Ga0068866_10050692 Ga0068866_100506922 155
158 3300005719 Ga0068861_101378960 Ga0068861_1013789601 155
159 3300005834 Ga0068851_10181507 Ga0068851_101815073 155
160 3300005841 Ga0068863_100063563 Ga0068863_1000635633 155
161 3300005844 Ga0068862_100023550 Ga0068862_1000235505 155
162 3300006028 Ga0070717_10035121 Ga0070717_100351215 155
163 3300006237 Ga0097621_100776106 Ga0097621_1007761062 155
164 3300009177 Ga0105248_10001111 Ga0105248_1000111131 155
165 3300009177 Ga0105248_10214055 Ga0105248_102140552 155
166 3300013308 Ga0157375_10042947 Ga0157375_100429471 155
167 3300017792 Ga0163161_10258303 Ga0163161_102583032 155
168 3300017792 Ga0163161_10635517 Ga0163161_106355172 155
169 3300025315 Ga0207697_10388847 Ga0207697_103888471 155
170 3300025321 Ga0207656_10102432 Ga0207656_101024322 155
171 3300025893 Ga0207682_10235729 Ga0207682_102357292 155
172 3300025899 Ga0207642_10099107 Ga0207642_100991072 155
173 3300025903 Ga0207680_10001520 Ga0207680_100015203 155
174 3300025904 Ga0207647_10014408 Ga0207647_100144083 155
175 3300025909 Ga0207705_10153720 Ga0207705_101537203 155
176 3300025909 Ga0207705_10294132 Ga0207705_102941322 155
177 3300025919 Ga0207657_10026293 Ga0207657_100262935 155
178 3300025920 Ga0207649_10004475 Ga0207649_100044755 155
179 3300025920 Ga0207649_10244484 Ga0207649_102444843 155
180 3300025923 Ga0207681_10030079 Ga0207681_100300792 155
181 3300025925 Ga0207650_10008430 Ga0207650_100084305 155
182 3300025925 Ga0207650_10232118 Ga0207650_102321182 155
183 3300025926 Ga0207659_10002500 Ga0207659_100025009 155
184 3300025928 Ga0207700_10161306 Ga0207700_101613063 155
185 3300025929 Ga0207664_10016602 Ga0207664_100166022 155
186 3300025931 Ga0207644_10085493 Ga0207644_100854933 155
187 3300025931 Ga0207644_10212461 Ga0207644_102124612 155
188 3300025932 Ga0207690_10022837 Ga0207690_100228372 155
189 3300025933 Ga0207706_10000479 Ga0207706_1000047919 155
190 3300025933 Ga0207706_10001812 Ga0207706_100018123 155
191 3300025937 Ga0207669_10017274 Ga0207669_100172743 155
192 3300025938 Ga0207704_10168646 Ga0207704_101686462 155
193 3300025939 Ga0207665_10126971 Ga0207665_101269712 155
194 3300025940 Ga0207691_10057904 Ga0207691_100579042 155
195 3300025940 Ga0207691_10070581 Ga0207691_100705812 155
196 3300025941 Ga0207711_10057251 Ga0207711_100572514 155
197 3300025942 Ga0207689_10458846 Ga0207689_104588462 155
198 3300025944 Ga0207661_10136313 Ga0207661_101363133 155
199 3300025945 Ga0207679_10004310 Ga0207679_100043107 155
200 3300025945 Ga0207679_10012568 Ga0207679_100125685 155
201 3300025945 Ga0207679_10558926 Ga0207679_105589262 155
202 3300025949 Ga0207667_11973220 Ga0207667_119732201 155
203 3300025960 Ga0207651_10026383 Ga0207651_100263832 155
204 3300025986 Ga0207658_10007960 Ga0207658_100079603 155
205 3300025986 Ga0207658_10206595 Ga0207658_102065952 155
206 3300026067 Ga0207678_10011742 Ga0207678_100117423 155
207 3300026088 Ga0207641_10045031 Ga0207641_100450313 155
208 3300026088 Ga0207641_10404758 Ga0207641_104047581 155
209 3300026095 Ga0207676_10038503 Ga0207676_100385033 155
210 3300026095 Ga0207676_10048861 Ga0207676_100488613 155
211 3300026116 Ga0207674_10034993 Ga0207674_100349933 155
212 3300026121 Ga0207683_10073255 Ga0207683_100732553 155
213 3300026121 Ga0207683_10288106 Ga0207683_102881061 155
214 3300026142 Ga0207698_10150225 Ga0207698_101502253 155
215 3300028379 Ga0268266_10002822 Ga0268266_100028229 155
216 3300028379 Ga0268266_10019148 Ga0268266_100191485 155
217 3300028380 Ga0268265_10025502 Ga0268265_100255025 155
218 3300031548 Ga0307408_100292763 Ga0307408_1002927632 155
219 3300031731 Ga0307405_10011231 Ga0307405_100112315 155
220 3300031731 Ga0307405_10314613 Ga0307405_103146132 155
