F469987

General Info

Members Datasets Scaffolds Average Seq Length
621 295 621 124

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100348204|Ga0070679_1003482042
Length 143
Sequence MSELVEKAAAAAANAYAPYSKYNVGAVVRTTDGREFAGVNVENAAYPLGQCAERTAIGAAATAGYRPGDIAAIGINASPCGGCRQWLYEWRIPEVSFRREDGTVATYSAADLLPDTWDLPAGVGSTEPDNGEGAGADGAEAAQ

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
136 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
137 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
141 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
142 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
145 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
186 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
187 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
190 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
191 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
192 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
193 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
194 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
195 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
196 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
197 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
198 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
199 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
213 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
268 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
269 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
275 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
276 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 1.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0
Rhizoplane 10.95
Rhizosphere 87.6
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10003190 3300003373 Bacteria 3900
2 Ga0070658_10244811 3300005327 Bacteria 1520
3 Ga0070658_10258221 3300005327 Bacteria 1479
4 Ga0070683_100004744 3300005329 Bacteria 11248
5 Ga0070683_100093616 3300005329 Bacteria 2823
6 Ga0070683_100328744 3300005329 Bacteria 1455
7 Ga0070683_100746731 3300005329 Bacteria 937
8 Ga0068869_100919399 3300005334 Bacteria 758
9 Ga0070680_100216681 3300005336 Bacteria 1615
10 Ga0070680_100243559 3300005336 Bacteria 1520
11 Ga0070680_100604099 3300005336 Bacteria 942
12 Ga0070680_101846063 3300005336 Bacteria 524
13 Ga0070682_100051110 3300005337 Bacteria 2582
14 Ga0070682_100087692 3300005337 Bacteria 2029
15 Ga0068868_100144035 3300005338 Bacteria 1958
16 Ga0070660_100001227 3300005339 Bacteria 17435
17 Ga0070660_100064925 3300005339 Bacteria 2841
18 Ga0070660_100160434 3300005339 Bacteria 1812
19 Ga0070660_100224027 3300005339 Bacteria 1529
20 Ga0070660_100274547 3300005339 Bacteria 1378
21 Ga0070691_10313981 3300005341 Bacteria 860
22 Ga0070691_10477961 3300005341 Unclassified 716
23 Ga0070687_100531590 3300005343 Bacteria 797
24 Ga0070687_101049616 3300005343 Bacteria 593
25 Ga0070661_100005972 3300005344 Bacteria 8382
26 Ga0070661_100011452 3300005344 Bacteria 6178
27 Ga0070661_100021829 3300005344 Bacteria 4579
28 Ga0070669_101391095 3300005353 Bacteria 609
29 Ga0070675_100778454 3300005354 Bacteria 874
30 Ga0070675_102208542 3300005354 Bacteria 507
31 Ga0070671_100398071 3300005355 Bacteria 1178
32 Ga0070674_100185349 3300005356 Bacteria 1597
33 Ga0070674_100681019 3300005356 Bacteria 877
34 Ga0070659_100015315 3300005366 Bacteria 5742
35 Ga0070659_100605198 3300005366 Bacteria 942
36 Ga0070659_101799714 3300005366 Bacteria 548
37 Ga0070709_10101218 3300005434 Bacteria 1920
38 Ga0070709_10314920 3300005434 Bacteria 1147
39 Ga0070713_101038896 3300005436 Unclassified 791
40 Ga0070713_101135743 3300005436 Bacteria 755
41 Ga0070705_100468713 3300005440 Bacteria 949
42 Ga0070663_100443280 3300005455 Bacteria 1069
43 Ga0070678_100033988 3300005456 Bacteria 3546
44 Ga0070681_10003001 3300005458 Bacteria 15664
45 Ga0070681_10008477 3300005458 Bacteria 10064
46 Ga0070681_10074014 3300005458 Bacteria 3368
47 Ga0070681_10277886 3300005458 Bacteria 1586
48 Ga0070679_100023955 3300005530 Bacteria 5981
49 Ga0070679_100060985 3300005530 Bacteria 3759
50 Ga0070679_100262126 3300005530 Bacteria 1683
51 Ga0070679_100348204 3300005530 Bacteria 1429
52 Ga0070679_100523621 3300005530 Bacteria 1129
53 Ga0070679_100721614 3300005530 Bacteria 939
54 Ga0070684_100000539 3300005535 Bacteria 26027
55 Ga0070684_100050016 3300005535 Bacteria 3629
56 Ga0070684_100094686 3300005535 Bacteria 2660
57 Ga0070684_100178815 3300005535 Bacteria 1928
58 Ga0070684_100578051 3300005535 Bacteria 1044
59 Ga0068853_100071494 3300005539 Bacteria 3021
60 Ga0068853_100471069 3300005539 Bacteria 1183
61 Ga0068853_100898304 3300005539 Bacteria 851
62 Ga0068853_102192928 3300005539 Bacteria 536
63 Ga0070686_101416316 3300005544 Bacteria 584
64 Ga0070695_101754918 3300005545 Bacteria 520
65 Ga0070696_101011454 3300005546 Bacteria 695
66 Ga0070693_100006379 3300005547 Bacteria 5719
67 Ga0070665_100004675 3300005548 Bacteria 14290
68 Ga0070665_100293892 3300005548 Bacteria 1627
69 Ga0070704_100097656 3300005549 Bacteria 2205
70 Ga0070704_100784041 3300005549 Unclassified 851
71 Ga0068855_100005572 3300005563 Bacteria 15363
72 Ga0068855_100008007 3300005563 Bacteria 12765
73 Ga0068855_100228049 3300005563 Bacteria 2087
74 Ga0068855_100351036 3300005563 Bacteria 1625
75 Ga0068855_100352576 3300005563 Bacteria 1621
76 Ga0070664_100428085 3300005564 Bacteria 1213
77 Ga0068857_100067465 3300005577 Bacteria 3184
78 Ga0068856_100025011 3300005614 Bacteria 5819
79 Ga0068856_100028973 3300005614 Bacteria 5410
80 Ga0068856_100281607 3300005614 Bacteria 1679
81 Ga0068856_100660002 3300005614 Bacteria 1066
82 Ga0068856_100700949 3300005614 Bacteria 1033
83 Ga0070702_100247813 3300005615 Bacteria 1206
84 Ga0068852_100006341 3300005616 Bacteria 8536
85 Ga0068852_100597129 3300005616 Bacteria 1108
86 Ga0068852_100790140 3300005616 Bacteria 963
87 Ga0068859_102726217 3300005617 Bacteria 543
88 Ga0068866_10103851 3300005718 Bacteria 1573
89 Ga0068861_100533155 3300005719 Bacteria 1067
90 Ga0068861_101112385 3300005719 Bacteria 760
91 Ga0068862_100800780 3300005844 Bacteria 920
92 Ga0081538_10000809 3300005981 Bacteria 33947
93 Ga0075365_10309463 3300006038 Bacteria 1112
94 Ga0070715_10006063 3300006163 Bacteria 4081
95 Ga0070712_100148143 3300006175 Bacteria 1799
96 Ga0070712_100377024 3300006175 Bacteria 1167
97 Ga0070712_100474704 3300006175 Bacteria 1045
98 Ga0070712_100822167 3300006175 Bacteria 798
99 Ga0075367_10401549 3300006178 Bacteria 867
100 Ga0097621_100323606 3300006237 Bacteria 1366
101 Ga0097621_100424049 3300006237 Bacteria 1194
102 Ga0068871_100214961 3300006358 Bacteria 1664
103 Ga0068871_100583839 3300006358 Bacteria 1015
104 Ga0068865_100667582 3300006881 Bacteria 885
105 Ga0068865_101924277 3300006881 Bacteria 536
106 Ga0075436_100282010 3300006914 Bacteria 1188
107 Ga0097620_102727477 3300006931 Bacteria 543
108 Ga0075435_100166819 3300007076 Bacteria 1857
109 Ga0105240_10061243 3300009093 Bacteria 4690
110 Ga0105240_10291542 3300009093 Bacteria 1870
111 Ga0111539_10646680 3300009094 Bacteria 1231
112 Ga0105245_10012899 3300009098 Bacteria 7284
113 Ga0105245_10041206 3300009098 Bacteria 4117
114 Ga0105245_10217240 3300009098 Bacteria 1843
115 Ga0105247_11220245 3300009101 Bacteria 600
116 Ga0105243_10044497 3300009148 Bacteria 3483
117 Ga0105241_10590458 3300009174 Bacteria 1002
118 Ga0105241_11550452 3300009174 Bacteria 639
119 Ga0105242_10061296 3300009176 Bacteria 3094
120 Ga0105242_10195039 3300009176 Bacteria 1795
121 Ga0105248_12600148 3300009177 Bacteria 577
122 Ga0105237_10028148 3300009545 Bacteria 5727
123 Ga0105237_12693965 3300009545 Unclassified 508
124 Ga0105238_10207211 3300009551 Bacteria 1937
125 Ga0105249_11014162 3300009553 Bacteria 899
126 Ga0105249_11141045 3300009553 Bacteria 850
127 Ga0105239_10178074 3300010375 Bacteria 2378
128 Ga0105239_11109112 3300010375 Bacteria 911
129 Ga0105239_11206563 3300010375 Bacteria 872
130 Ga0105239_12250842 3300010375 Bacteria 634
131 Ga0157373_10188324 3300013100 Bacteria 1454
132 Ga0157371_10047405 3300013102 Bacteria 3055
133 Ga0157371_10177588 3300013102 Bacteria 1522
134 Ga0157370_10025745 3300013104 Bacteria 5820
135 Ga0157370_10083856 3300013104 Bacteria 2996
136 Ga0157370_10330492 3300013104 Bacteria 1406
137 Ga0157370_11052768 3300013104 Unclassified 736
138 Ga0157369_10006969 3300013105 Bacteria 13031
139 Ga0157369_10062629 3300013105 Bacteria 4008
140 Ga0157369_10201157 3300013105 Bacteria 2091
141 Ga0157369_10220231 3300013105 Bacteria 1987
142 Ga0157374_10345845 3300013296 Bacteria 1477
143 Ga0157374_11417573 3300013296 Bacteria 717
144 Ga0157378_11595705 3300013297 Bacteria 698
145 Ga0163162_10219805 3300013306 Bacteria 2030
146 Ga0157372_10026405 3300013307 Bacteria 6320
147 Ga0157372_10076616 3300013307 Bacteria 3776
148 Ga0157372_10447418 3300013307 Bacteria 1506
149 Ga0157372_11465941 3300013307 Unclassified 786
150 Ga0157372_11674972 3300013307 Bacteria 732
151 Ga0157375_10165490 3300013308 Bacteria 2356
152 Ga0157375_10724876 3300013308 Bacteria 1147
153 Ga0163163_11368179 3300014325 Bacteria 770
154 Ga0163163_12109044 3300014325 Bacteria 623
155 Ga0157380_10765366 3300014326 Bacteria 979
156 Ga0157379_10624563 3300014968 Unclassified 1007
157 Ga0157376_10555571 3300014969 Bacteria 1137
158 Ga0157376_12308853 3300014969 Unclassified 577
159 Ga0182006_1065253 3300015261 Bacteria 1363
160 Ga0182007_10185851 3300015262 Bacteria 720
161 Ga0182007_10370163 3300015262 Bacteria 542
162 Ga0197907_10898572 3300020069 Bacteria 1019
163 Ga0197907_11164167 3300020069 Bacteria 673
164 Ga0206356_10772295 3300020070 Bacteria 547
165 Ga0206354_10108151 3300020081 Bacteria 545
166 Ga0206354_10842383 3300020081 Bacteria 625
167 Ga0206354_11481859 3300020081 Bacteria 1058
168 Ga0206353_10039946 3300020082 Bacteria 1527
169 Ga0206353_10567668 3300020082 Bacteria 1219
170 Ga0206353_11608262 3300020082 Bacteria 1362
171 Ga0224712_10103283 3300022467 Bacteria 1212
172 Ga0207642_10107077 3300025899 Bacteria 1416
173 Ga0207710_10542204 3300025900 Bacteria 606
174 Ga0207688_10049842 3300025901 Bacteria 2342
175 Ga0207688_10859823 3300025901 Bacteria 574
176 Ga0207685_10028113 3300025905 Bacteria 1976
177 Ga0207699_10095020 3300025906 Bacteria 1879
178 Ga0207705_10352623 3300025909 Bacteria 1134
179 Ga0207705_11532620 3300025909 Unclassified 504
180 Ga0207654_10138778 3300025911 Bacteria 1548
