F469987
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 621 | 295 | 621 | 124 |
Family's Representative Sequence
| Representative Sequence | 3300005530|Ga0070679_100348204|Ga0070679_1003482042 |
| Length | 143 |
| Sequence | MSELVEKAAAAAANAYAPYSKYNVGAVVRTTDGREFAGVNVENAAYPLGQCAERTAIGAAATAGYRPGDIAAIGINASPCGGCRQWLYEWRIPEVSFRREDGTVATYSAADLLPDTWDLPAGVGSTEPDNGEGAGADGAEAAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 43 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 136 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 137 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 138 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 139 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 140 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 141 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 142 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 145 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 150 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 152 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 155 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 160 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 161 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 162 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 163 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 165 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 174 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 175 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 176 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 185 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 186 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 188 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 189 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 190 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 191 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 192 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 193 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 194 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 195 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 196 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 197 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 198 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 199 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 200 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 201 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 204 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 205 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 206 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 207 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 208 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 284 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 285 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 286 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 293 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 295 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.39 |
| Metatranscriptomes | 1.61 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.81 |
| Nodule | 0 |
| Rhizoplane | 10.95 |
| Rhizosphere | 87.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10003190 | 3300003373 | Bacteria | 3900 |
| 2 | Ga0070658_10244811 | 3300005327 | Bacteria | 1520 |
| 3 | Ga0070658_10258221 | 3300005327 | Bacteria | 1479 |
| 4 | Ga0070683_100004744 | 3300005329 | Bacteria | 11248 |
| 5 | Ga0070683_100093616 | 3300005329 | Bacteria | 2823 |
| 6 | Ga0070683_100328744 | 3300005329 | Bacteria | 1455 |
| 7 | Ga0070683_100746731 | 3300005329 | Bacteria | 937 |
| 8 | Ga0068869_100919399 | 3300005334 | Bacteria | 758 |
| 9 | Ga0070680_100216681 | 3300005336 | Bacteria | 1615 |
| 10 | Ga0070680_100243559 | 3300005336 | Bacteria | 1520 |
| 11 | Ga0070680_100604099 | 3300005336 | Bacteria | 942 |
| 12 | Ga0070680_101846063 | 3300005336 | Bacteria | 524 |
| 13 | Ga0070682_100051110 | 3300005337 | Bacteria | 2582 |
| 14 | Ga0070682_100087692 | 3300005337 | Bacteria | 2029 |
| 15 | Ga0068868_100144035 | 3300005338 | Bacteria | 1958 |
| 16 | Ga0070660_100001227 | 3300005339 | Bacteria | 17435 |
| 17 | Ga0070660_100064925 | 3300005339 | Bacteria | 2841 |
| 18 | Ga0070660_100160434 | 3300005339 | Bacteria | 1812 |
| 19 | Ga0070660_100224027 | 3300005339 | Bacteria | 1529 |
| 20 | Ga0070660_100274547 | 3300005339 | Bacteria | 1378 |
| 21 | Ga0070691_10313981 | 3300005341 | Bacteria | 860 |
| 22 | Ga0070691_10477961 | 3300005341 | Unclassified | 716 |
| 23 | Ga0070687_100531590 | 3300005343 | Bacteria | 797 |
| 24 | Ga0070687_101049616 | 3300005343 | Bacteria | 593 |
| 25 | Ga0070661_100005972 | 3300005344 | Bacteria | 8382 |
| 26 | Ga0070661_100011452 | 3300005344 | Bacteria | 6178 |
| 27 | Ga0070661_100021829 | 3300005344 | Bacteria | 4579 |
| 28 | Ga0070669_101391095 | 3300005353 | Bacteria | 609 |
| 29 | Ga0070675_100778454 | 3300005354 | Bacteria | 874 |
| 30 | Ga0070675_102208542 | 3300005354 | Bacteria | 507 |
| 31 | Ga0070671_100398071 | 3300005355 | Bacteria | 1178 |
| 32 | Ga0070674_100185349 | 3300005356 | Bacteria | 1597 |
| 33 | Ga0070674_100681019 | 3300005356 | Bacteria | 877 |
| 34 | Ga0070659_100015315 | 3300005366 | Bacteria | 5742 |
| 35 | Ga0070659_100605198 | 3300005366 | Bacteria | 942 |
| 36 | Ga0070659_101799714 | 3300005366 | Bacteria | 548 |
| 37 | Ga0070709_10101218 | 3300005434 | Bacteria | 1920 |
| 38 | Ga0070709_10314920 | 3300005434 | Bacteria | 1147 |
| 39 | Ga0070713_101038896 | 3300005436 | Unclassified | 791 |
| 40 | Ga0070713_101135743 | 3300005436 | Bacteria | 755 |
| 41 | Ga0070705_100468713 | 3300005440 | Bacteria | 949 |
| 42 | Ga0070663_100443280 | 3300005455 | Bacteria | 1069 |
| 43 | Ga0070678_100033988 | 3300005456 | Bacteria | 3546 |
| 44 | Ga0070681_10003001 | 3300005458 | Bacteria | 15664 |
| 45 | Ga0070681_10008477 | 3300005458 | Bacteria | 10064 |
| 46 | Ga0070681_10074014 | 3300005458 | Bacteria | 3368 |
| 47 | Ga0070681_10277886 | 3300005458 | Bacteria | 1586 |
| 48 | Ga0070679_100023955 | 3300005530 | Bacteria | 5981 |
| 49 | Ga0070679_100060985 | 3300005530 | Bacteria | 3759 |
| 50 | Ga0070679_100262126 | 3300005530 | Bacteria | 1683 |
| 51 | Ga0070679_100348204 | 3300005530 | Bacteria | 1429 |
| 52 | Ga0070679_100523621 | 3300005530 | Bacteria | 1129 |
| 53 | Ga0070679_100721614 | 3300005530 | Bacteria | 939 |
| 54 | Ga0070684_100000539 | 3300005535 | Bacteria | 26027 |