221 3300031824 Ga0307413_10049136 Ga0307413_100491363 155
222 3300031824 Ga0307413_10239543 Ga0307413_102395431 155
223 3300031824 Ga0307413_11046525 Ga0307413_110465251 155
224 3300031852 Ga0307410_10009323 Ga0307410_100093235 155
225 3300031852 Ga0307410_10038637 Ga0307410_100386375 155
226 3300031901 Ga0307406_10239820 Ga0307406_102398202 155
227 3300031903 Ga0307407_10017326 Ga0307407_100173263 155
228 3300031903 Ga0307407_10272250 Ga0307407_102722503 155
229 3300031903 Ga0307407_10854635 Ga0307407_108546351 155
230 3300031995 Ga0307409_100027003 Ga0307409_1000270035 155
231 3300031995 Ga0307409_100047357 Ga0307409_1000473575 155
232 3300031995 Ga0307409_100654363 Ga0307409_1006543633 155
233 3300032002 Ga0307416_100014635 Ga0307416_1000146357 155
234 3300032002 Ga0307416_100799892 Ga0307416_1007998921 155
235 3300032004 Ga0307414_10003073 Ga0307414_100030739 155
236 3300032004 Ga0307414_10154709 Ga0307414_101547094 155
237 3300032005 Ga0307411_10001507 Ga0307411_100015074 155
238 3300032005 Ga0307411_10104879 Ga0307411_101048793 155
239 3300032126 Ga0307415_100014964 Ga0307415_1000149643 155
240 3300032126 Ga0307415_100591470 Ga0307415_1005914702 155
241 3300035085 Ga0373929_0023594 Ga0373929_0023594_124_597 155
242 3300035091 Ga0373951_0075368 Ga0373951_0075368_215_688 155
243 3300037312 Ga0395899_0179827 Ga0395899_0179827_142_609 155
244 3300037418 Ga0395900_0113474 Ga0395900_0113474_717_1187 155
245 3300037418 Ga0395900_0392518 Ga0395900_0392518_745_1212 155
246 3300037418 Ga0395900_0793106 Ga0395900_0793106_276_743 155
247 3300037418 Ga0395900_0796015 Ga0395900_0796015_142_609 155
248 3300037466 Ga0395898_0222430 Ga0395898_0222430_1159_1626 155
249 3300037466 Ga0395898_0498248 Ga0395898_0498248_127_594 155
250 3300037471 Ga0395905_0026597 Ga0395905_0026597_3467_3937 155
251 3300037471 Ga0395905_0041077 Ga0395905_0041077_520_990 155
252 3300037471 Ga0395905_0356176 Ga0395905_0356176_229_702 155
253 3300037471 Ga0395905_0757347 Ga0395905_0757347_142_609 155
254 3300037471 Ga0395905_0757369 Ga0395905_0757369_142_609 155
255 3300037471 Ga0395905_1857979 Ga0395905_1857979_11_484 155
256 3300038443 Ga0395901_0064902 Ga0395901_0064902_1940_2410 155
257 3300038443 Ga0395901_0547151 Ga0395901_0547151_142_609 155
258 3300038443 Ga0395901_0762026 Ga0395901_0762026_313_786 155
259 3300038443 Ga0395901_1023344 Ga0395901_1023344_192_659 155
260 3300044842 Ga0466957_0167558 Ga0466957_0167558_820_1296 155
261 3300045836 Ga0466958_0136692 Ga0466958_0136692_669_1145 155
262 3300045976 Ga0466967_0179685 Ga0466967_0179685_784_1251 155
263 3300045976 Ga0466967_1234453 Ga0466967_1234453_170_646 155
264 3300046528 Ga0495642_0146081 Ga0495642_0146081_195_662 155
265 3300046539 Ga0495621_0114068 Ga0495621_0114068_532_1008 155
266 3300046539 Ga0495621_0218827 Ga0495621_0218827_83_550 155
267 3300046684 Ga0495669_0001549 Ga0495669_0001549_1505_2059 155
268 3300047445 Ga0495677_0066373 Ga0495677_0066373_561_1115 155
269 3300048911 Ga0496108_0190267 Ga0496108_0190267_582_1136 155
270 3300048912 Ga0496109_0380171 Ga0496109_0380171_408_962 155
271 3300048913 Ga0496110_0000713 Ga0496110_0000713_130_684 155
272 3300048914 Ga0496111_0087854 Ga0496111_0087854_1287_1841 155
273 3300048917 Ga0496114_0394393 Ga0496114_0394393_658_1212 155
274 3300049679 Ga0501249_113593 Ga0501249_113593_145_615 155
275 3300049765 Ga0501268_049976 Ga0501268_049976_292_762 155
276 3300061719 Ga0466962_0165950 Ga0466962_0165950_530_1006 155
277 3300001989 JGI24739J22299_10033536 JGI24739J22299_100335362 156
278 3300002077 JGI24744J21845_10002777 JGI24744J21845_100027774 156
279 3300002239 JGI24034J26672_10034511 JGI24034J26672_100345112 156
280 3300005327 Ga0070658_10017100 Ga0070658_100171006 156
281 3300005330 Ga0070690_100006117 Ga0070690_1000061175 156