181 Ga0207654_10748855 3300025911 Bacteria 704
182 Ga0207707_10002237 3300025912 Bacteria 17490
183 Ga0207707_10009006 3300025912 Bacteria 8670
184 Ga0207707_10072257 3300025912 Bacteria 3007
185 Ga0207707_10126302 3300025912 Bacteria 2237
186 Ga0207695_10155311 3300025913 Bacteria 2223
187 Ga0207695_10181083 3300025913 Bacteria 2028
188 Ga0207671_10045482 3300025914 Bacteria 3246
189 Ga0207671_11213255 3300025914 Bacteria 590
190 Ga0207693_10326465 3300025915 Bacteria 1201
191 Ga0207693_10405093 3300025915 Bacteria 1066
192 Ga0207663_10539037 3300025916 Bacteria 911
193 Ga0207663_11144924 3300025916 Bacteria 626
194 Ga0207660_10008381 3300025917 Bacteria 6686
195 Ga0207660_10138108 3300025917 Bacteria 1861
196 Ga0207660_10323497 3300025917 Bacteria 1232
197 Ga0207660_11244943 3300025917 Bacteria 605
198 Ga0207662_10272065 3300025918 Bacteria 1118
199 Ga0207657_10000467 3300025919 Bacteria 42840
200 Ga0207657_10000731 3300025919 Bacteria 34878
201 Ga0207657_10035446 3300025919 Bacteria 4474
202 Ga0207657_10128274 3300025919 Bacteria 2081
203 Ga0207657_10175722 3300025919 Bacteria 1733
204 Ga0207657_10421509 3300025919 Bacteria 1049
205 Ga0207657_10455941 3300025919 Bacteria 1003
206 Ga0207649_10106584 3300025920 Bacteria 1864
207 Ga0207649_10158046 3300025920 Bacteria 1568
208 Ga0207652_10021861 3300025921 Bacteria 5284
209 Ga0207652_10061576 3300025921 Bacteria 3241
210 Ga0207652_10074730 3300025921 Bacteria 2951
211 Ga0207652_10526231 3300025921 Bacteria 1064
212 Ga0207652_10608704 3300025921 Bacteria 979
213 Ga0207652_10756180 3300025921 Bacteria 865
214 Ga0207652_10789797 3300025921 Bacteria 843
215 Ga0207681_11024055 3300025923 Bacteria 693
216 Ga0207694_10119177 3300025924 Bacteria 2106
217 Ga0207694_10671161 3300025924 Bacteria 874
218 Ga0207659_10168850 3300025926 Bacteria 1724
219 Ga0207659_11815606 3300025926 Bacteria 518
220 Ga0207687_10152821 3300025927 Bacteria 1763
221 Ga0207687_10281477 3300025927 Bacteria 1333
222 Ga0207687_10341137 3300025927 Bacteria 1218
223 Ga0207700_10401255 3300025928 Bacteria 1202
224 Ga0207690_10010005 3300025932 Bacteria 5634
225 Ga0207690_10038365 3300025932 Bacteria 3117
226 Ga0207690_10099492 3300025932 Bacteria 2073
227 Ga0207690_10415765 3300025932 Unclassified 1075
228 Ga0207706_10329705 3300025933 Bacteria 1328
229 Ga0207686_10172850 3300025934 Bacteria 1525
230 Ga0207686_10402221 3300025934 Unclassified 1043
231 Ga0207709_10032476 3300025935 Bacteria 3056
232 Ga0207670_10723085 3300025936 Bacteria 825
233 Ga0207669_10532358 3300025937 Bacteria 945
234 Ga0207669_10539968 3300025937 Bacteria 939
235 Ga0207691_10269009 3300025940 Bacteria 1468
236 Ga0207711_10817060 3300025941 Bacteria 868
237 Ga0207711_11474236 3300025941 Bacteria 623
238 Ga0207711_11619844 3300025941 Bacteria 591
239 Ga0207689_10591332 3300025942 Bacteria 933
240 Ga0207689_11024206 3300025942 Bacteria 696
241 Ga0207661_10003566 3300025944 Bacteria 10821
242 Ga0207661_10416106 3300025944 Bacteria 1220
243 Ga0207661_10425529 3300025944 Bacteria 1206
244 Ga0207661_10660464 3300025944 Bacteria 961
245 Ga0207679_10360714 3300025945 Bacteria 1269
246 Ga0207679_10384033 3300025945 Bacteria 1232
247 Ga0207679_11312566 3300025945 Bacteria 664
248 Ga0207667_10027576 3300025949 Bacteria 6180
249 Ga0207667_10287406 3300025949 Bacteria 1680
250 Ga0207667_11870790 3300025949 Bacteria 563
251 Ga0207651_10294711 3300025960 Bacteria 1347
252 Ga0207712_10337323 3300025961 Unclassified 1249
253 Ga0207712_10989628 3300025961 Bacteria 746
254 Ga0207712_11006006 3300025961 Bacteria 740
255 Ga0207640_10305509 3300025981 Unclassified 1260
256 Ga0207658_11039433 3300025986 Bacteria 748
257 Ga0207677_10130773 3300026023 Bacteria 1905
258 Ga0207677_10563192 3300026023 Bacteria 995
259 Ga0207703_10140023 3300026035 Bacteria 2099
260 Ga0207639_10052524 3300026041 Bacteria 3106
261 Ga0207639_10136468 3300026041 Bacteria 2038
262 Ga0207639_10400080 3300026041 Bacteria 1237
263 Ga0207639_10467369 3300026041 Bacteria 1148
264 Ga0207639_11651351 3300026041 Bacteria 601
265 Ga0207678_10430940 3300026067 Bacteria 1144
266 Ga0207708_10243492 3300026075 Bacteria 1447
267 Ga0207702_10476942 3300026078 Bacteria 1213
268 Ga0207702_10990978 3300026078 Bacteria 834
269 Ga0207674_10088605 3300026116 Bacteria 3087
270 Ga0207674_10090008 3300026116 Bacteria 3060
271 Ga0207675_100559259 3300026118 Bacteria 1144
272 Ga0207675_100847934 3300026118 Bacteria 929
273 Ga0207683_10033247 3300026121 Bacteria 4479
274 Ga0207698_10043082 3300026142 Bacteria 3379
275 Ga0207698_10849935 3300026142 Bacteria 917
276 Ga0207698_11825483 3300026142 Bacteria 623
277 Ga0268266_10028962 3300028379 Bacteria 4706
278 Ga0268264_10961134 3300028381 Bacteria 860
279 Ga0265337_1025568 3300028556 Bacteria 1797
280 Ga0265326_10014746 3300028558 Bacteria 2275
281 Ga0265319_1003775 3300028563 Bacteria 7765
282 Ga0265334_10001611 3300028573 Bacteria 10835
283 Ga0265318_10001206 3300028577 Bacteria 15720
284 Ga0265323_10124858 3300028653 Bacteria 836
285 Ga0265322_10013711 3300028654 Bacteria 2347
286 Ga0265336_10025608 3300028666 Bacteria 1857
287 Ga0265336_10130398 3300028666 Bacteria 748
288 Ga0265338_10003587 3300028800 Bacteria 21674
289 Ga0265338_10093645 3300028800 Bacteria 2474
290 Ga0265338_10313819 3300028800 Bacteria 1136
291 Ga0265338_10339654 3300028800 Bacteria 1082
292 Ga0265324_10048976 3300029957 Bacteria 1453
293 Ga0265330_10011257 3300031235 Bacteria 4200
294 Ga0265332_10001674 3300031238 Bacteria 12107
295 Ga0265328_10000898 3300031239 Bacteria 13766
296 Ga0265320_10045024 3300031240 Bacteria 2169
297 Ga0265320_10184403 3300031240 Bacteria 934
298 Ga0265325_10004860 3300031241 Bacteria 8398
299 Ga0265325_10271998 3300031241 Bacteria 761
300 Ga0265329_10002795 3300031242 Bacteria 7796
301 Ga0265329_10231220 3300031242 Bacteria 613
302 Ga0265340_10007370 3300031247 Bacteria 5974
303 Ga0265339_10006923 3300031249 Bacteria 7382
304 Ga0265339_10186831 3300031249 Bacteria 1029
305 Ga0265331_10022946 3300031250 Bacteria 3177
306 Ga0265327_10004631 3300031251 Bacteria 12068
307 Ga0265316_10012197 3300031344 Bacteria 7712
308 Ga0265313_10009890 3300031595 Bacteria 6130
309 Ga0265314_10026978 3300031711 Bacteria 4307
310 Ga0265314_10306126 3300031711 Bacteria 889
311 Ga0265342_10019024 3300031712 Bacteria 4434
312 Ga0265342_10220014 3300031712 Bacteria 1023
313 Ga0307410_10335157 3300031852 Bacteria 1204
314 Ga0307406_10249536 3300031901 Bacteria 1336
315 Ga0307409_101788781 3300031995 Bacteria 643
316 Ga0307416_100783665 3300032002 Bacteria 1048
317 Ga0373944_0036426 3300035089 Bacteria 1503
318 Ga0373936_0002175 3300035113 Bacteria 7307
319 Ga0373945_0053688 3300035116 Bacteria 1488
320 Ga0373956_0624241 3300035119 Bacteria 514
321 Ga0373960_0112452 3300035121 Bacteria 895
322 Ga0373943_0045170 3300035170 Bacteria 2146
323 Ga0373943_0045871 3300035170 Bacteria 2131
324 Ga0373946_0235138 3300035171 Bacteria 889
325 Ga0373955_0202961 3300035172 Bacteria 1181
326 Ga0373924_0137809 3300035410 Bacteria 1064
327 Ga0373935_0263577 3300035692 Bacteria 1209
328 Ga0373927_0483850 3300035695 Bacteria 818
329 Ga0373933_0052021 3300035724 Bacteria 2449
330 Ga0373947_0006531 3300035725 Bacteria 6763
331 Ga0373947_0295939 3300035725 Bacteria 1078
332 Ga0373937_0053415 3300036401 Bacteria 3706
333 Ga0373925_0010265 3300037068 Bacteria 6793
334 Ga0395899_0023348 3300037312 Bacteria 4685
335 Ga0395899_0219864 3300037312 Bacteria 1316
336 Ga0395899_0416579 3300037312 Bacteria 886
337 Ga0395900_0025838 3300037418 Bacteria 6012
338 Ga0395900_0628158 3300037418 Bacteria 1012
339 Ga0395898_0014525 3300037466 Bacteria 8087
340 Ga0395898_0040304 3300037466 Bacteria 4619
341 Ga0395898_1131220 3300037466 Unclassified 716
342 Ga0395905_0070140 3300037471 Bacteria 3283
343 Ga0395905_0661994 3300037471 Unclassified 946
344 Ga0395905_1907011 3300037471 Bacteria 500
345 Ga0395901_0022533 3300038443 Bacteria 6456
346 Ga0395901_0518662 3300038443 Bacteria 1211
347 Ga0395901_1241643 3300038443 Bacteria 709
348 Ga0436365_1713197 3300039437 Bacteria 1967
349 Ga0436363_0904841 3300039450 Bacteria 574
350 Ga0439438_032702 3300041405 Bacteria 1378
351 Ga0451802_0683445 3300041460 Bacteria 770
352 Ga0451847_0324892 3300041503 Bacteria 555
353 Ga0451853_0962046 3300041512 Unclassified 585
354 Ga0439431_0050098 3300041997 Bacteria 1081
355 Ga0439441_023784 3300042001 Bacteria 1147
356 Ga0439442_112613 3300042002 Bacteria 593
357 Ga0439448_0037808 3300042005 Bacteria 1552
358 Ga0439450_061542 3300042008 Bacteria 908
359 Ga0450915_015225 3300042119 Bacteria 577
360 Ga0450920_014080 3300042122 Bacteria 1510
361 Ga0450907_009372 3300042146 Bacteria 1623
362 Ga0450910_035542 3300042147 Bacteria 794
363 Ga0450910_061432 3300042147 Bacteria 635
364 Ga0439446_0009477 3300042156 Bacteria 2607
365 Ga0439434_0013357 3300042435 Bacteria 2438
366 Ga0466966_0002628 3300044684 Bacteria 11768
367 Ga0466966_0185510 3300044684 Bacteria 1261
368 Ga0466961_0002298 3300044693 Bacteria 11884
369 Ga0466963_0002261 3300044694 Bacteria 10700
370 Ga0466963_0022468 3300044694 Bacteria 3995
371 Ga0466963_0045643 3300044694 Bacteria 2886
372 Ga0466963_0110438 3300044694 Bacteria 1887
373 Ga0466963_0170504 3300044694 Bacteria 1517
374 Ga0466963_0257392 3300044694 Bacteria 1225
375 Ga0466964_0006383 3300044706 Bacteria 4395
376 Ga0466964_0095056 3300044706 Bacteria 1304
377 Ga0466971_0000910 3300044719 Bacteria 12117
378 Ga0466971_0644785 3300044719 Bacteria 530
379 Ga0466957_0000349 3300044842 Bacteria 22576
380 Ga0466957_0044788 3300044842 Bacteria 2682
381 Ga0466957_0435123 3300044842 Bacteria 902
382 Ga0466960_0114570 3300044901 Bacteria 1405
383 Ga0466959_0000435 3300045049 Bacteria 24320
384 Ga0466959_0013400 3300045049 Bacteria 5943
385 Ga0466959_0095285 3300045049 Bacteria 2135
386 Ga0466959_0750195 3300045049 Bacteria 653
387 Ga0466958_0007727 3300045836 Bacteria 5931
388 Ga0466967_0000265 3300045976 Bacteria 23015
389 Ga0466967_0000781 3300045976 Bacteria 16563
390 Ga0466967_0009902 3300045976 Bacteria 7111
391 Ga0466967_0014620 3300045976 Bacteria 6123
392 Ga0466967_0015693 3300045976 Bacteria 5948
393 Ga0466967_0021416 3300045976 Bacteria 5249
394 Ga0466967_0055394 3300045976 Bacteria 3492
395 Ga0466967_0058281 3300045976 Bacteria 3413
396 Ga0466967_0187637 3300045976 Bacteria 1953
397 Ga0466967_0615907 3300045976 Bacteria 1072
398 Ga0466967_0638195 3300045976 Bacteria 1052
399 Ga0466967_1045234 3300045976 Bacteria 813
400 Ga0495603_0051258 3300046455 Bacteria 2453