| 55 | Ga0070684_100050016 | 3300005535 | Bacteria | 3629 |
| 56 | Ga0070684_100094686 | 3300005535 | Bacteria | 2660 |
| 57 | Ga0070684_100178815 | 3300005535 | Bacteria | 1928 |
| 58 | Ga0070684_100578051 | 3300005535 | Bacteria | 1044 |
| 59 | Ga0068853_100071494 | 3300005539 | Bacteria | 3021 |
| 60 | Ga0068853_100471069 | 3300005539 | Bacteria | 1183 |
| 61 | Ga0068853_100898304 | 3300005539 | Bacteria | 851 |
| 62 | Ga0068853_102192928 | 3300005539 | Bacteria | 536 |
| 63 | Ga0070686_101416316 | 3300005544 | Bacteria | 584 |
| 64 | Ga0070695_101754918 | 3300005545 | Bacteria | 520 |
| 65 | Ga0070696_101011454 | 3300005546 | Bacteria | 695 |
| 66 | Ga0070693_100006379 | 3300005547 | Bacteria | 5719 |
| 67 | Ga0070665_100004675 | 3300005548 | Bacteria | 14290 |
| 68 | Ga0070665_100293892 | 3300005548 | Bacteria | 1627 |
| 69 | Ga0070704_100097656 | 3300005549 | Bacteria | 2205 |
| 70 | Ga0070704_100784041 | 3300005549 | Unclassified | 851 |
| 71 | Ga0068855_100005572 | 3300005563 | Bacteria | 15363 |
| 72 | Ga0068855_100008007 | 3300005563 | Bacteria | 12765 |
| 73 | Ga0068855_100228049 | 3300005563 | Bacteria | 2087 |
| 74 | Ga0068855_100351036 | 3300005563 | Bacteria | 1625 |
| 75 | Ga0068855_100352576 | 3300005563 | Bacteria | 1621 |
| 76 | Ga0070664_100428085 | 3300005564 | Bacteria | 1213 |
| 77 | Ga0068857_100067465 | 3300005577 | Bacteria | 3184 |
| 78 | Ga0068856_100025011 | 3300005614 | Bacteria | 5819 |
| 79 | Ga0068856_100028973 | 3300005614 | Bacteria | 5410 |
| 80 | Ga0068856_100281607 | 3300005614 | Bacteria | 1679 |
| 81 | Ga0068856_100660002 | 3300005614 | Bacteria | 1066 |
| 82 | Ga0068856_100700949 | 3300005614 | Bacteria | 1033 |
| 83 | Ga0070702_100247813 | 3300005615 | Bacteria | 1206 |
| 84 | Ga0068852_100006341 | 3300005616 | Bacteria | 8536 |
| 85 | Ga0068852_100597129 | 3300005616 | Bacteria | 1108 |
| 86 | Ga0068852_100790140 | 3300005616 | Bacteria | 963 |
| 87 | Ga0068859_102726217 | 3300005617 | Bacteria | 543 |
| 88 | Ga0068866_10103851 | 3300005718 | Bacteria | 1573 |
| 89 | Ga0068861_100533155 | 3300005719 | Bacteria | 1067 |
| 90 | Ga0068861_101112385 | 3300005719 | Bacteria | 760 |
| 91 | Ga0068862_100800780 | 3300005844 | Bacteria | 920 |
| 92 | Ga0081538_10000809 | 3300005981 | Bacteria | 33947 |
| 93 | Ga0075365_10309463 | 3300006038 | Bacteria | 1112 |
| 94 | Ga0070715_10006063 | 3300006163 | Bacteria | 4081 |
| 95 | Ga0070712_100148143 | 3300006175 | Bacteria | 1799 |
| 96 | Ga0070712_100377024 | 3300006175 | Bacteria | 1167 |
| 97 | Ga0070712_100474704 | 3300006175 | Bacteria | 1045 |
| 98 | Ga0070712_100822167 | 3300006175 | Bacteria | 798 |
| 99 | Ga0075367_10401549 | 3300006178 | Bacteria | 867 |
| 100 | Ga0097621_100323606 | 3300006237 | Bacteria | 1366 |
| 101 | Ga0097621_100424049 | 3300006237 | Bacteria | 1194 |
| 102 | Ga0068871_100214961 | 3300006358 | Bacteria | 1664 |
| 103 | Ga0068871_100583839 | 3300006358 | Bacteria | 1015 |
| 104 | Ga0068865_100667582 | 3300006881 | Bacteria | 885 |
| 105 | Ga0068865_101924277 | 3300006881 | Bacteria | 536 |
| 106 | Ga0075436_100282010 | 3300006914 | Bacteria | 1188 |
| 107 | Ga0097620_102727477 | 3300006931 | Bacteria | 543 |
| 108 | Ga0075435_100166819 | 3300007076 | Bacteria | 1857 |