282 3300005330 Ga0070690_100007444 Ga0070690_1000074442 156
283 3300005331 Ga0070670_100062929 Ga0070670_1000629292 156
284 3300005335 Ga0070666_10000788 Ga0070666_100007887 156
285 3300005335 Ga0070666_10005791 Ga0070666_100057917 156
286 3300005335 Ga0070666_10044201 Ga0070666_100442012 156
287 3300005335 Ga0070666_10203544 Ga0070666_102035442 156
288 3300005338 Ga0068868_100000211 Ga0068868_10000021128 156
289 3300005338 Ga0068868_100174617 Ga0068868_1001746172 156
290 3300005339 Ga0070660_100015688 Ga0070660_1000156886 156
291 3300005339 Ga0070660_100420387 Ga0070660_1004203872 156
292 3300005344 Ga0070661_100008952 Ga0070661_1000089526 156
293 3300005344 Ga0070661_100298901 Ga0070661_1002989012 156
294 3300005344 Ga0070661_101147391 Ga0070661_1011473911 156
295 3300005344 Ga0070661_101327881 Ga0070661_1013278811 156
296 3300005353 Ga0070669_101597975 Ga0070669_1015979751 156
297 3300005355 Ga0070671_100002991 Ga0070671_1000029918 156
298 3300005355 Ga0070671_100016359 Ga0070671_1000163596 156
299 3300005355 Ga0070671_100225821 Ga0070671_1002258212 156
300 3300005355 Ga0070671_101162100 Ga0070671_1011621001 156
301 3300005356 Ga0070674_100002387 Ga0070674_10000238714 156
302 3300005364 Ga0070673_100003428 Ga0070673_1000034287 156
303 3300005364 Ga0070673_100648210 Ga0070673_1006482102 156
304 3300005366 Ga0070659_100148860 Ga0070659_1001488602 156
305 3300005366 Ga0070659_100169778 Ga0070659_1001697781 156
306 3300005367 Ga0070667_100003689 Ga0070667_1000036895 156
307 3300005367 Ga0070667_100007895 Ga0070667_1000078953 156
308 3300005367 Ga0070667_100551016 Ga0070667_1005510162 156
309 3300005435 Ga0070714_100023000 Ga0070714_1000230004 156
310 3300005436 Ga0070713_100403213 Ga0070713_1004032131 156
311 3300005455 Ga0070663_100116197 Ga0070663_1001161972 156
312 3300005456 Ga0070678_100186883 Ga0070678_1001868834 156
313 3300005457 Ga0070662_100037214 Ga0070662_1000372142 156
314 3300005457 Ga0070662_100389310 Ga0070662_1003893102 156
315 3300005459 Ga0068867_100002635 Ga0068867_1000026355 156
316 3300005466 Ga0070685_10440693 Ga0070685_104406932 156
317 3300005543 Ga0070672_100012235 Ga0070672_1000122352 156
318 3300005543 Ga0070672_100036320 Ga0070672_1000363205 156
319 3300005544 Ga0070686_100264114 Ga0070686_1002641143 156
320 3300005563 Ga0068855_100505938 Ga0068855_1005059382 156
321 3300005564 Ga0070664_100007769 Ga0070664_1000077695 156
322 3300005564 Ga0070664_100139965 Ga0070664_1001399652 156
323 3300005578 Ga0068854_100089841 Ga0068854_1000898414 156
324 3300005614 Ga0068856_100056502 Ga0068856_1000565022 156
325 3300005614 Ga0068856_100094984 Ga0068856_1000949842 156
326 3300005614 Ga0068856_100706371 Ga0068856_1007063712 156
327 3300005616 Ga0068852_100010871 Ga0068852_1000108712 156
328 3300005617 Ga0068859_100064332 Ga0068859_1000643322 156
329 3300005618 Ga0068864_100013419 Ga0068864_1000134195 156
330 3300005618 Ga0068864_100039553 Ga0068864_1000395532 156
331 3300005718 Ga0068866_10067856 Ga0068866_100678562 156
332 3300005718 Ga0068866_10196673 Ga0068866_101966732 156
333 3300005718 Ga0068866_10418121 Ga0068866_104181212 156
334 3300005719 Ga0068861_100337986 Ga0068861_1003379863 156
335 3300005834 Ga0068851_10002496 Ga0068851_100024964 156
336 3300005841 Ga0068863_100008573 Ga0068863_1000085739 156
337 3300005842 Ga0068858_100004134 Ga0068858_1000041345 156
338 3300005842 Ga0068858_100055226 Ga0068858_1000552264 156
339 3300005843 Ga0068860_100167921 Ga0068860_1001679215 156
340 3300005843 Ga0068860_100252781 Ga0068860_1002527812 156
341 3300005843 Ga0068860_100303757 Ga0068860_1003037572 156
342 3300006173 Ga0070716_100282663 Ga0070716_1002826632 156
343 3300006237 Ga0097621_100141304 Ga0097621_1001413044 156