401 Ga0495603_0436176 3300046455 Bacteria 750
402 Ga0495629_0015277 3300046459 Bacteria 5514
403 Ga0495629_0275730 3300046459 Bacteria 1155
404 Ga0495641_0107746 3300046461 Bacteria 1243
405 Ga0495641_0130355 3300046461 Bacteria 1122
406 Ga0495641_0425669 3300046461 Unclassified 603
407 Ga0495651_0151737 3300046462 Bacteria 1669
408 Ga0495651_0381103 3300046462 Bacteria 925
409 Ga0495653_0961513 3300046463 Bacteria 506
410 Ga0495639_0099624 3300046475 Bacteria 1371
411 Ga0495664_0183925 3300046477 Bacteria 1267
412 Ga0495584_0187884 3300046491 Bacteria 1050
413 Ga0495608_0023600 3300046511 Bacteria 4215
414 Ga0495628_0478322 3300046516 Bacteria 902
415 Ga0495630_0023500 3300046517 Bacteria 4557
416 Ga0495630_0528620 3300046517 Unclassified 904
417 Ga0495667_0050896 3300046559 Bacteria 2734
418 Ga0495634_0065766 3300046642 Bacteria 2402
419 Ga0495634_0067785 3300046642 Bacteria 2359
420 Ga0495635_0151199 3300046663 Bacteria 1580
421 Ga0495588_0436242 3300046674 Bacteria 687
422 Ga0495657_0071504 3300046675 Bacteria 2264
423 Ga0495657_0095709 3300046675 Bacteria 1898
424 Ga0495647_0218484 3300046681 Bacteria 840
425 Ga0495658_0007224 3300046683 Bacteria 5489
426 Ga0495658_0473699 3300046683 Bacteria 800
427 Ga0495613_0011876 3300046689 Bacteria 6473
428 Ga0495613_0169117 3300046689 Bacteria 1552
429 Ga0495600_0058724 3300046809 Bacteria 2513
430 Ga0495581_0536245 3300047315 Bacteria 680
431 Ga0495581_0872471 3300047315 Bacteria 514
432 Ga0495604_0387400 3300047317 Bacteria 922
433 Ga0495674_0432494 3300047319 Bacteria 1059
434 Ga0495676_0208900 3300047321 Bacteria 1352
435 Ga0495680_0003274 3300047322 Bacteria 16061
436 Ga0495675_0290220 3300047444 Bacteria 974
437 Ga0495684_0020392 3300047471 Bacteria 5108
438 Ga0495602_0474423 3300048088 Bacteria 879
439 Ga0496100_0029557 3300048903 Bacteria 3391
440 Ga0496100_0077896 3300048903 Bacteria 2230
441 Ga0496100_0084589 3300048903 Bacteria 2150
442 Ga0496100_0101088 3300048903 Bacteria 1987
443 Ga0496101_0006731 3300048904 Bacteria 7414
444 Ga0496101_0022064 3300048904 Bacteria 4380
445 Ga0496101_0023532 3300048904 Bacteria 4257
446 Ga0496101_0024266 3300048904 Bacteria 4195
447 Ga0496101_0137026 3300048904 Bacteria 1863
448 Ga0496101_0334281 3300048904 Bacteria 1189
449 Ga0496102_0019711 3300048905 Bacteria 5944
450 Ga0496102_0082066 3300048905 Bacteria 2973
451 Ga0496102_0126921 3300048905 Bacteria 2385
452 Ga0496102_0318292 3300048905 Bacteria 1466
453 Ga0496102_0335188 3300048905 Bacteria 1425
454 Ga0496102_0361135 3300048905 Bacteria 1367
455 Ga0496102_0905256 3300048905 Bacteria 804
456 Ga0496103_0104386 3300048906 Bacteria 1796
457 Ga0496103_0193328 3300048906 Bacteria 1308
458 Ga0496104_0000319 3300048907 Bacteria 42768
459 Ga0496104_0202649 3300048907 Bacteria 1896
460 Ga0496104_0607734 3300048907 Bacteria 1004
461 Ga0496104_0851558 3300048907 Bacteria 817
462 Ga0496104_0997379 3300048907 Bacteria 741
463 Ga0496105_0000194 3300048908 Bacteria 40666
464 Ga0496105_0110862 3300048908 Bacteria 2265
465 Ga0496105_0156256 3300048908 Bacteria 1873
466 Ga0496105_0740634 3300048908 Bacteria 751
467 Ga0496105_1313953 3300048908 Bacteria 527
468 Ga0496106_0023028 3300048909 Bacteria 4626
469 Ga0496106_0241093 3300048909 Bacteria 1445
470 Ga0496106_0446576 3300048909 Bacteria 1039
471 Ga0496107_0009958 3300048910 Bacteria 6595
472 Ga0496107_0024981 3300048910 Bacteria 4229
473 Ga0496107_0187715 3300048910 Bacteria 1535
474 Ga0496107_0384314 3300048910 Bacteria 1044
475 Ga0496107_0565479 3300048910 Bacteria 842
476 Ga0496108_0000971 3300048911 Bacteria 22338
477 Ga0496108_0296482 3300048911 Bacteria 1408
478 Ga0496108_1263181 3300048911 Bacteria 622
479 Ga0496109_0000458 3300048912 Bacteria 34881
480 Ga0496109_0050601 3300048912 Bacteria 3783
481 Ga0496109_0381927 3300048912 Bacteria 1331
482 Ga0496109_0569398 3300048912 Bacteria 1068
483 Ga0496110_0002903 3300048913 Bacteria 12976
484 Ga0496110_0010229 3300048913 Bacteria 7622
485 Ga0496110_0239912 3300048913 Bacteria 1649
486 Ga0496111_0034631 3300048914 Bacteria 3606
487 Ga0496111_0137652 3300048914 Bacteria 1809
488 Ga0496111_0496374 3300048914 Bacteria 898
489 Ga0496112_0372830 3300048915 Unclassified 1369
490 Ga0496112_0454903 3300048915 Bacteria 1218
491 Ga0496112_0936647 3300048915 Bacteria 787
492 Ga0496113_0089594 3300048916 Bacteria 2368
493 Ga0496113_0172567 3300048916 Bacteria 1713
494 Ga0496113_0813216 3300048916 Bacteria 742
495 Ga0496114_0000510 3300048917 Bacteria 28469
496 Ga0496114_0004175 3300048917 Bacteria 11183
497 Ga0496114_0007371 3300048917 Bacteria 8691
498 Ga0496114_0050597 3300048917 Bacteria 3459
499 Ga0496114_0103213 3300048917 Bacteria 2437
500 Ga0496114_0425916 3300048917 Bacteria 1176
501 Ga0496115_0000431 3300048918 Bacteria 33991
502 Ga0496115_0073089 3300048918 Bacteria 2783
503 Ga0496115_0388241 3300048918 Bacteria 1134
504 Ga0496115_0610758 3300048918 Bacteria 866
505 Ga0496115_0771195 3300048918 Bacteria 750
506 Ga0501031_0004013 3300049568 Bacteria 9496
507 Ga0501031_0011292 3300049568 Bacteria 5819
508 Ga0501032_0035558 3300049569 Bacteria 3405
509 Ga0501032_0137322 3300049569 Bacteria 1611
510 Ga0501033_0027299 3300049570 Bacteria 4292
511 Ga0501033_0113835 3300049570 Bacteria 1967
512 Ga0501033_0163547 3300049570 Bacteria 1601
513 Ga0501036_0000261 3300049572 Bacteria 35846
514 Ga0501036_0005893 3300049572 Bacteria 9930
515 Ga0501036_0086238 3300049572 Bacteria 2654
516 Ga0501037_0026288 3300049573 Bacteria 4302
517 Ga0501037_0325890 3300049573 Bacteria 1063
518 Ga0501038_0023050 3300049574 Bacteria 5571
519 Ga0501038_0081648 3300049574 Bacteria 2724
520 Ga0501038_0094569 3300049574 Bacteria 2498
521 Ga0501039_0011079 3300049575 Bacteria 6871
522 Ga0501039_0026396 3300049575 Bacteria 4463
523 Ga0501039_0165654 3300049575 Bacteria 1738
524 Ga0501039_0297433 3300049575 Bacteria 1269
525 Ga0501039_0817216 3300049575 Bacteria 727
526 Ga0501040_0000344 3300049576 Bacteria 27241
527 Ga0501040_0013668 3300049576 Bacteria 5338
528 Ga0501040_0070788 3300049576 Bacteria 2407
529 Ga0501040_0134327 3300049576 Bacteria 1741
530 Ga0501041_0001411 3300049577 Bacteria 13273
531 Ga0501041_0006031 3300049577 Bacteria 7089
532 Ga0501041_0092786 3300049577 Bacteria 1864
533 Ga0501041_0247781 3300049577 Bacteria 1120
534 Ga0501042_0004621 3300049578 Bacteria 8790
535 Ga0501042_0022168 3300049578 Bacteria 4435
536 Ga0501042_0209885 3300049578 Bacteria 1405
537 Ga0501042_0707372 3300049578 Unclassified 733
538 Ga0501043_0215405 3300049579 Bacteria 1487
539 Ga0501046_0006023 3300049580 Bacteria 10784
540 Ga0501046_0082969 3300049580 Bacteria 2475
541 Ga0501046_0726374 3300049580 Bacteria 699
542 Ga0501046_0796298 3300049580 Bacteria 662
543 Ga0501048_0034079 3300049582 Bacteria 3676
544 Ga0501048_0186287 3300049582 Bacteria 1471
545 Ga0501048_0694602 3300049582 Bacteria 730
546 Ga0501048_0712095 3300049582 Bacteria 721
547 Ga0501067_0000208 3300049583 Bacteria 32744
548 Ga0501067_0067263 3300049583 Bacteria 1983
549 Ga0501068_0010528 3300049584 Bacteria 5197
550 Ga0501068_0033981 3300049584 Bacteria 3040
551 Ga0501068_0141766 3300049584 Bacteria 1507
552 Ga0501069_0000901 3300049585 Bacteria 14162
553 Ga0501069_0090169 3300049585 Bacteria 1733
554 Ga0501069_0106346 3300049585 Bacteria 1595
555 Ga0501069_0214676 3300049585 Bacteria 1117
556 Ga0501071_0000430 3300049587 Bacteria 20980
557 Ga0501071_0013850 3300049587 Bacteria 5504
558 Ga0501071_0138107 3300049587 Bacteria 1814
559 Ga0501072_0000897 3300049588 Bacteria 21843
560 Ga0501072_0008013 3300049588 Bacteria 8018
561 Ga0501072_0468167 3300049588 Bacteria 998
562 Ga0501072_0587448 3300049588 Bacteria 878
563 Ga0501073_0129538 3300049589 Bacteria 1749
564 Ga0501074_0016767 3300049590 Bacteria 5315
565 Ga0501074_0019812 3300049590 Bacteria 4886
566 Ga0501074_0645978 3300049590 Bacteria 747
567 Ga0501075_0001217 3300049591 Bacteria 16683
568 Ga0501075_0159348 3300049591 Bacteria 1721
569 Ga0501076_0000330 3300049592 Bacteria 29312
570 Ga0501076_0003143 3300049592 Bacteria 11515
571 Ga0501076_0003676 3300049592 Bacteria 10783
572 Ga0501076_0242116 3300049592 Bacteria 1476
573 Ga0501077_0002421 3300049593 Bacteria 11194
574 Ga0501077_0008570 3300049593 Bacteria 6337
575 Ga0501077_0014090 3300049593 Bacteria 5015
576 Ga0501077_0376351 3300049593 Bacteria 907
577 Ga0501079_0004782 3300049741 Bacteria 10035
578 Ga0501079_0015023 3300049741 Bacteria 5902
579 Ga0501079_0030332 3300049741 Bacteria 4154
580 Ga0501080_0011873 3300049742 Bacteria 7979
581 Ga0501080_0153657 3300049742 Bacteria 2126
582 Ga0501081_0001194 3300049743 Bacteria 15741
583 Ga0501081_0006646 3300049743 Bacteria 7518
584 Ga0501081_0014696 3300049743 Bacteria 5164
585 Ga0501081_0025578 3300049743 Bacteria 3972
586 Ga0501081_0239846 3300049743 Bacteria 1322
587 Ga0501081_0997088 3300049743 Bacteria 633
588 Ga0501083_0016010 3300049744 Bacteria 5252
589 Ga0501083_0060454 3300049744 Bacteria 2531
590 Ga0501083_0820310 3300049744 Bacteria 605
591 Ga0501035_0014888 3300049822 Bacteria 7178
592 Ga0501035_0242717 3300049822 Bacteria 1532
593 Ga0501035_0375604 3300049822 Bacteria 1186
594 Ga0501045_0000784 3300049824 Bacteria 20425
595 Ga0501045_0002106 3300049824 Bacteria 13459
596 Ga0501045_0009831 3300049824 Bacteria 6693
597 Ga0501045_0976966 3300049824 Bacteria 621
598 nmdc:mga03n38_764770_c1 3300050490 Bacteria 560
599 nmdc:mga0yw44_298610_c1 3300050492 Bacteria 1079
600 nmdc:mga06z11_421127_c1 3300050494 Bacteria 805
601 nmdc:mga08y16_960391_c1 3300050511 Bacteria 837
602 nmdc:mga0rr50_178194_c1 3300050513 Bacteria 1736
603 nmdc:mga0rr50_238276_c1 3300050513 Bacteria 1507
604 Ga0495601_0105291 3300053077 Bacteria 1824
605 Ga0495595_0114381 3300053084 Bacteria 1311
606 Ga0495595_0430911 3300053084 Bacteria 669
607 Ga0495619_0050809 3300053085 Bacteria 2738
608 Ga0501084_0000982 3300054114 Bacteria 22117
609 Ga0501084_0005384 3300054114 Bacteria 10491
610 Ga0501084_0007211 3300054114 Bacteria 9162
611 Ga0501084_0079394 3300054114 Bacteria 2750
612 Ga0501084_0152886 3300054114 Bacteria 1945
613 Ga0590077_110220 3300059426 Bacteria 647
614 Ga0501082_0003519 3300060353 Bacteria 13680
615 Ga0501082_0015919 3300060353 Bacteria 6468
616 Ga0501082_0035686 3300060353 Bacteria 4285
617 Ga0501082_0094983 3300060353 Bacteria 2576
618 Ga0466962_0004212 3300061719 Bacteria 6890
619 Ga0530510_0006712 3300061734 Bacteria 8023
620 Ga0530510_0022478 3300061734 Bacteria 4493
621 Ga0530510_0147608 3300061734 Bacteria 1735