| 109 | Ga0105240_10061243 | 3300009093 | Bacteria | 4690 |
| 110 | Ga0105240_10291542 | 3300009093 | Bacteria | 1870 |
| 111 | Ga0111539_10646680 | 3300009094 | Bacteria | 1231 |
| 112 | Ga0105245_10012899 | 3300009098 | Bacteria | 7284 |
| 113 | Ga0105245_10041206 | 3300009098 | Bacteria | 4117 |
| 114 | Ga0105245_10217240 | 3300009098 | Bacteria | 1843 |
| 115 | Ga0105247_11220245 | 3300009101 | Bacteria | 600 |
| 116 | Ga0105243_10044497 | 3300009148 | Bacteria | 3483 |
| 117 | Ga0105241_10590458 | 3300009174 | Bacteria | 1002 |
| 118 | Ga0105241_11550452 | 3300009174 | Bacteria | 639 |
| 119 | Ga0105242_10061296 | 3300009176 | Bacteria | 3094 |
| 120 | Ga0105242_10195039 | 3300009176 | Bacteria | 1795 |
| 121 | Ga0105248_12600148 | 3300009177 | Bacteria | 577 |
| 122 | Ga0105237_10028148 | 3300009545 | Bacteria | 5727 |
| 123 | Ga0105237_12693965 | 3300009545 | Unclassified | 508 |
| 124 | Ga0105238_10207211 | 3300009551 | Bacteria | 1937 |
| 125 | Ga0105249_11014162 | 3300009553 | Bacteria | 899 |
| 126 | Ga0105249_11141045 | 3300009553 | Bacteria | 850 |
| 127 | Ga0105239_10178074 | 3300010375 | Bacteria | 2378 |
| 128 | Ga0105239_11109112 | 3300010375 | Bacteria | 911 |
| 129 | Ga0105239_11206563 | 3300010375 | Bacteria | 872 |
| 130 | Ga0105239_12250842 | 3300010375 | Bacteria | 634 |
| 131 | Ga0157373_10188324 | 3300013100 | Bacteria | 1454 |
| 132 | Ga0157371_10047405 | 3300013102 | Bacteria | 3055 |
| 133 | Ga0157371_10177588 | 3300013102 | Bacteria | 1522 |
| 134 | Ga0157370_10025745 | 3300013104 | Bacteria | 5820 |
| 135 | Ga0157370_10083856 | 3300013104 | Bacteria | 2996 |
| 136 | Ga0157370_10330492 | 3300013104 | Bacteria | 1406 |
| 137 | Ga0157370_11052768 | 3300013104 | Unclassified | 736 |
| 138 | Ga0157369_10006969 | 3300013105 | Bacteria | 13031 |
| 139 | Ga0157369_10062629 | 3300013105 | Bacteria | 4008 |
| 140 | Ga0157369_10201157 | 3300013105 | Bacteria | 2091 |
| 141 | Ga0157369_10220231 | 3300013105 | Bacteria | 1987 |
| 142 | Ga0157374_10345845 | 3300013296 | Bacteria | 1477 |
| 143 | Ga0157374_11417573 | 3300013296 | Bacteria | 717 |
| 144 | Ga0157378_11595705 | 3300013297 | Bacteria | 698 |
| 145 | Ga0163162_10219805 | 3300013306 | Bacteria | 2030 |
| 146 | Ga0157372_10026405 | 3300013307 | Bacteria | 6320 |
| 147 | Ga0157372_10076616 | 3300013307 | Bacteria | 3776 |
| 148 | Ga0157372_10447418 | 3300013307 | Bacteria | 1506 |
| 149 | Ga0157372_11465941 | 3300013307 | Unclassified | 786 |
| 150 | Ga0157372_11674972 | 3300013307 | Bacteria | 732 |
| 151 | Ga0157375_10165490 | 3300013308 | Bacteria | 2356 |
| 152 | Ga0157375_10724876 | 3300013308 | Bacteria | 1147 |
| 153 | Ga0163163_11368179 | 3300014325 | Bacteria | 770 |
| 154 | Ga0163163_12109044 | 3300014325 | Bacteria | 623 |
| 155 | Ga0157380_10765366 | 3300014326 | Bacteria | 979 |
| 156 | Ga0157379_10624563 | 3300014968 | Unclassified | 1007 |
| 157 | Ga0157376_10555571 | 3300014969 | Bacteria | 1137 |
| 158 | Ga0157376_12308853 | 3300014969 | Unclassified | 577 |
| 159 | Ga0182006_1065253 | 3300015261 | Bacteria | 1363 |
| 160 | Ga0182007_10185851 | 3300015262 | Bacteria | 720 |
| 161 | Ga0182007_10370163 | 3300015262 | Bacteria | 542 |
| 162 | Ga0197907_10898572 | 3300020069 | Bacteria | 1019 |