344 3300006237 Ga0097621_100547643 Ga0097621_1005476433 156
345 3300006237 Ga0097621_101150706 Ga0097621_1011507062 156
346 3300006358 Ga0068871_100010804 Ga0068871_1000108047 156
347 3300006358 Ga0068871_100074962 Ga0068871_1000749621 156
348 3300006358 Ga0068871_100631970 Ga0068871_1006319701 156
349 3300006358 Ga0068871_101270334 Ga0068871_1012703341 156
350 3300006881 Ga0068865_100004204 Ga0068865_1000042042 156
351 3300006931 Ga0097620_100064331 Ga0097620_1000643315 156
352 3300009011 Ga0105251_10189926 Ga0105251_101899262 156
353 3300009093 Ga0105240_10314455 Ga0105240_103144552 156
354 3300009098 Ga0105245_10018371 Ga0105245_100183717 156
355 3300009098 Ga0105245_10171976 Ga0105245_101719764 156
356 3300009098 Ga0105245_11006832 Ga0105245_110068323 156
357 3300009101 Ga0105247_10057624 Ga0105247_100576242 156
358 3300009101 Ga0105247_10243311 Ga0105247_102433113 156
359 3300009148 Ga0105243_10759310 Ga0105243_107593103 156
360 3300009176 Ga0105242_11012603 Ga0105242_110126032 156
361 3300009177 Ga0105248_10000442 Ga0105248_1000044228 156
362 3300009177 Ga0105248_10000502 Ga0105248_1000050223 156
363 3300009177 Ga0105248_10030286 Ga0105248_100302862 156
364 3300009177 Ga0105248_10138802 Ga0105248_101388022 156
365 3300009177 Ga0105248_10606714 Ga0105248_106067142 156
366 3300009551 Ga0105238_10004331 Ga0105238_100043317 156
367 3300009553 Ga0105249_10013266 Ga0105249_100132662 156
368 3300009553 Ga0105249_10109045 Ga0105249_101090455 156
369 3300010375 Ga0105239_10648141 Ga0105239_106481412 156
370 3300011119 Ga0105246_10100888 Ga0105246_101008883 156
371 3300011119 Ga0105246_10361649 Ga0105246_103616492 156
372 3300013104 Ga0157370_10004644 Ga0157370_100046442 156
373 3300013105 Ga0157369_10053404 Ga0157369_100534045 156
374 3300013296 Ga0157374_10295185 Ga0157374_102951853 156
375 3300013296 Ga0157374_10372088 Ga0157374_103720882 156
376 3300013297 Ga0157378_10113488 Ga0157378_101134884 156
377 3300013306 Ga0163162_10068607 Ga0163162_100686072 156
378 3300013306 Ga0163162_10268318 Ga0163162_102683182 156
379 3300013308 Ga0157375_10032612 Ga0157375_100326122 156
380 3300013308 Ga0157375_10073886 Ga0157375_100738863 156
381 3300013308 Ga0157375_10527432 Ga0157375_105274322 156
382 3300013308 Ga0157375_10718682 Ga0157375_107186822 156
383 3300014325 Ga0163163_10000164 Ga0163163_1000016424 156
384 3300014325 Ga0163163_11840318 Ga0163163_118403182 156
385 3300014745 Ga0157377_10020587 Ga0157377_100205874 156
386 3300014968 Ga0157379_10030141 Ga0157379_100301415 156
387 3300014968 Ga0157379_10082317 Ga0157379_100823174 156
388 3300014968 Ga0157379_10142557 Ga0157379_101425573 156
389 3300014968 Ga0157379_10217605 Ga0157379_102176052 156
390 3300014969 Ga0157376_10036609 Ga0157376_100366092 156
391 3300025315 Ga0207697_10031976 Ga0207697_100319765 156
392 3300025321 Ga0207656_10004393 Ga0207656_100043935 156
393 3300025893 Ga0207682_10320688 Ga0207682_103206882 156
394 3300025893 Ga0207682_10476605 Ga0207682_104766052 156
395 3300025899 Ga0207642_10668231 Ga0207642_106682312 156
396 3300025903 Ga0207680_10021479 Ga0207680_100214792 156
397 3300025903 Ga0207680_10032911 Ga0207680_100329115 156
398 3300025904 Ga0207647_10057408 Ga0207647_100574081 156
399 3300025907 Ga0207645_10079335 Ga0207645_100793352 156
400 3300025909 Ga0207705_10006093 Ga0207705_100060932 156
401 3300025909 Ga0207705_10130912 Ga0207705_101309124 156
402 3300025913 Ga0207695_10868984 Ga0207695_108689842 156
403 3300025918 Ga0207662_10141256 Ga0207662_101412563 156
404 3300025918 Ga0207662_10188241 Ga0207662_101882412 156
405 3300025919 Ga0207657_10025850 Ga0207657_100258506 156
406 3300025919 Ga0207657_10052286 Ga0207657_100522864 156
407 3300025919 Ga0207657_10069737 Ga0207657_100697373 156