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025900 Ga0207710_10542204 Ga0207710_105422042 119
2 3300025914 Ga0207671_11213255 Ga0207671_112132551 119
3 3300026035 Ga0207703_10140023 Ga0207703_101400232 119
4 3300041503 Ga0451847_0324892 Ga0451847_0324892_100_459 119
5 3300042147 Ga0450910_035542 Ga0450910_035542_178_540 119
6 3300049570 Ga0501033_0163547 Ga0501033_0163547_1092_1469 119
7 3300049572 Ga0501036_0086238 Ga0501036_0086238_327_704 119
8 3300049574 Ga0501038_0094569 Ga0501038_0094569_1889_2266 119
9 3300049575 Ga0501039_0026396 Ga0501039_0026396_1508_1885 119
10 3300049576 Ga0501040_0070788 Ga0501040_0070788_984_1361 119
11 3300049577 Ga0501041_0006031 Ga0501041_0006031_1522_1899 119
12 3300049578 Ga0501042_0707372 Ga0501042_0707372_26_403 119
13 3300049580 Ga0501046_0082969 Ga0501046_0082969_1760_2137 119
14 3300049584 Ga0501068_0033981 Ga0501068_0033981_2298_2675 119
15 3300049585 Ga0501069_0090169 Ga0501069_0090169_561_938 119
16 3300049587 Ga0501071_0000430 Ga0501071_0000430_697_1074 119
17 3300049588 Ga0501072_0000897 Ga0501072_0000897_16537_16914 119
18 3300049590 Ga0501074_0645978 Ga0501074_0645978_34_411 119
19 3300049592 Ga0501076_0003676 Ga0501076_0003676_6990_7367 119
20 3300049593 Ga0501077_0002421 Ga0501077_0002421_5509_5886 119
21 3300049741 Ga0501079_0030332 Ga0501079_0030332_2053_2430 119
22 3300049742 Ga0501080_0011873 Ga0501080_0011873_5839_6216 119
23 3300049743 Ga0501081_0014696 Ga0501081_0014696_1570_1947 119
24 3300049744 Ga0501083_0060454 Ga0501083_0060454_867_1244 119
25 3300049824 Ga0501045_0009831 Ga0501045_0009831_5245_5622 119
26 3300054114 Ga0501084_0005384 Ga0501084_0005384_7807_8184 119
27 3300060353 Ga0501082_0003519 Ga0501082_0003519_1247_1624 119
28 3300061734 Ga0530510_0022478 Ga0530510_0022478_4094_4471 119
29 3300005327 Ga0070658_10244811 Ga0070658_102448112 120
30 3300005327 Ga0070658_10258221 Ga0070658_102582211 120
31 3300005329 Ga0070683_100093616 Ga0070683_1000936164 120
32 3300005329 Ga0070683_100328744 Ga0070683_1003287442 120
33 3300005329 Ga0070683_100746731 Ga0070683_1007467312 120
34 3300005336 Ga0070680_100216681 Ga0070680_1002166813 120
35 3300005336 Ga0070680_100604099 Ga0070680_1006040991 120
36 3300005337 Ga0070682_100051110 Ga0070682_1000511103 120
37 3300005337 Ga0070682_100087692 Ga0070682_1000876924 120
38 3300005339 Ga0070660_100001227 Ga0070660_10000122711 120
39 3300005339 Ga0070660_100064925 Ga0070660_1000649253 120
40 3300005339 Ga0070660_100160434 Ga0070660_1001604341 120
41 3300005339 Ga0070660_100224027 Ga0070660_1002240273 120
42 3300005339 Ga0070660_100274547 Ga0070660_1002745472 120
43 3300005341 Ga0070691_10477961 Ga0070691_104779611 120
44 3300005344 Ga0070661_100005972 Ga0070661_1000059728 120
45 3300005344 Ga0070661_100011452 Ga0070661_1000114525 120
46 3300005344 Ga0070661_100021829 Ga0070661_1000218295 120
47 3300005366 Ga0070659_100015315 Ga0070659_1000153153 120
48 3300005366 Ga0070659_101799714 Ga0070659_1017997141 120
49 3300005434 Ga0070709_10101218 Ga0070709_101012182 120
50 3300005434 Ga0070709_10314920 Ga0070709_103149202 120
51 3300005436 Ga0070713_101135743 Ga0070713_1011357432 120
52 3300005458 Ga0070681_10003001 Ga0070681_1000300112 120
53 3300005458 Ga0070681_10008477 Ga0070681_100084775 120
54 3300005458 Ga0070681_10277886 Ga0070681_102778863 120
55 3300005530 Ga0070679_100023955 Ga0070679_1000239555 120
56 3300005530 Ga0070679_100262126 Ga0070679_1002621263 120
57 3300005530 Ga0070679_100348204 Ga0070679_1003482042 120
58 3300005530 Ga0070679_100523621 Ga0070679_1005236212 120
59 3300005535 Ga0070684_100050016 Ga0070684_1000500164 120
60 3300005535 Ga0070684_100094686 Ga0070684_1000946862 120
61 3300005535 Ga0070684_100178815 Ga0070684_1001788152 120
62 3300005535 Ga0070684_100578051 Ga0070684_1005780512 120
63 3300005539 Ga0068853_100071494 Ga0068853_1000714944 120
64 3300005539 Ga0068853_100898304 Ga0068853_1008983041 120
65 3300005539 Ga0068853_102192928 Ga0068853_1021929282 120
66 3300005546 Ga0070696_101011454 Ga0070696_1010114541 120
67 3300005548 Ga0070665_100004675 Ga0070665_10000467516 120
68 3300005563 Ga0068855_100005572 Ga0068855_10000557212 120
69 3300005563 Ga0068855_100008007 Ga0068855_1000080076 120
70 3300005563 Ga0068855_100228049 Ga0068855_1002280494 120
71 3300005563 Ga0068855_100351036 Ga0068855_1003510362 120
72 3300005563 Ga0068855_100352576 Ga0068855_1003525762 120
73 3300005577 Ga0068857_100067465 Ga0068857_1000674653 120
74 3300005614 Ga0068856_100025011 Ga0068856_1000250114 120
75 3300005614 Ga0068856_100028973 Ga0068856_1000289734 120
76 3300005614 Ga0068856_100700949 Ga0068856_1007009492 120
77 3300005616 Ga0068852_100006341 Ga0068852_1000063415 120
78 3300009093 Ga0105240_10061243 Ga0105240_100612434 120
79 3300009093 Ga0105240_10291542 Ga0105240_102915422 120
80 3300009174 Ga0105241_11550452 Ga0105241_115504522 120
81 3300009545 Ga0105237_10028148 Ga0105237_100281488 120
82 3300009545 Ga0105237_12693965 Ga0105237_126939651 120
83 3300009551 Ga0105238_10207211 Ga0105238_102072114 120
84 3300010375 Ga0105239_11206563 Ga0105239_112065632 120
85 3300013100 Ga0157373_10188324 Ga0157373_101883242 120
86 3300013102 Ga0157371_10047405 Ga0157371_100474054 120
87 3300013104 Ga0157370_10025745 Ga0157370_100257455 120
88 3300013104 Ga0157370_10083856 Ga0157370_100838564 120
89 3300013104 Ga0157370_10330492 Ga0157370_103304922 120
90 3300013104 Ga0157370_11052768 Ga0157370_110527681 120
91 3300013105 Ga0157369_10006969 Ga0157369_1000696911 120
92 3300013105 Ga0157369_10062629 Ga0157369_100626296 120
93 3300013105 Ga0157369_10201157 Ga0157369_102011572 120
94 3300013105 Ga0157369_10220231 Ga0157369_102202313 120
95 3300013307 Ga0157372_10026405 Ga0157372_100264054 120
96 3300013307 Ga0157372_10076616 Ga0157372_100766162 120
97 3300013307 Ga0157372_10447418 Ga0157372_104474183 120
98 3300013307 Ga0157372_11465941 Ga0157372_114659412 120
99 3300015261 Ga0182006_1065253 Ga0182006_10652531 120
100 3300015262 Ga0182007_10185851 Ga0182007_101858512 120
101 3300020069 Ga0197907_10898572 Ga0197907_108985722 120
102 3300020069 Ga0197907_11164167 Ga0197907_111641671 120
103 3300020070 Ga0206356_10772295 Ga0206356_107722951 120
104 3300020081 Ga0206354_10108151 Ga0206354_101081511 120
105 3300020081 Ga0206354_10842383 Ga0206354_108423832 120
106 3300020081 Ga0206354_11481859 Ga0206354_114818592 120
107 3300020082 Ga0206353_10039946 Ga0206353_100399462 120
108 3300020082 Ga0206353_10567668 Ga0206353_105676682 120
109 3300020082 Ga0206353_11608262 Ga0206353_116082622 120
110 3300022467 Ga0224712_10103283 Ga0224712_101032832 120
111 3300025906 Ga0207699_10095020 Ga0207699_100950202 120
112 3300025909 Ga0207705_10352623 Ga0207705_103526232 120
113 3300025909 Ga0207705_11532620 Ga0207705_115326201 120
114 3300025911 Ga0207654_10138778 Ga0207654_101387782 120
115 3300025911 Ga0207654_10748855 Ga0207654_107488552 120
116 3300025912 Ga0207707_10002237 Ga0207707_1000223711 120
117 3300025912 Ga0207707_10072257 Ga0207707_100722572 120
118 3300025913 Ga0207695_10155311 Ga0207695_101553114 120
119 3300025913 Ga0207695_10181083 Ga0207695_101810832 120
120 3300025914 Ga0207671_10045482 Ga0207671_100454825 120
121 3300025916 Ga0207663_10539037 Ga0207663_105390372 120
122 3300025916 Ga0207663_11144924 Ga0207663_111449242 120
123 3300025917 Ga0207660_10008381 Ga0207660_100083814 120
124 3300025917 Ga0207660_10138108 Ga0207660_101381082 120
125 3300025919 Ga0207657_10000467 Ga0207657_1000046742 120
126 3300025919 Ga0207657_10000731 Ga0207657_1000073120 120
127 3300025919 Ga0207657_10035446 Ga0207657_100354464 120
128 3300025919 Ga0207657_10128274 Ga0207657_101282742 120
129 3300025919 Ga0207657_10175722 Ga0207657_101757223 120
130 3300025920 Ga0207649_10106584 Ga0207649_101065842 120
131 3300025920 Ga0207649_10158046 Ga0207649_101580462 120
132 3300025921 Ga0207652_10061576 Ga0207652_100615763 120
133 3300025921 Ga0207652_10526231 Ga0207652_105262312 120
134 3300025921 Ga0207652_10608704 Ga0207652_106087042 120
135 3300025921 Ga0207652_10756180 Ga0207652_107561802 120
136 3300025924 Ga0207694_10119177 Ga0207694_101191774 120
137 3300025928 Ga0207700_10401255 Ga0207700_104012552 120
138 3300025932 Ga0207690_10010005 Ga0207690_100100054 120
139 3300025932 Ga0207690_10038365 Ga0207690_100383652 120
140 3300025932 Ga0207690_10099492 Ga0207690_100994923 120
141 3300025933 Ga0207706_10329705 Ga0207706_103297052 120
142 3300025944 Ga0207661_10416106 Ga0207661_104161063 120
143 3300025944 Ga0207661_10425529 Ga0207661_104255292 120
144 3300025945 Ga0207679_10360714 Ga0207679_103607142 120
145 3300025949 Ga0207667_10027576 Ga0207667_100275764 120
146 3300025949 Ga0207667_10287406 Ga0207667_102874062 120
147 3300025949 Ga0207667_11870790 Ga0207667_118707902 120
148 3300026041 Ga0207639_10052524 Ga0207639_100525244 120
149 3300026041 Ga0207639_10136468 Ga0207639_101364682 120
150 3300026041 Ga0207639_10400080 Ga0207639_104000802 120
151 3300026041 Ga0207639_11651351 Ga0207639_116513511 120
152 3300026067 Ga0207678_10430940 Ga0207678_104309403 120
153 3300026078 Ga0207702_10476942 Ga0207702_104769422 120
154 3300026116 Ga0207674_10088605 Ga0207674_100886052 120
155 3300026116 Ga0207674_10090008 Ga0207674_100900082 120
156 3300026142 Ga0207698_10043082 Ga0207698_100430823 120
157 3300028379 Ga0268266_10028962 Ga0268266_100289625 120
158 3300032002 Ga0307416_100783665 Ga0307416_1007836652 120
159 3300037312 Ga0395899_0219864 Ga0395899_0219864_125_505 120
160 3300037418 Ga0395900_0025838 Ga0395900_0025838_3105_3485 120
161 3300037466 Ga0395898_0040304 Ga0395898_0040304_1826_2206 120