| 163 | Ga0197907_11164167 | 3300020069 | Bacteria | 673 |
| 164 | Ga0206356_10772295 | 3300020070 | Bacteria | 547 |
| 165 | Ga0206354_10108151 | 3300020081 | Bacteria | 545 |
| 166 | Ga0206354_10842383 | 3300020081 | Bacteria | 625 |
| 167 | Ga0206354_11481859 | 3300020081 | Bacteria | 1058 |
| 168 | Ga0206353_10039946 | 3300020082 | Bacteria | 1527 |
| 169 | Ga0206353_10567668 | 3300020082 | Bacteria | 1219 |
| 170 | Ga0206353_11608262 | 3300020082 | Bacteria | 1362 |
| 171 | Ga0224712_10103283 | 3300022467 | Bacteria | 1212 |
| 172 | Ga0207642_10107077 | 3300025899 | Bacteria | 1416 |
| 173 | Ga0207710_10542204 | 3300025900 | Bacteria | 606 |
| 174 | Ga0207688_10049842 | 3300025901 | Bacteria | 2342 |
| 175 | Ga0207688_10859823 | 3300025901 | Bacteria | 574 |
| 176 | Ga0207685_10028113 | 3300025905 | Bacteria | 1976 |
| 177 | Ga0207699_10095020 | 3300025906 | Bacteria | 1879 |
| 178 | Ga0207705_10352623 | 3300025909 | Bacteria | 1134 |
| 179 | Ga0207705_11532620 | 3300025909 | Unclassified | 504 |
| 180 | Ga0207654_10138778 | 3300025911 | Bacteria | 1548 |
| 181 | Ga0207654_10748855 | 3300025911 | Bacteria | 704 |
| 182 | Ga0207707_10002237 | 3300025912 | Bacteria | 17490 |
| 183 | Ga0207707_10009006 | 3300025912 | Bacteria | 8670 |
| 184 | Ga0207707_10072257 | 3300025912 | Bacteria | 3007 |
| 185 | Ga0207707_10126302 | 3300025912 | Bacteria | 2237 |
| 186 | Ga0207695_10155311 | 3300025913 | Bacteria | 2223 |
| 187 | Ga0207695_10181083 | 3300025913 | Bacteria | 2028 |
| 188 | Ga0207671_10045482 | 3300025914 | Bacteria | 3246 |
| 189 | Ga0207671_11213255 | 3300025914 | Bacteria | 590 |
| 190 | Ga0207693_10326465 | 3300025915 | Bacteria | 1201 |
| 191 | Ga0207693_10405093 | 3300025915 | Bacteria | 1066 |
| 192 | Ga0207663_10539037 | 3300025916 | Bacteria | 911 |
| 193 | Ga0207663_11144924 | 3300025916 | Bacteria | 626 |
| 194 | Ga0207660_10008381 | 3300025917 | Bacteria | 6686 |
| 195 | Ga0207660_10138108 | 3300025917 | Bacteria | 1861 |
| 196 | Ga0207660_10323497 | 3300025917 | Bacteria | 1232 |
| 197 | Ga0207660_11244943 | 3300025917 | Bacteria | 605 |
| 198 | Ga0207662_10272065 | 3300025918 | Bacteria | 1118 |
| 199 | Ga0207657_10000467 | 3300025919 | Bacteria | 42840 |
| 200 | Ga0207657_10000731 | 3300025919 | Bacteria | 34878 |
| 201 | Ga0207657_10035446 | 3300025919 | Bacteria | 4474 |
| 202 | Ga0207657_10128274 | 3300025919 | Bacteria | 2081 |
| 203 | Ga0207657_10175722 | 3300025919 | Bacteria | 1733 |
| 204 | Ga0207657_10421509 | 3300025919 | Bacteria | 1049 |
| 205 | Ga0207657_10455941 | 3300025919 | Bacteria | 1003 |
| 206 | Ga0207649_10106584 | 3300025920 | Bacteria | 1864 |
| 207 | Ga0207649_10158046 | 3300025920 | Bacteria | 1568 |
| 208 | Ga0207652_10021861 | 3300025921 | Bacteria | 5284 |
| 209 | Ga0207652_10061576 | 3300025921 | Bacteria | 3241 |
| 210 | Ga0207652_10074730 | 3300025921 | Bacteria | 2951 |
| 211 | Ga0207652_10526231 | 3300025921 | Bacteria | 1064 |
| 212 | Ga0207652_10608704 | 3300025921 | Bacteria | 979 |
| 213 | Ga0207652_10756180 | 3300025921 | Bacteria | 865 |
| 214 | Ga0207652_10789797 | 3300025921 | Bacteria | 843 |
| 215 | Ga0207681_11024055 | 3300025923 | Bacteria | 693 |
| 216 | Ga0207694_10119177 | 3300025924 | Bacteria | 2106 |