408 3300025919 Ga0207657_10840901 Ga0207657_108409011 156
409 3300025920 Ga0207649_10032471 Ga0207649_100324712 156
410 3300025920 Ga0207649_10162750 Ga0207649_101627502 156
411 3300025923 Ga0207681_11528258 Ga0207681_115282581 156
412 3300025924 Ga0207694_10007521 Ga0207694_100075215 156
413 3300025925 Ga0207650_10114145 Ga0207650_101141453 156
414 3300025928 Ga0207700_10088331 Ga0207700_100883313 156
415 3300025929 Ga0207664_10205708 Ga0207664_102057082 156
416 3300025931 Ga0207644_10000616 Ga0207644_1000061611 156
417 3300025931 Ga0207644_10089383 Ga0207644_100893832 156
418 3300025931 Ga0207644_10193005 Ga0207644_101930052 156
419 3300025932 Ga0207690_10037622 Ga0207690_100376222 156
420 3300025932 Ga0207690_10056299 Ga0207690_100562995 156
421 3300025932 Ga0207690_10079667 Ga0207690_100796673 156
422 3300025932 Ga0207690_10382434 Ga0207690_103824342 156
423 3300025933 Ga0207706_10009763 Ga0207706_100097635 156
424 3300025933 Ga0207706_10051884 Ga0207706_100518843 156
425 3300025933 Ga0207706_10061818 Ga0207706_100618182 156
426 3300025933 Ga0207706_10161991 Ga0207706_101619911 156
427 3300025933 Ga0207706_10403158 Ga0207706_104031582 156
428 3300025937 Ga0207669_10180851 Ga0207669_101808511 156
429 3300025938 Ga0207704_10004322 Ga0207704_100043227 156
430 3300025938 Ga0207704_10102253 Ga0207704_101022531 156
431 3300025940 Ga0207691_10005014 Ga0207691_100050144 156
432 3300025940 Ga0207691_10044575 Ga0207691_100445752 156
433 3300025941 Ga0207711_10000526 Ga0207711_1000052617 156
434 3300025941 Ga0207711_10010774 Ga0207711_100107742 156
435 3300025941 Ga0207711_10076715 Ga0207711_100767153 156
436 3300025942 Ga0207689_10235776 Ga0207689_102357763 156
437 3300025945 Ga0207679_10006770 Ga0207679_100067704 156
438 3300025945 Ga0207679_10014999 Ga0207679_100149994 156
439 3300025949 Ga0207667_10534416 Ga0207667_105344161 156
440 3300025960 Ga0207651_10002050 Ga0207651_100020505 156
441 3300025960 Ga0207651_10092783 Ga0207651_100927833 156
442 3300025981 Ga0207640_10114059 Ga0207640_101140592 156
443 3300025981 Ga0207640_11131577 Ga0207640_111315771 156
444 3300025986 Ga0207658_10024551 Ga0207658_100245515 156
445 3300025986 Ga0207658_10047697 Ga0207658_100476973 156
446 3300025986 Ga0207658_10053870 Ga0207658_100538703 156
447 3300026023 Ga0207677_10001325 Ga0207677_100013258 156
448 3300026023 Ga0207677_10015460 Ga0207677_100154605 156
449 3300026035 Ga0207703_10000774 Ga0207703_1000077427 156
450 3300026035 Ga0207703_10002018 Ga0207703_1000201814 156
451 3300026041 Ga0207639_10102172 Ga0207639_101021722 156
452 3300026041 Ga0207639_10325779 Ga0207639_103257792 156
453 3300026067 Ga0207678_10079840 Ga0207678_100798402 156
454 3300026067 Ga0207678_10274943 Ga0207678_102749432 156
455 3300026078 Ga0207702_10075862 Ga0207702_100758622 156
456 3300026078 Ga0207702_10113023 Ga0207702_101130234 156
457 3300026078 Ga0207702_10147182 Ga0207702_101471824 156
458 3300026088 Ga0207641_10009684 Ga0207641_100096848 156
459 3300026088 Ga0207641_11038499 Ga0207641_110384992 156
460 3300026089 Ga0207648_10005222 Ga0207648_100052226 156
461 3300026089 Ga0207648_10052091 Ga0207648_100520914 156
462 3300026095 Ga0207676_10015775 Ga0207676_100157756 156
463 3300026095 Ga0207676_10026126 Ga0207676_100261265 156
464 3300026095 Ga0207676_10059651 Ga0207676_100596516 156
465 3300026121 Ga0207683_10002818 Ga0207683_100028185 156
466 3300026121 Ga0207683_10087317 Ga0207683_100873174 156
467 3300026142 Ga0207698_10088692 Ga0207698_100886922 156
468 3300026142 Ga0207698_10104679 Ga0207698_101046794 156
469 3300028379 Ga0268266_10184745 Ga0268266_101847454 156
470 3300028381 Ga0268264_10117548 Ga0268264_101175482 156
471 3300028381 Ga0268264_10130689 Ga0268264_101306892 156
472 3300028381 Ga0268264_10160411 Ga0268264_101604115 156