162 3300037466 Ga0395898_1131220 Ga0395898_1131220_272_637 120
163 3300038443 Ga0395901_0022533 Ga0395901_0022533_577_942 120
164 3300041405 Ga0439438_032702 Ga0439438_032702_261_626 120
165 3300041997 Ga0439431_0050098 Ga0439431_0050098_421_786 120
166 3300042002 Ga0439442_112613 Ga0439442_112613_49_417 120
167 3300042122 Ga0450920_014080 Ga0450920_014080_212_577 120
168 3300042146 Ga0450907_009372 Ga0450907_009372_1037_1402 120
169 3300042147 Ga0450910_061432 Ga0450910_061432_142_507 120
170 3300042156 Ga0439446_0009477 Ga0439446_0009477_1598_1963 120
171 3300042435 Ga0439434_0013357 Ga0439434_0013357_191_556 120
172 3300044694 Ga0466963_0045643 Ga0466963_0045643_322_687 120
173 3300044694 Ga0466963_0170504 Ga0466963_0170504_841_1209 120
174 3300044706 Ga0466964_0006383 Ga0466964_0006383_1059_1424 120
175 3300044719 Ga0466971_0644785 Ga0466971_0644785_112_477 120
176 3300045049 Ga0466959_0095285 Ga0466959_0095285_1004_1369 120
177 3300045976 Ga0466967_0009902 Ga0466967_0009902_3565_3933 120
178 3300045976 Ga0466967_0055394 Ga0466967_0055394_2267_2632 120
179 3300045976 Ga0466967_0638195 Ga0466967_0638195_622_987 120
180 3300048903 Ga0496100_0077896 Ga0496100_0077896_175_540 120
181 3300048904 Ga0496101_0006731 Ga0496101_0006731_3568_3933 120
182 3300048905 Ga0496102_0361135 Ga0496102_0361135_494_859 120
183 3300048907 Ga0496104_0202649 Ga0496104_0202649_96_461 120
184 3300048908 Ga0496105_0110862 Ga0496105_0110862_553_918 120
185 3300048909 Ga0496106_0446576 Ga0496106_0446576_444_809 120
186 3300048910 Ga0496107_0384314 Ga0496107_0384314_66_431 120
187 3300048917 Ga0496114_0007371 Ga0496114_0007371_4759_5124 120
188 3300048917 Ga0496114_0425916 Ga0496114_0425916_43_471 120
189 3300048918 Ga0496115_0000431 Ga0496115_0000431_21612_21977 120
190 3300049575 Ga0501039_0817216 Ga0501039_0817216_33_401 120
191 3300049583 Ga0501067_0000208 Ga0501067_0000208_7848_8213 120
192 3300049583 Ga0501067_0067263 Ga0501067_0067263_1285_1650 120
193 3300049585 Ga0501069_0000901 Ga0501069_0000901_6976_7341 120
194 3300049585 Ga0501069_0106346 Ga0501069_0106346_655_1086 120
195 3300049743 Ga0501081_0239846 Ga0501081_0239846_660_1025 120
196 3300059426 Ga0590077_110220 Ga0590077_110220_205_573 120
197 3300006175 Ga0070712_100822167 Ga0070712_1008221672 121
198 3300015262 Ga0182007_10370163 Ga0182007_103701631 121
199 3300025912 Ga0207707_10126302 Ga0207707_101263023 121
200 3300025915 Ga0207693_10405093 Ga0207693_104050932 121
201 3300025921 Ga0207652_10021861 Ga0207652_100218612 121
202 3300028556 Ga0265337_1025568 Ga0265337_10255683 121
203 3300028558 Ga0265326_10014746 Ga0265326_100147462 121
204 3300028563 Ga0265319_1003775 Ga0265319_100377510 121
205 3300028573 Ga0265334_10001611 Ga0265334_1000161111 121
206 3300028577 Ga0265318_10001206 Ga0265318_100012067 121
207 3300028653 Ga0265323_10124858 Ga0265323_101248582 121
208 3300028654 Ga0265322_10013711 Ga0265322_100137112 121
209 3300028666 Ga0265336_10025608 Ga0265336_100256083 121
210 3300028666 Ga0265336_10130398 Ga0265336_101303982 121
211 3300028800 Ga0265338_10003587 Ga0265338_100035876 121
212 3300028800 Ga0265338_10093645 Ga0265338_100936453 121
213 3300028800 Ga0265338_10313819 Ga0265338_103138192 121
214 3300028800 Ga0265338_10339654 Ga0265338_103396542 121
215 3300029957 Ga0265324_10048976 Ga0265324_100489762 121
216 3300031235 Ga0265330_10011257 Ga0265330_100112577 121
217 3300031238 Ga0265332_10001674 Ga0265332_1000167411 121
218 3300031239 Ga0265328_10000898 Ga0265328_100008983 121
219 3300031240 Ga0265320_10045024 Ga0265320_100450244 121
220 3300031240 Ga0265320_10184403 Ga0265320_101844032 121
221 3300031241 Ga0265325_10004860 Ga0265325_100048609 121
222 3300031241 Ga0265325_10271998 Ga0265325_102719981 121
223 3300031242 Ga0265329_10002795 Ga0265329_100027953 121
224 3300031242 Ga0265329_10231220 Ga0265329_102312202 121
225 3300031247 Ga0265340_10007370 Ga0265340_100073704 121
226 3300031249 Ga0265339_10006923 Ga0265339_100069232 121
227 3300031249 Ga0265339_10186831 Ga0265339_101868312 121
228 3300031250 Ga0265331_10022946 Ga0265331_100229465 121
229 3300031251 Ga0265327_10004631 Ga0265327_100046315 121
230 3300031344 Ga0265316_10012197 Ga0265316_100121973 121
231 3300031595 Ga0265313_10009890 Ga0265313_100098905 121
232 3300031711 Ga0265314_10026978 Ga0265314_100269787 121
233 3300031711 Ga0265314_10306126 Ga0265314_103061262 121
234 3300031712 Ga0265342_10019024 Ga0265342_100190247 121
235 3300031712 Ga0265342_10220014 Ga0265342_102200142 121
236 3300031852 Ga0307410_10335157 Ga0307410_103351572 121
237 3300031901 Ga0307406_10249536 Ga0307406_102495362 121
238 3300031995 Ga0307409_101788781 Ga0307409_1017887811 121
239 3300035089 Ga0373944_0036426 Ga0373944_0036426_959_1330 121
240 3300035113 Ga0373936_0002175 Ga0373936_0002175_2644_3015 121
241 3300035116 Ga0373945_0053688 Ga0373945_0053688_360_731 121
242 3300035119 Ga0373956_0624241 Ga0373956_0624241_15_389 121
243 3300035170 Ga0373943_0045871 Ga0373943_0045871_1309_1680 121
244 3300035172 Ga0373955_0202961 Ga0373955_0202961_750_1124 121
245 3300035410 Ga0373924_0137809 Ga0373924_0137809_366_740 121
246 3300035692 Ga0373935_0263577 Ga0373935_0263577_564_935 121
247 3300035695 Ga0373927_0483850 Ga0373927_0483850_145_516 121
248 3300035724 Ga0373933_0052021 Ga0373933_0052021_388_762 121
249 3300035725 Ga0373947_0006531 Ga0373947_0006531_3529_3900 121
250 3300036401 Ga0373937_0053415 Ga0373937_0053415_30_404 121
251 3300037068 Ga0373925_0010265 Ga0373925_0010265_6159_6530 121
252 3300037312 Ga0395899_0416579 Ga0395899_0416579_466_837 121
253 3300037471 Ga0395905_1907011 Ga0395905_1907011_117_488 121
254 3300038443 Ga0395901_1241643 Ga0395901_1241643_61_432 121
255 3300039437 Ga0436365_1713197 Ga0436365_1713197_215_595 121
256 3300039450 Ga0436363_0904841 Ga0436363_0904841_125_505 121
257 3300044684 Ga0466966_0002628 Ga0466966_0002628_5753_6118 121
258 3300044684 Ga0466966_0185510 Ga0466966_0185510_223_588 121
259 3300044693 Ga0466961_0002298 Ga0466961_0002298_4914_5279 121
260 3300044694 Ga0466963_0002261 Ga0466963_0002261_1315_1680 121
261 3300044694 Ga0466963_0022468 Ga0466963_0022468_1101_1469 121
262 3300044694 Ga0466963_0110438 Ga0466963_0110438_288_653 121
263 3300044694 Ga0466963_0257392 Ga0466963_0257392_446_817 121
264 3300044706 Ga0466964_0095056 Ga0466964_0095056_741_1112 121
265 3300044719 Ga0466971_0000910 Ga0466971_0000910_9154_9519 121
266 3300044842 Ga0466957_0000349 Ga0466957_0000349_14445_14810 121
267 3300044842 Ga0466957_0435123 Ga0466957_0435123_287_658 121
268 3300045049 Ga0466959_0000435 Ga0466959_0000435_2062_2427 121
269 3300045049 Ga0466959_0013400 Ga0466959_0013400_5061_5426 121
270 3300045049 Ga0466959_0750195 Ga0466959_0750195_174_539 121
271 3300045836 Ga0466958_0007727 Ga0466958_0007727_1775_2140 121
272 3300045976 Ga0466967_0000265 Ga0466967_0000265_9522_9887 121
273 3300045976 Ga0466967_0000781 Ga0466967_0000781_16149_16520 121
274 3300045976 Ga0466967_0014620 Ga0466967_0014620_4804_5175 121
275 3300045976 Ga0466967_0015693 Ga0466967_0015693_3986_4357 121
276 3300045976 Ga0466967_0021416 Ga0466967_0021416_3570_3938 121
277 3300045976 Ga0466967_0058281 Ga0466967_0058281_1178_1549 121
278 3300045976 Ga0466967_0615907 Ga0466967_0615907_383_751 121
279 3300045976 Ga0466967_1045234 Ga0466967_1045234_367_738 121
280 3300046459 Ga0495629_0275730 Ga0495629_0275730_379_750 121
281 3300046461 Ga0495641_0107746 Ga0495641_0107746_707_1078 121
282 3300046461 Ga0495641_0425669 Ga0495641_0425669_26_397 121
283 3300046462 Ga0495651_0151737 Ga0495651_0151737_569_943 121
284 3300046462 Ga0495651_0381103 Ga0495651_0381103_450_824 121
285 3300046463 Ga0495653_0961513 Ga0495653_0961513_24_395 121
286 3300046475 Ga0495639_0099624 Ga0495639_0099624_346_717 121
287 3300046477 Ga0495664_0183925 Ga0495664_0183925_665_1036 121
288 3300046511 Ga0495608_0023600 Ga0495608_0023600_2764_3138 121
289 3300046516 Ga0495628_0478322 Ga0495628_0478322_121_492 121
290 3300046517 Ga0495630_0023500 Ga0495630_0023500_3774_4145 121
291 3300046559 Ga0495667_0050896 Ga0495667_0050896_1245_1619 121
292 3300046642 Ga0495634_0065766 Ga0495634_0065766_138_512 121
293 3300046663 Ga0495635_0151199 Ga0495635_0151199_1194_1568 121
294 3300046675 Ga0495657_0071504 Ga0495657_0071504_816_1190 121
295 3300046675 Ga0495657_0095709 Ga0495657_0095709_638_1009 121
296 3300046683 Ga0495658_0007224 Ga0495658_0007224_1735_2106 121
297 3300046689 Ga0495613_0169117 Ga0495613_0169117_90_464 121
298 3300046809 Ga0495600_0058724 Ga0495600_0058724_915_1289 121
299 3300047315 Ga0495581_0536245 Ga0495581_0536245_88_459 121
300 3300047315 Ga0495581_0872471 Ga0495581_0872471_117_488 121
301 3300047317 Ga0495604_0387400 Ga0495604_0387400_522_896 121
302 3300047319 Ga0495674_0432494 Ga0495674_0432494_656_1027 121
303 3300047321 Ga0495676_0208900 Ga0495676_0208900_132_503 121
304 3300047322 Ga0495680_0003274 Ga0495680_0003274_13471_13845 121
305 3300047444 Ga0495675_0290220 Ga0495675_0290220_562_936 121
306 3300047471 Ga0495684_0020392 Ga0495684_0020392_3446_3820 121
307 3300048088 Ga0495602_0474423 Ga0495602_0474423_350_724 121
308 3300048912 Ga0496109_0569398 Ga0496109_0569398_407_778 121
309 3300048915 Ga0496112_0454903 Ga0496112_0454903_145_516 121
310 3300048918 Ga0496115_0610758 Ga0496115_0610758_334_702 121
311 3300049568 Ga0501031_0004013 Ga0501031_0004013_1951_2322 121
312 3300049568 Ga0501031_0011292 Ga0501031_0011292_832_1209 121
313 3300049569 Ga0501032_0035558 Ga0501032_0035558_2539_2916 121
314 3300049569 Ga0501032_0137322 Ga0501032_0137322_113_484 121