| 217 | Ga0207694_10671161 | 3300025924 | Bacteria | 874 |
| 218 | Ga0207659_10168850 | 3300025926 | Bacteria | 1724 |
| 219 | Ga0207659_11815606 | 3300025926 | Bacteria | 518 |
| 220 | Ga0207687_10152821 | 3300025927 | Bacteria | 1763 |
| 221 | Ga0207687_10281477 | 3300025927 | Bacteria | 1333 |
| 222 | Ga0207687_10341137 | 3300025927 | Bacteria | 1218 |
| 223 | Ga0207700_10401255 | 3300025928 | Bacteria | 1202 |
| 224 | Ga0207690_10010005 | 3300025932 | Bacteria | 5634 |
| 225 | Ga0207690_10038365 | 3300025932 | Bacteria | 3117 |
| 226 | Ga0207690_10099492 | 3300025932 | Bacteria | 2073 |
| 227 | Ga0207690_10415765 | 3300025932 | Unclassified | 1075 |
| 228 | Ga0207706_10329705 | 3300025933 | Bacteria | 1328 |
| 229 | Ga0207686_10172850 | 3300025934 | Bacteria | 1525 |
| 230 | Ga0207686_10402221 | 3300025934 | Unclassified | 1043 |
| 231 | Ga0207709_10032476 | 3300025935 | Bacteria | 3056 |
| 232 | Ga0207670_10723085 | 3300025936 | Bacteria | 825 |
| 233 | Ga0207669_10532358 | 3300025937 | Bacteria | 945 |
| 234 | Ga0207669_10539968 | 3300025937 | Bacteria | 939 |
| 235 | Ga0207691_10269009 | 3300025940 | Bacteria | 1468 |
| 236 | Ga0207711_10817060 | 3300025941 | Bacteria | 868 |
| 237 | Ga0207711_11474236 | 3300025941 | Bacteria | 623 |
| 238 | Ga0207711_11619844 | 3300025941 | Bacteria | 591 |
| 239 | Ga0207689_10591332 | 3300025942 | Bacteria | 933 |
| 240 | Ga0207689_11024206 | 3300025942 | Bacteria | 696 |
| 241 | Ga0207661_10003566 | 3300025944 | Bacteria | 10821 |
| 242 | Ga0207661_10416106 | 3300025944 | Bacteria | 1220 |
| 243 | Ga0207661_10425529 | 3300025944 | Bacteria | 1206 |
| 244 | Ga0207661_10660464 | 3300025944 | Bacteria | 961 |
| 245 | Ga0207679_10360714 | 3300025945 | Bacteria | 1269 |
| 246 | Ga0207679_10384033 | 3300025945 | Bacteria | 1232 |
| 247 | Ga0207679_11312566 | 3300025945 | Bacteria | 664 |
| 248 | Ga0207667_10027576 | 3300025949 | Bacteria | 6180 |
| 249 | Ga0207667_10287406 | 3300025949 | Bacteria | 1680 |
| 250 | Ga0207667_11870790 | 3300025949 | Bacteria | 563 |
| 251 | Ga0207651_10294711 | 3300025960 | Bacteria | 1347 |
| 252 | Ga0207712_10337323 | 3300025961 | Unclassified | 1249 |
| 253 | Ga0207712_10989628 | 3300025961 | Bacteria | 746 |
| 254 | Ga0207712_11006006 | 3300025961 | Bacteria | 740 |
| 255 | Ga0207640_10305509 | 3300025981 | Unclassified | 1260 |
| 256 | Ga0207658_11039433 | 3300025986 | Bacteria | 748 |
| 257 | Ga0207677_10130773 | 3300026023 | Bacteria | 1905 |
| 258 | Ga0207677_10563192 | 3300026023 | Bacteria | 995 |
| 259 | Ga0207703_10140023 | 3300026035 | Bacteria | 2099 |
| 260 | Ga0207639_10052524 | 3300026041 | Bacteria | 3106 |
| 261 | Ga0207639_10136468 | 3300026041 | Bacteria | 2038 |
| 262 | Ga0207639_10400080 | 3300026041 | Bacteria | 1237 |
| 263 | Ga0207639_10467369 | 3300026041 | Bacteria | 1148 |
| 264 | Ga0207639_11651351 | 3300026041 | Bacteria | 601 |
| 265 | Ga0207678_10430940 | 3300026067 | Bacteria | 1144 |
| 266 | Ga0207708_10243492 | 3300026075 | Bacteria | 1447 |
| 267 | Ga0207702_10476942 | 3300026078 | Bacteria | 1213 |
| 268 | Ga0207702_10990978 | 3300026078 | Bacteria | 834 |
| 269 | Ga0207674_10088605 | 3300026116 | Bacteria | 3087 |
| 270 | Ga0207674_10090008 | 3300026116 | Bacteria | 3060 |