473 3300028381 Ga0268264_10256809 Ga0268264_102568092 156
474 3300028381 Ga0268264_11915197 Ga0268264_119151971 156
475 3300031548 Ga0307408_100673122 Ga0307408_1006731222 156
476 3300031548 Ga0307408_100685451 Ga0307408_1006854512 156
477 3300031731 Ga0307405_10031034 Ga0307405_100310342 156
478 3300031824 Ga0307413_10063116 Ga0307413_100631163 156
479 3300031824 Ga0307413_10079475 Ga0307413_100794753 156
480 3300031824 Ga0307413_10364375 Ga0307413_103643753 156
481 3300031852 Ga0307410_10061165 Ga0307410_100611653 156
482 3300031852 Ga0307410_10168031 Ga0307410_101680312 156
483 3300031852 Ga0307410_10310543 Ga0307410_103105433 156
484 3300031901 Ga0307406_10084904 Ga0307406_100849043 156
485 3300031903 Ga0307407_10063338 Ga0307407_100633383 156
486 3300031903 Ga0307407_10170891 Ga0307407_101708912 156
487 3300031911 Ga0307412_10410255 Ga0307412_104102553 156
488 3300031995 Ga0307409_100007554 Ga0307409_1000075542 156
489 3300031995 Ga0307409_100097134 Ga0307409_1000971344 156
490 3300031995 Ga0307409_100126283 Ga0307409_1001262833 156
491 3300031995 Ga0307409_101313762 Ga0307409_1013137621 156
492 3300031995 Ga0307409_101620888 Ga0307409_1016208881 156
493 3300032002 Ga0307416_100341033 Ga0307416_1003410333 156
494 3300032002 Ga0307416_101402646 Ga0307416_1014026462 156
495 3300032004 Ga0307414_10064401 Ga0307414_100644012 156
496 3300032004 Ga0307414_10436290 Ga0307414_104362902 156
497 3300032004 Ga0307414_10515867 Ga0307414_105158672 156
498 3300032005 Ga0307411_10016978 Ga0307411_100169785 156
499 3300032005 Ga0307411_10150549 Ga0307411_101505493 156
500 3300032005 Ga0307411_10259408 Ga0307411_102594082 156
501 3300032005 Ga0307411_10660689 Ga0307411_106606891 156
502 3300032126 Ga0307415_100403788 Ga0307415_1004037883 156
503 3300032126 Ga0307415_100513342 Ga0307415_1005133421 156
504 3300032126 Ga0307415_100915693 Ga0307415_1009156932 156
505 3300035112 Ga0373932_0031024 Ga0373932_0031024_163_633 156
506 3300035207 Ga0373942_0047216 Ga0373942_0047216_308_778 156
507 3300035692 Ga0373935_0052714 Ga0373935_0052714_1456_1935 156
508 3300037312 Ga0395899_0019397 Ga0395899_0019397_2581_3075 156
509 3300037312 Ga0395899_0029173 Ga0395899_0029173_3643_4113 156
510 3300037312 Ga0395899_0041369 Ga0395899_0041369_1828_2301 156
511 3300037312 Ga0395899_0056551 Ga0395899_0056551_378_851 156
512 3300037312 Ga0395899_0138586 Ga0395899_0138586_350_844 156
513 3300037312 Ga0395899_0459874 Ga0395899_0459874_270_743 156
514 3300037312 Ga0395899_0786936 Ga0395899_0786936_100_570 156
515 3300037418 Ga0395900_0041989 Ga0395900_0041989_831_1301 156
516 3300037418 Ga0395900_0057318 Ga0395900_0057318_1414_1908 156
517 3300037418 Ga0395900_0082995 Ga0395900_0082995_1758_2255 156
518 3300037418 Ga0395900_0167469 Ga0395900_0167469_1297_1767 156
519 3300037418 Ga0395900_0176242 Ga0395900_0176242_559_1032 156
520 3300037418 Ga0395900_0219304 Ga0395900_0219304_370_846 156
521 3300037418 Ga0395900_0337519 Ga0395900_0337519_918_1391 156
522 3300037418 Ga0395900_0429053 Ga0395900_0429053_149_646 156
523 3300037418 Ga0395900_1231314 Ga0395900_1231314_171_644 156
524 3300037466 Ga0395898_0021736 Ga0395898_0021736_3919_4389 156
525 3300037466 Ga0395898_0050528 Ga0395898_0050528_2103_2597 156
526 3300037466 Ga0395898_0088271 Ga0395898_0088271_917_1414 156
527 3300037466 Ga0395898_0157197 Ga0395898_0157197_1143_1616 156
528 3300037466 Ga0395898_0560965 Ga0395898_0560965_477_947 156
529 3300037471 Ga0395905_0002298 Ga0395905_0002298_7687_8157 156
530 3300037471 Ga0395905_0008567 Ga0395905_0008567_1217_1693 156
531 3300037471 Ga0395905_0028256 Ga0395905_0028256_3428_3898 156
532 3300037471 Ga0395905_0067620 Ga0395905_0067620_1278_1775 156