315 3300049570 Ga0501033_0027299 Ga0501033_0027299_1484_1855 121
316 3300049570 Ga0501033_0113835 Ga0501033_0113835_1105_1482 121
317 3300049572 Ga0501036_0000261 Ga0501036_0000261_27038_27409 121
318 3300049572 Ga0501036_0005893 Ga0501036_0005893_5372_5749 121
319 3300049573 Ga0501037_0026288 Ga0501037_0026288_381_752 121
320 3300049573 Ga0501037_0325890 Ga0501037_0325890_258_635 121
321 3300049574 Ga0501038_0023050 Ga0501038_0023050_1210_1587 121
322 3300049574 Ga0501038_0081648 Ga0501038_0081648_1446_1817 121
323 3300049575 Ga0501039_0011079 Ga0501039_0011079_3338_3709 121
324 3300049575 Ga0501039_0165654 Ga0501039_0165654_461_832 121
325 3300049575 Ga0501039_0297433 Ga0501039_0297433_359_736 121
326 3300049576 Ga0501040_0000344 Ga0501040_0000344_13047_13418 121
327 3300049576 Ga0501040_0013668 Ga0501040_0013668_495_872 121
328 3300049577 Ga0501041_0001411 Ga0501041_0001411_8205_8576 121
329 3300049577 Ga0501041_0092786 Ga0501041_0092786_1457_1834 121
330 3300049577 Ga0501041_0247781 Ga0501041_0247781_305_676 121
331 3300049578 Ga0501042_0004621 Ga0501042_0004621_8261_8638 121
332 3300049578 Ga0501042_0022168 Ga0501042_0022168_3819_4190 121
333 3300049578 Ga0501042_0209885 Ga0501042_0209885_247_618 121
334 3300049579 Ga0501043_0215405 Ga0501043_0215405_504_875 121
335 3300049580 Ga0501046_0006023 Ga0501046_0006023_7677_8048 121
336 3300049580 Ga0501046_0726374 Ga0501046_0726374_106_477 121
337 3300049582 Ga0501048_0034079 Ga0501048_0034079_2932_3303 121
338 3300049582 Ga0501048_0186287 Ga0501048_0186287_578_949 121
339 3300049582 Ga0501048_0694602 Ga0501048_0694602_298_675 121
340 3300049584 Ga0501068_0010528 Ga0501068_0010528_3841_4212 121
341 3300049585 Ga0501069_0214676 Ga0501069_0214676_449_820 121
342 3300049587 Ga0501071_0013850 Ga0501071_0013850_4283_4654 121
343 3300049587 Ga0501071_0138107 Ga0501071_0138107_211_588 121
344 3300049588 Ga0501072_0008013 Ga0501072_0008013_2819_3190 121
345 3300049588 Ga0501072_0468167 Ga0501072_0468167_581_952 121
346 3300049588 Ga0501072_0587448 Ga0501072_0587448_150_527 121
347 3300049589 Ga0501073_0129538 Ga0501073_0129538_1130_1501 121
348 3300049590 Ga0501074_0016767 Ga0501074_0016767_1020_1391 121
349 3300049590 Ga0501074_0019812 Ga0501074_0019812_1295_1672 121
350 3300049591 Ga0501075_0001217 Ga0501075_0001217_12440_12811 121
351 3300049591 Ga0501075_0159348 Ga0501075_0159348_832_1209 121
352 3300049592 Ga0501076_0000330 Ga0501076_0000330_24807_25178 121
353 3300049592 Ga0501076_0003143 Ga0501076_0003143_2455_2832 121
354 3300049592 Ga0501076_0242116 Ga0501076_0242116_798_1169 121
355 3300049593 Ga0501077_0008570 Ga0501077_0008570_3920_4291 121
356 3300049593 Ga0501077_0014090 Ga0501077_0014090_66_443 121
357 3300049741 Ga0501079_0004782 Ga0501079_0004782_8667_9038 121
358 3300049741 Ga0501079_0015023 Ga0501079_0015023_881_1258 121
359 3300049742 Ga0501080_0153657 Ga0501080_0153657_796_1167 121
360 3300049743 Ga0501081_0001194 Ga0501081_0001194_4970_5341 121
361 3300049743 Ga0501081_0006646 Ga0501081_0006646_6499_6876 121
362 3300049743 Ga0501081_0997088 Ga0501081_0997088_176_547 121
363 3300049744 Ga0501083_0016010 Ga0501083_0016010_3857_4228 121
364 3300049744 Ga0501083_0820310 Ga0501083_0820310_17_394 121
365 3300049822 Ga0501035_0014888 Ga0501035_0014888_3941_4312 121
366 3300049822 Ga0501035_0242717 Ga0501035_0242717_308_679 121
367 3300049822 Ga0501035_0375604 Ga0501035_0375604_65_442 121
368 3300049824 Ga0501045_0000784 Ga0501045_0000784_8774_9145 121
369 3300049824 Ga0501045_0002106 Ga0501045_0002106_2367_2744 121
370 3300049824 Ga0501045_0976966 Ga0501045_0976966_86_457 121
371 3300053077 Ga0495601_0105291 Ga0495601_0105291_792_1163 121
372 3300053084 Ga0495595_0114381 Ga0495595_0114381_837_1208 121
373 3300053084 Ga0495595_0430911 Ga0495595_0430911_115_489 121
374 3300053085 Ga0495619_0050809 Ga0495619_0050809_1301_1675 121
375 3300054114 Ga0501084_0000982 Ga0501084_0000982_14578_14949 121
376 3300054114 Ga0501084_0007211 Ga0501084_0007211_8506_8883 121
377 3300054114 Ga0501084_0152886 Ga0501084_0152886_635_1006 121
378 3300060353 Ga0501082_0035686 Ga0501082_0035686_3290_3661 121
379 3300060353 Ga0501082_0094983 Ga0501082_0094983_399_776 121
380 3300061719 Ga0466962_0004212 Ga0466962_0004212_2396_2761 121
381 3300061734 Ga0530510_0006712 Ga0530510_0006712_2531_2902 121
382 3300061734 Ga0530510_0147608 Ga0530510_0147608_1101_1478 121
383 3300009101 Ga0105247_11220245 Ga0105247_112202452 122
384 3300035121 Ga0373960_0112452 Ga0373960_0112452_94_462 122
385 3300005329 Ga0070683_100004744 Ga0070683_1000047442 123
386 3300005334 Ga0068869_100919399 Ga0068869_1009193992 123
387 3300005336 Ga0070680_100243559 Ga0070680_1002435592 123
388 3300005338 Ga0068868_100144035 Ga0068868_1001440352 123
389 3300005341 Ga0070691_10313981 Ga0070691_103139812 123
390 3300005343 Ga0070687_100531590 Ga0070687_1005315901 123
391 3300005343 Ga0070687_101049616 Ga0070687_1010496161 123
392 3300005353 Ga0070669_101391095 Ga0070669_1013910952 123
393 3300005354 Ga0070675_100778454 Ga0070675_1007784542 123
394 3300005354 Ga0070675_102208542 Ga0070675_1022085421 123
395 3300005355 Ga0070671_100398071 Ga0070671_1003980712 123
396 3300005356 Ga0070674_100185349 Ga0070674_1001853492 123
397 3300005356 Ga0070674_100681019 Ga0070674_1006810192 123
398 3300005366 Ga0070659_100605198 Ga0070659_1006051981 123
399 3300005440 Ga0070705_100468713 Ga0070705_1004687131 123
400 3300005455 Ga0070663_100443280 Ga0070663_1004432801 123
401 3300005456 Ga0070678_100033988 Ga0070678_1000339884 123
402 3300005458 Ga0070681_10074014 Ga0070681_100740143 123
403 3300005530 Ga0070679_100060985 Ga0070679_1000609855 123
404 3300005535 Ga0070684_100000539 Ga0070684_10000053917 123
405 3300005539 Ga0068853_100471069 Ga0068853_1004710692 123
406 3300005544 Ga0070686_101416316 Ga0070686_1014163161 123
407 3300005545 Ga0070695_101754918 Ga0070695_1017549181 123
408 3300005547 Ga0070693_100006379 Ga0070693_1000063792 123
409 3300005548 Ga0070665_100293892 Ga0070665_1002938923 123
410 3300005549 Ga0070704_100097656 Ga0070704_1000976562 123
411 3300005549 Ga0070704_100784041 Ga0070704_1007840411 123
412 3300005564 Ga0070664_100428085 Ga0070664_1004280852 123
413 3300005614 Ga0068856_100281607 Ga0068856_1002816073 123
414 3300005614 Ga0068856_100660002 Ga0068856_1006600022 123
415 3300005615 Ga0070702_100247813 Ga0070702_1002478132 123
416 3300005616 Ga0068852_100597129 Ga0068852_1005971292 123
417 3300005616 Ga0068852_100790140 Ga0068852_1007901402 123
418 3300005617 Ga0068859_102726217 Ga0068859_1027262172 123
419 3300005718 Ga0068866_10103851 Ga0068866_101038512 123
420 3300005719 Ga0068861_100533155 Ga0068861_1005331552 123
421 3300005719 Ga0068861_101112385 Ga0068861_1011123852 123
422 3300005844 Ga0068862_100800780 Ga0068862_1008007802 123
423 3300006038 Ga0075365_10309463 Ga0075365_103094632 123
424 3300006175 Ga0070712_100377024 Ga0070712_1003770242 123
425 3300006175 Ga0070712_100474704 Ga0070712_1004747042 123
426 3300006178 Ga0075367_10401549 Ga0075367_104015492 123
427 3300006237 Ga0097621_100323606 Ga0097621_1003236062 123
428 3300006237 Ga0097621_100424049 Ga0097621_1004240492 123
429 3300006358 Ga0068871_100214961 Ga0068871_1002149612 123
430 3300006358 Ga0068871_100583839 Ga0068871_1005838392 123
431 3300006881 Ga0068865_100667582 Ga0068865_1006675822 123
432 3300006881 Ga0068865_101924277 Ga0068865_1019242771 123
433 3300006914 Ga0075436_100282010 Ga0075436_1002820102 123
434 3300006931 Ga0097620_102727477 Ga0097620_1027274772 123
435 3300007076 Ga0075435_100166819 Ga0075435_1001668192 123
436 3300009094 Ga0111539_10646680 Ga0111539_106466802 123
437 3300009098 Ga0105245_10012899 Ga0105245_100128993 123
438 3300009098 Ga0105245_10041206 Ga0105245_100412064 123
439 3300009098 Ga0105245_10217240 Ga0105245_102172402 123
440 3300009148 Ga0105243_10044497 Ga0105243_100444974 123
441 3300009174 Ga0105241_10590458 Ga0105241_105904582 123
442 3300009176 Ga0105242_10061296 Ga0105242_100612963 123
443 3300009176 Ga0105242_10195039 Ga0105242_101950393 123
444 3300009177 Ga0105248_12600148 Ga0105248_126001481 123
445 3300009553 Ga0105249_11014162 Ga0105249_110141622 123
446 3300009553 Ga0105249_11141045 Ga0105249_111410452 123
447 3300010375 Ga0105239_10178074 Ga0105239_101780743 123
448 3300010375 Ga0105239_11109112 Ga0105239_111091122 123
449 3300010375 Ga0105239_12250842 Ga0105239_122508422 123
450 3300013102 Ga0157371_10177588 Ga0157371_101775882 123
451 3300013296 Ga0157374_11417573 Ga0157374_114175732 123
452 3300013297 Ga0157378_11595705 Ga0157378_115957051 123
453 3300013306 Ga0163162_10219805 Ga0163162_102198052 123
454 3300013307 Ga0157372_11674972 Ga0157372_116749722 123
455 3300013308 Ga0157375_10165490 Ga0157375_101654901 123
456 3300013308 Ga0157375_10724876 Ga0157375_107248761 123
457 3300014325 Ga0163163_11368179 Ga0163163_113681792 123
458 3300014325 Ga0163163_12109044 Ga0163163_121090441 123
459 3300014326 Ga0157380_10765366 Ga0157380_107653662 123
460 3300014968 Ga0157379_10624563 Ga0157379_106245631 123
461 3300014969 Ga0157376_10555571 Ga0157376_105555712 123
462 3300014969 Ga0157376_12308853 Ga0157376_123088531 123
463 3300025899 Ga0207642_10107077 Ga0207642_101070772 123
464 3300025901 Ga0207688_10049842 Ga0207688_100498423 123
465 3300025901 Ga0207688_10859823 Ga0207688_108598232 123
466 3300025912 Ga0207707_10009006 Ga0207707_100090063 123
467 3300025915 Ga0207693_10326465 Ga0207693_103264652 123
468 3300025917 Ga0207660_10323497 Ga0207660_103234972 123
469 3300025918 Ga0207662_10272065 Ga0207662_102720652 123