| 271 | Ga0207675_100559259 | 3300026118 | Bacteria | 1144 |
| 272 | Ga0207675_100847934 | 3300026118 | Bacteria | 929 |
| 273 | Ga0207683_10033247 | 3300026121 | Bacteria | 4479 |
| 274 | Ga0207698_10043082 | 3300026142 | Bacteria | 3379 |
| 275 | Ga0207698_10849935 | 3300026142 | Bacteria | 917 |
| 276 | Ga0207698_11825483 | 3300026142 | Bacteria | 623 |
| 277 | Ga0268266_10028962 | 3300028379 | Bacteria | 4706 |
| 278 | Ga0268264_10961134 | 3300028381 | Bacteria | 860 |
| 279 | Ga0265337_1025568 | 3300028556 | Bacteria | 1797 |
| 280 | Ga0265326_10014746 | 3300028558 | Bacteria | 2275 |
| 281 | Ga0265319_1003775 | 3300028563 | Bacteria | 7765 |
| 282 | Ga0265334_10001611 | 3300028573 | Bacteria | 10835 |
| 283 | Ga0265318_10001206 | 3300028577 | Bacteria | 15720 |
| 284 | Ga0265323_10124858 | 3300028653 | Bacteria | 836 |
| 285 | Ga0265322_10013711 | 3300028654 | Bacteria | 2347 |
| 286 | Ga0265336_10025608 | 3300028666 | Bacteria | 1857 |
| 287 | Ga0265336_10130398 | 3300028666 | Bacteria | 748 |
| 288 | Ga0265338_10003587 | 3300028800 | Bacteria | 21674 |
| 289 | Ga0265338_10093645 | 3300028800 | Bacteria | 2474 |
| 290 | Ga0265338_10313819 | 3300028800 | Bacteria | 1136 |
| 291 | Ga0265338_10339654 | 3300028800 | Bacteria | 1082 |
| 292 | Ga0265324_10048976 | 3300029957 | Bacteria | 1453 |
| 293 | Ga0265330_10011257 | 3300031235 | Bacteria | 4200 |
| 294 | Ga0265332_10001674 | 3300031238 | Bacteria | 12107 |
| 295 | Ga0265328_10000898 | 3300031239 | Bacteria | 13766 |
| 296 | Ga0265320_10045024 | 3300031240 | Bacteria | 2169 |
| 297 | Ga0265320_10184403 | 3300031240 | Bacteria | 934 |
| 298 | Ga0265325_10004860 | 3300031241 | Bacteria | 8398 |
| 299 | Ga0265325_10271998 | 3300031241 | Bacteria | 761 |
| 300 | Ga0265329_10002795 | 3300031242 | Bacteria | 7796 |
| 301 | Ga0265329_10231220 | 3300031242 | Bacteria | 613 |
| 302 | Ga0265340_10007370 | 3300031247 | Bacteria | 5974 |
| 303 | Ga0265339_10006923 | 3300031249 | Bacteria | 7382 |
| 304 | Ga0265339_10186831 | 3300031249 | Bacteria | 1029 |
| 305 | Ga0265331_10022946 | 3300031250 | Bacteria | 3177 |
| 306 | Ga0265327_10004631 | 3300031251 | Bacteria | 12068 |
| 307 | Ga0265316_10012197 | 3300031344 | Bacteria | 7712 |
| 308 | Ga0265313_10009890 | 3300031595 | Bacteria | 6130 |
| 309 | Ga0265314_10026978 | 3300031711 | Bacteria | 4307 |
| 310 | Ga0265314_10306126 | 3300031711 | Bacteria | 889 |
| 311 | Ga0265342_10019024 | 3300031712 | Bacteria | 4434 |
| 312 | Ga0265342_10220014 | 3300031712 | Bacteria | 1023 |
| 313 | Ga0307410_10335157 | 3300031852 | Bacteria | 1204 |
| 314 | Ga0307406_10249536 | 3300031901 | Bacteria | 1336 |
| 315 | Ga0307409_101788781 | 3300031995 | Bacteria | 643 |
| 316 | Ga0307416_100783665 | 3300032002 | Bacteria | 1048 |
| 317 | Ga0373944_0036426 | 3300035089 | Bacteria | 1503 |
| 318 | Ga0373936_0002175 | 3300035113 | Bacteria | 7307 |
| 319 | Ga0373945_0053688 | 3300035116 | Bacteria | 1488 |
| 320 | Ga0373956_0624241 | 3300035119 | Bacteria | 514 |
| 321 | Ga0373960_0112452 | 3300035121 | Bacteria | 895 |
| 322 | Ga0373943_0045170 | 3300035170 | Bacteria | 2146 |
| 323 | Ga0373943_0045871 | 3300035170 | Bacteria | 2131 |
| 324 | Ga0373946_0235138 | 3300035171 | Bacteria | 889 |