533 3300037471 Ga0395905_0091823 Ga0395905_0091823_1143_1616 156
534 3300037471 Ga0395905_0111465 Ga0395905_0111465_824_1318 156
535 3300037471 Ga0395905_0131286 Ga0395905_0131286_918_1391 156
536 3300037471 Ga0395905_0163075 Ga0395905_0163075_1395_1865 156
537 3300037471 Ga0395905_0206167 Ga0395905_0206167_738_1211 156
538 3300037471 Ga0395905_0633681 Ga0395905_0633681_402_875 156
539 3300037471 Ga0395905_0836823 Ga0395905_0836823_177_650 156
540 3300037853 Ga0436364_0131383 Ga0436364_0131383_135_605 156
541 3300038443 Ga0395901_0029596 Ga0395901_0029596_1630_2127 156
542 3300038443 Ga0395901_0056909 Ga0395901_0056909_1471_1965 156
543 3300038443 Ga0395901_0087060 Ga0395901_0087060_446_919 156
544 3300038443 Ga0395901_0146597 Ga0395901_0146597_1143_1616 156
545 3300038443 Ga0395901_0169030 Ga0395901_0169030_1728_2198 156
546 3300038443 Ga0395901_0203025 Ga0395901_0203025_1563_2036 156
547 3300038443 Ga0395901_0241700 Ga0395901_0241700_595_1071 156
548 3300038443 Ga0395901_0394142 Ga0395901_0394142_469_939 156
549 3300042118 Ga0450914_029667 Ga0450914_029667_48_521 156
550 3300044658 Ga0466972_0049943 Ga0466972_0049943_711_1184 156
551 3300044658 Ga0466972_0287617 Ga0466972_0287617_190_669 156
552 3300044683 Ga0466965_0130090 Ga0466965_0130090_621_1091 156
553 3300044684 Ga0466966_0121825 Ga0466966_0121825_957_1451 156
554 3300044684 Ga0466966_0406542 Ga0466966_0406542_62_535 156
555 3300044693 Ga0466961_0115788 Ga0466961_0115788_649_1122 156
556 3300044693 Ga0466961_0134437 Ga0466961_0134437_574_1044 156
557 3300044694 Ga0466963_0012668 Ga0466963_0012668_2481_2954 156
558 3300044694 Ga0466963_0045689 Ga0466963_0045689_796_1290 156
559 3300044719 Ga0466971_0017102 Ga0466971_0017102_1017_1490 156
560 3300044719 Ga0466971_0132619 Ga0466971_0132619_55_552 156
561 3300044842 Ga0466957_0014646 Ga0466957_0014646_19_492 156
562 3300044842 Ga0466957_0282915 Ga0466957_0282915_163_636 156
563 3300044901 Ga0466960_0273337 Ga0466960_0273337_428_898 156
564 3300045049 Ga0466959_0025239 Ga0466959_0025239_2270_2767 156
565 3300045049 Ga0466959_0637825 Ga0466959_0637825_28_522 156
566 3300045976 Ga0466967_0061021 Ga0466967_0061021_1997_2470 156
567 3300045976 Ga0466967_0127345 Ga0466967_0127345_1148_1621 156
568 3300045976 Ga0466967_0207178 Ga0466967_0207178_270_740 156
569 3300045976 Ga0466967_0362097 Ga0466967_0362097_617_1087 156
570 3300045976 Ga0466967_1339646 Ga0466967_1339646_175_645 156
571 3300046452 Ga0495617_274544 Ga0495617_274544_26_499 156
572 3300046492 Ga0495585_0162772 Ga0495585_0162772_371_844 156
573 3300046525 Ga0495663_0002089 Ga0495663_0002089_712_1185 156
574 3300046537 Ga0495598_0002444 Ga0495598_0002444_2130_2603 156
575 3300046539 Ga0495621_0000267 Ga0495621_0000267_4521_4994 156
576 3300046558 Ga0495633_0033176 Ga0495633_0033176_613_1086 156
577 3300046615 Ga0495656_0498575 Ga0495656_0498575_65_538 156
578 3300046684 Ga0495669_0003119 Ga0495669_0003119_5011_5484 156
579 3300046684 Ga0495669_0106765 Ga0495669_0106765_67_537 156
580 3300046684 Ga0495669_0178732 Ga0495669_0178732_149_622 156
581 3300046684 Ga0495669_0317816 Ga0495669_0317816_230_703 156
582 3300047323 Ga0495683_0399899 Ga0495683_0399899_72_545 156
583 3300047445 Ga0495677_0006908 Ga0495677_0006908_3340_3813 156
584 3300048903 Ga0496100_0034924 Ga0496100_0034924_2525_2995 156
585 3300048904 Ga0496101_0028388 Ga0496101_0028388_1021_1491 156
586 3300048904 Ga0496101_0037026 Ga0496101_0037026_377_847 156
587 3300048905 Ga0496102_0020190 Ga0496102_0020190_443_913 156
588 3300048905 Ga0496102_0321543 Ga0496102_0321543_272_745 156
589 3300048905 Ga0496102_0932291 Ga0496102_0932291_51_521 156
590 3300048907 Ga0496104_0016210 Ga0496104_0016210_4884_5354 156
591 3300048908 Ga0496105_0036620 Ga0496105_0036620_3448_3918 156