470 3300025919 Ga0207657_10421509 Ga0207657_104215092 123
471 3300025919 Ga0207657_10455941 Ga0207657_104559412 123
472 3300025921 Ga0207652_10074730 Ga0207652_100747304 123
473 3300025923 Ga0207681_11024055 Ga0207681_110240552 123
474 3300025924 Ga0207694_10671161 Ga0207694_106711612 123
475 3300025926 Ga0207659_10168850 Ga0207659_101688503 123
476 3300025926 Ga0207659_11815606 Ga0207659_118156062 123
477 3300025927 Ga0207687_10152821 Ga0207687_101528212 123
478 3300025927 Ga0207687_10281477 Ga0207687_102814772 123
479 3300025927 Ga0207687_10341137 Ga0207687_103411372 123
480 3300025932 Ga0207690_10415765 Ga0207690_104157652 123
481 3300025934 Ga0207686_10172850 Ga0207686_101728502 123
482 3300025934 Ga0207686_10402221 Ga0207686_104022211 123
483 3300025935 Ga0207709_10032476 Ga0207709_100324763 123
484 3300025936 Ga0207670_10723085 Ga0207670_107230852 123
485 3300025937 Ga0207669_10532358 Ga0207669_105323582 123
486 3300025937 Ga0207669_10539968 Ga0207669_105399682 123
487 3300025940 Ga0207691_10269009 Ga0207691_102690093 123
488 3300025941 Ga0207711_10817060 Ga0207711_108170602 123
489 3300025941 Ga0207711_11474236 Ga0207711_114742362 123
490 3300025941 Ga0207711_11619844 Ga0207711_116198441 123
491 3300025942 Ga0207689_10591332 Ga0207689_105913322 123
492 3300025942 Ga0207689_11024206 Ga0207689_110242062 123
493 3300025944 Ga0207661_10003566 Ga0207661_100035662 123
494 3300025944 Ga0207661_10660464 Ga0207661_106604642 123
495 3300025945 Ga0207679_10384033 Ga0207679_103840332 123
496 3300025945 Ga0207679_11312566 Ga0207679_113125661 123
497 3300025960 Ga0207651_10294711 Ga0207651_102947112 123
498 3300025961 Ga0207712_10337323 Ga0207712_103373231 123
499 3300025961 Ga0207712_10989628 Ga0207712_109896282 123
500 3300025961 Ga0207712_11006006 Ga0207712_110060061 123
501 3300025981 Ga0207640_10305509 Ga0207640_103055092 123
502 3300025986 Ga0207658_11039433 Ga0207658_110394331 123
503 3300026023 Ga0207677_10130773 Ga0207677_101307732 123
504 3300026023 Ga0207677_10563192 Ga0207677_105631922 123
505 3300026041 Ga0207639_10467369 Ga0207639_104673692 123
506 3300026075 Ga0207708_10243492 Ga0207708_102434922 123
507 3300026078 Ga0207702_10990978 Ga0207702_109909782 123
508 3300026118 Ga0207675_100559259 Ga0207675_1005592592 123
509 3300026118 Ga0207675_100847934 Ga0207675_1008479342 123
510 3300026121 Ga0207683_10033247 Ga0207683_100332472 123
511 3300026142 Ga0207698_10849935 Ga0207698_108499352 123
512 3300026142 Ga0207698_11825483 Ga0207698_118254831 123
513 3300028381 Ga0268264_10961134 Ga0268264_109611341 123
514 3300035170 Ga0373943_0045170 Ga0373943_0045170_309_683 123
515 3300035171 Ga0373946_0235138 Ga0373946_0235138_180_554 123
516 3300035725 Ga0373947_0295939 Ga0373947_0295939_320_694 123
517 3300037312 Ga0395899_0023348 Ga0395899_0023348_4179_4559 123
518 3300037418 Ga0395900_0628158 Ga0395900_0628158_455_835 123
519 3300037466 Ga0395898_0014525 Ga0395898_0014525_5186_5566 123
520 3300037471 Ga0395905_0070140 Ga0395905_0070140_89_469 123
521 3300037471 Ga0395905_0661994 Ga0395905_0661994_89_463 123
522 3300038443 Ga0395901_0518662 Ga0395901_0518662_263_637 123
523 3300041460 Ga0451802_0683445 Ga0451802_0683445_340_714 123
524 3300041512 Ga0451853_0962046 Ga0451853_0962046_59_433 123
525 3300042001 Ga0439441_023784 Ga0439441_023784_162_539 123
526 3300042008 Ga0439450_061542 Ga0439450_061542_406_783 123
527 3300042119 Ga0450915_015225 Ga0450915_015225_43_420 123
528 3300046455 Ga0495603_0051258 Ga0495603_0051258_1411_1785 123
529 3300046455 Ga0495603_0436176 Ga0495603_0436176_33_407 123
530 3300046459 Ga0495629_0015277 Ga0495629_0015277_2922_3296 123
531 3300046461 Ga0495641_0130355 Ga0495641_0130355_237_611 123
532 3300046491 Ga0495584_0187884 Ga0495584_0187884_305_679 123
533 3300046517 Ga0495630_0528620 Ga0495630_0528620_462_836 123
534 3300046642 Ga0495634_0067785 Ga0495634_0067785_803_1177 123
535 3300046674 Ga0495588_0436242 Ga0495588_0436242_32_406 123
536 3300046681 Ga0495647_0218484 Ga0495647_0218484_456_830 123
537 3300046683 Ga0495658_0473699 Ga0495658_0473699_261_635 123
538 3300046689 Ga0495613_0011876 Ga0495613_0011876_5821_6195 123
539 3300048903 Ga0496100_0029557 Ga0496100_0029557_2846_3244 123
540 3300048903 Ga0496100_0101088 Ga0496100_0101088_930_1304 123
541 3300048904 Ga0496101_0023532 Ga0496101_0023532_2051_2425 123
542 3300048904 Ga0496101_0024266 Ga0496101_0024266_3639_4013 123
543 3300048904 Ga0496101_0137026 Ga0496101_0137026_892_1266 123
544 3300048904 Ga0496101_0334281 Ga0496101_0334281_322_696 123
545 3300048905 Ga0496102_0019711 Ga0496102_0019711_116_490 123
546 3300048905 Ga0496102_0082066 Ga0496102_0082066_988_1386 123
547 3300048905 Ga0496102_0126921 Ga0496102_0126921_1529_1903 123
548 3300048905 Ga0496102_0318292 Ga0496102_0318292_248_622 123
549 3300048905 Ga0496102_0335188 Ga0496102_0335188_548_922 123
550 3300048906 Ga0496103_0104386 Ga0496103_0104386_253_651 123
551 3300048906 Ga0496103_0193328 Ga0496103_0193328_694_1068 123
552 3300048907 Ga0496104_0000319 Ga0496104_0000319_31106_31480 123
553 3300048907 Ga0496104_0607734 Ga0496104_0607734_499_873 123
554 3300048907 Ga0496104_0851558 Ga0496104_0851558_84_458 123
555 3300048907 Ga0496104_0997379 Ga0496104_0997379_352_726 123
556 3300048908 Ga0496105_0000194 Ga0496105_0000194_25396_25770 123
557 3300048908 Ga0496105_0156256 Ga0496105_0156256_1315_1689 123
558 3300048908 Ga0496105_0740634 Ga0496105_0740634_75_449 123
559 3300048908 Ga0496105_1313953 Ga0496105_1313953_36_410 123
560 3300048909 Ga0496106_0241093 Ga0496106_0241093_48_422 123
561 3300048910 Ga0496107_0024981 Ga0496107_0024981_2295_2669 123
562 3300048910 Ga0496107_0187715 Ga0496107_0187715_333_707 123
563 3300048910 Ga0496107_0565479 Ga0496107_0565479_313_687 123
564 3300048911 Ga0496108_0000971 Ga0496108_0000971_14995_15369 123
565 3300048911 Ga0496108_0296482 Ga0496108_0296482_1004_1378 123
566 3300048911 Ga0496108_1263181 Ga0496108_1263181_101_475 123
567 3300048912 Ga0496109_0000458 Ga0496109_0000458_26340_26714 123
568 3300048912 Ga0496109_0050601 Ga0496109_0050601_1750_2124 123
569 3300048912 Ga0496109_0381927 Ga0496109_0381927_235_609 123
570 3300048913 Ga0496110_0002903 Ga0496110_0002903_7332_7706 123
571 3300048913 Ga0496110_0010229 Ga0496110_0010229_6797_7171 123
572 3300048913 Ga0496110_0239912 Ga0496110_0239912_893_1267 123
573 3300048914 Ga0496111_0034631 Ga0496111_0034631_1132_1506 123
574 3300048914 Ga0496111_0137652 Ga0496111_0137652_801_1175 123
575 3300048914 Ga0496111_0496374 Ga0496111_0496374_62_436 123
576 3300048915 Ga0496112_0372830 Ga0496112_0372830_838_1212 123
577 3300048915 Ga0496112_0936647 Ga0496112_0936647_384_758 123
578 3300048916 Ga0496113_0089594 Ga0496113_0089594_1760_2134 123
579 3300048916 Ga0496113_0172567 Ga0496113_0172567_1294_1668 123
580 3300048916 Ga0496113_0813216 Ga0496113_0813216_58_432 123
581 3300048917 Ga0496114_0000510 Ga0496114_0000510_28069_28443 123
582 3300048917 Ga0496114_0004175 Ga0496114_0004175_10567_10941 123
583 3300048917 Ga0496114_0050597 Ga0496114_0050597_2126_2500 123
584 3300048917 Ga0496114_0103213 Ga0496114_0103213_819_1193 123
585 3300048918 Ga0496115_0073089 Ga0496115_0073089_960_1358 123
586 3300048918 Ga0496115_0388241 Ga0496115_0388241_140_514 123
587 3300048918 Ga0496115_0771195 Ga0496115_0771195_47_421 123
588 3300049576 Ga0501040_0134327 Ga0501040_0134327_647_1021 123
589 3300049580 Ga0501046_0796298 Ga0501046_0796298_165_539 123
590 3300049582 Ga0501048_0712095 Ga0501048_0712095_92_466 123
591 3300049584 Ga0501068_0141766 Ga0501068_0141766_178_552 123
592 3300049593 Ga0501077_0376351 Ga0501077_0376351_406_780 123
593 3300049743 Ga0501081_0025578 Ga0501081_0025578_1488_1862 123
594 3300050490 nmdc:mga03n38_764770_c1 nmdc:mga03n38_764770_c1_130_504 123
595 3300050492 nmdc:mga0yw44_298610_c1 nmdc:mga0yw44_298610_c1_269_643 123
596 3300050494 nmdc:mga06z11_421127_c1 nmdc:mga06z11_421127_c1_285_659 123
597 3300050511 nmdc:mga08y16_960391_c1 nmdc:mga08y16_960391_c1_418_792 123
598 3300050513 nmdc:mga0rr50_178194_c1 nmdc:mga0rr50_178194_c1_830_1204 123
599 3300050513 nmdc:mga0rr50_238276_c1 nmdc:mga0rr50_238276_c1_1018_1392 123
600 3300054114 Ga0501084_0079394 Ga0501084_0079394_425_799 123
601 3300060353 Ga0501082_0015919 Ga0501082_0015919_5661_6035 123
602 3300005336 Ga0070680_101846063 Ga0070680_1018460631 124
603 3300005436 Ga0070713_101038896 Ga0070713_1010388962 124
604 3300005530 Ga0070679_100721614 Ga0070679_1007216141 124
605 3300006163 Ga0070715_10006063 Ga0070715_100060632 124
606 3300006175 Ga0070712_100148143 Ga0070712_1001481431 124
607 3300013296 Ga0157374_10345845 Ga0157374_103458453 124
608 3300025905 Ga0207685_10028113 Ga0207685_100281132 124
609 3300025917 Ga0207660_11244943 Ga0207660_112449431 124
610 3300025921 Ga0207652_10789797 Ga0207652_107897972 124
611 3300042005 Ga0439448_0037808 Ga0439448_0037808_295_681 124
612 3300044842 Ga0466957_0044788 Ga0466957_0044788_1248_1625 124
613 3300044901 Ga0466960_0114570 Ga0466960_0114570_777_1157 124
614 3300045976 Ga0466967_0187637 Ga0466967_0187637_1519_1896 124
615 3300048903 Ga0496100_0084589 Ga0496100_0084589_1368_1766 124
616 3300048904 Ga0496101_0022064 Ga0496101_0022064_969_1367 124
617 3300048905 Ga0496102_0905256 Ga0496102_0905256_259_657 124
618 3300048909 Ga0496106_0023028 Ga0496106_0023028_810_1208 124
619 3300048910 Ga0496107_0009958 Ga0496107_0009958_5670_6068 124
620 3300003373 JGI25407J50210_10003190 JGI25407J50210_100031904 125
621 3300005981 Ga0081538_10000809 Ga0081538_1000080916 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

1

99

0.9

PF08211

dCMP_cyt_deam_2

Cytidine and deoxycytidylate deaminase zinc-binding region

1

76

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d30-assembly1.cif.gz_A crystal structure of cytidine deaminase cdd-2 (ba4525) from bacillus anthracis at 2.40a resolution 0.8989 6 120
1mq0-assembly1.cif.gz_A crystal structure of human cytidine deaminase 0.8895 5 121
3dmo-assembly1.cif.gz_C 1.6 a crystal structure of cytidine deaminase from burkholderia pseudomallei 0.8864 1 121
1jtk-assembly1.cif.gz_A crystal structure of cytidine deaminase from bacillus subtilis in complex with the inhibitor tetrahydrodeoxyuridine 0.8846 6 122
1ux0-assembly1.cif.gz_B-2 bacillus subtilis cytidine deaminase with an arg56 - gln substitution 0.8838 6 122
ID Description Score Start End Superfamily
af_R4GEK6_29_122_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9613 28 43 2.60.40.10
af_F4KH86_156_399_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9154 76 103 3.40.140.10
af_Q4D5I0_402_512_3.30.1490.100 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain 0.8811 28 43 3.30.1490.100
4eg2C02 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.869 1 79 3.40.140.10
af_Q2FY04_3_129_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8625 1 122 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A538EGM8-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) 0.9595 1 125 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A7W0PZU2-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) 0.9537 1 123 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A353HWN1-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase) 0.9523 7 94 GO:0004126
GO:0005829
GO:0008270
GO:0009972
AF-A0A538EGM8-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) 0.952 1 125 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A538D7I5-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) 0.9489 1 85 GO:0004126
GO:0005829
GO:0008270
GO:0009972

Feature Viewer

pLDDT pTM Quality
94.83 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map