592 3300048909 Ga0496106_0164526 Ga0496106_0164526_26_496 156
593 3300048909 Ga0496106_0289972 Ga0496106_0289972_579_1052 156
594 3300048910 Ga0496107_0081220 Ga0496107_0081220_586_1059 156
595 3300048910 Ga0496107_0108037 Ga0496107_0108037_1094_1567 156
596 3300048911 Ga0496108_0004008 Ga0496108_0004008_3237_3707 156
597 3300048911 Ga0496108_0013160 Ga0496108_0013160_2332_2805 156
598 3300048912 Ga0496109_0012164 Ga0496109_0012164_976_1449 156
599 3300048912 Ga0496109_0015582 Ga0496109_0015582_1244_1714 156
600 3300048912 Ga0496109_0033815 Ga0496109_0033815_1487_1957 156
601 3300048913 Ga0496110_0003336 Ga0496110_0003336_6982_7452 156
602 3300048913 Ga0496110_0031828 Ga0496110_0031828_2079_2552 156
603 3300048914 Ga0496111_0009133 Ga0496111_0009133_5640_6110 156
604 3300048914 Ga0496111_0015908 Ga0496111_0015908_2941_3414 156
605 3300048914 Ga0496111_0135593 Ga0496111_0135593_1155_1625 156
606 3300048915 Ga0496112_0014176 Ga0496112_0014176_5166_5654 156
607 3300048915 Ga0496112_0037146 Ga0496112_0037146_3641_4114 156
608 3300048915 Ga0496112_0044022 Ga0496112_0044022_2415_2885 156
609 3300048915 Ga0496112_0215334 Ga0496112_0215334_723_1193 156
610 3300048916 Ga0496113_0000844 Ga0496113_0000844_12917_13387 156
611 3300048916 Ga0496113_0008357 Ga0496113_0008357_554_1027 156
612 3300048916 Ga0496113_0414776 Ga0496113_0414776_237_707 156
613 3300048917 Ga0496114_0907594 Ga0496114_0907594_96_566 156
614 3300049522 Ga0501299_090404 Ga0501299_090404_170_643 156
615 3300049583 Ga0501067_0484347 Ga0501067_0484347_121_594 156
616 3300049585 Ga0501069_0237464 Ga0501069_0237464_417_890 156
617 3300049661 Ga0501217_095096 Ga0501217_095096_315_800 156
618 3300049668 Ga0501233_192252 Ga0501233_192252_56_529 156
619 3300049705 Ga0501225_0077398 Ga0501225_0077398_208_693 156
620 3300061719 Ga0466962_0005552 Ga0466962_0005552_3946_4419 156
621 3300061719 Ga0466962_0078942 Ga0466962_0078942_196_669 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

33

175

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4s2y-assembly1.cif.gz_A structure of e. coli rpph bound to rna and three magnesium ions 0.9102 1 153
6d1v-assembly1.cif.gz_B crystal structure of e. coli rpph-dapf complex, monomer bound to rna 0.9097 2 153
1jkn-assembly1.cif.gz_A solution structure of the nudix enzyme diadenosine tetraphosphate hydrolase from lupinus angustifolius complexed with atp 0.9031 4 155
5ygu-assembly1.cif.gz_B crystal structure of escherichia coli (strain k12) mrna decapping complex rpph-dapf 0.9007 1 153
7sp3-assembly1.cif.gz_A e. coli rpph bound to ap4a 0.9002 1 153
ID Description Score Start End Superfamily
4s2yA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9102 1 153 3.90.79.10
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9064 1 155 3.90.79.10
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9008 1 155 3.90.79.10
af_Q54FR0_1_169_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8718 3 153 3.90.79.10
af_Q4DDM6_1_156_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8555 7 150 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A7Y9VL69-F1-model_v4 deleted 0.9864 6 154
AF-A0A6J4T925-F1-model_v4 Adenosine (5')-pentaphospho-(5'')-adenosine pyrophosphohydrolase 0.9854 4 155 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A4Q3D9K2-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9828 4 154 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A1G9IA05-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9823 7 154 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A3C0PM87-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9819 3 155 GO:0006753
GO:0008893
GO:0019693
GO:0034432

Feature Viewer

pLDDT pTM Quality
92.21 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map