| 325 | Ga0373955_0202961 | 3300035172 | Bacteria | 1181 |
| 326 | Ga0373924_0137809 | 3300035410 | Bacteria | 1064 |
| 327 | Ga0373935_0263577 | 3300035692 | Bacteria | 1209 |
| 328 | Ga0373927_0483850 | 3300035695 | Bacteria | 818 |
| 329 | Ga0373933_0052021 | 3300035724 | Bacteria | 2449 |
| 330 | Ga0373947_0006531 | 3300035725 | Bacteria | 6763 |
| 331 | Ga0373947_0295939 | 3300035725 | Bacteria | 1078 |
| 332 | Ga0373937_0053415 | 3300036401 | Bacteria | 3706 |
| 333 | Ga0373925_0010265 | 3300037068 | Bacteria | 6793 |
| 334 | Ga0395899_0023348 | 3300037312 | Bacteria | 4685 |
| 335 | Ga0395899_0219864 | 3300037312 | Bacteria | 1316 |
| 336 | Ga0395899_0416579 | 3300037312 | Bacteria | 886 |
| 337 | Ga0395900_0025838 | 3300037418 | Bacteria | 6012 |
| 338 | Ga0395900_0628158 | 3300037418 | Bacteria | 1012 |
| 339 | Ga0395898_0014525 | 3300037466 | Bacteria | 8087 |
| 340 | Ga0395898_0040304 | 3300037466 | Bacteria | 4619 |
| 341 | Ga0395898_1131220 | 3300037466 | Unclassified | 716 |
| 342 | Ga0395905_0070140 | 3300037471 | Bacteria | 3283 |
| 343 | Ga0395905_0661994 | 3300037471 | Unclassified | 946 |
| 344 | Ga0395905_1907011 | 3300037471 | Bacteria | 500 |
| 345 | Ga0395901_0022533 | 3300038443 | Bacteria | 6456 |
| 346 | Ga0395901_0518662 | 3300038443 | Bacteria | 1211 |
| 347 | Ga0395901_1241643 | 3300038443 | Bacteria | 709 |
| 348 | Ga0436365_1713197 | 3300039437 | Bacteria | 1967 |
| 349 | Ga0436363_0904841 | 3300039450 | Bacteria | 574 |
| 350 | Ga0439438_032702 | 3300041405 | Bacteria | 1378 |
| 351 | Ga0451802_0683445 | 3300041460 | Bacteria | 770 |
| 352 | Ga0451847_0324892 | 3300041503 | Bacteria | 555 |
| 353 | Ga0451853_0962046 | 3300041512 | Unclassified | 585 |
| 354 | Ga0439431_0050098 | 3300041997 | Bacteria | 1081 |
| 355 | Ga0439441_023784 | 3300042001 | Bacteria | 1147 |
| 356 | Ga0439442_112613 | 3300042002 | Bacteria | 593 |
| 357 | Ga0439448_0037808 | 3300042005 | Bacteria | 1552 |
| 358 | Ga0439450_061542 | 3300042008 | Bacteria | 908 |
| 359 | Ga0450915_015225 | 3300042119 | Bacteria | 577 |
| 360 | Ga0450920_014080 | 3300042122 | Bacteria | 1510 |
| 361 | Ga0450907_009372 | 3300042146 | Bacteria | 1623 |
| 362 | Ga0450910_035542 | 3300042147 | Bacteria | 794 |
| 363 | Ga0450910_061432 | 3300042147 | Bacteria | 635 |
| 364 | Ga0439446_0009477 | 3300042156 | Bacteria | 2607 |
| 365 | Ga0439434_0013357 | 3300042435 | Bacteria | 2438 |
| 366 | Ga0466966_0002628 | 3300044684 | Bacteria | 11768 |
| 367 | Ga0466966_0185510 | 3300044684 | Bacteria | 1261 |
| 368 | Ga0466961_0002298 | 3300044693 | Bacteria | 11884 |
| 369 | Ga0466963_0002261 | 3300044694 | Bacteria | 10700 |
| 370 | Ga0466963_0022468 | 3300044694 | Bacteria | 3995 |
| 371 | Ga0466963_0045643 | 3300044694 | Bacteria | 2886 |
| 372 | Ga0466963_0110438 | 3300044694 | Bacteria | 1887 |
| 373 | Ga0466963_0170504 | 3300044694 | Bacteria | 1517 |
| 374 | Ga0466963_0257392 | 3300044694 | Bacteria | 1225 |
| 375 | Ga0466964_0006383 | 3300044706 | Bacteria | 4395 |
| 376 | Ga0466964_0095056 | 3300044706 | Bacteria | 1304 |
| 377 | Ga0466971_0000910 | 3300044719 | Bacteria | 12117 |
| 378 | Ga0466971_0644785 | 3300044719 | Bacteria | 530 |
| 379 | Ga0466957_0000349 | 3300044842 | Bacteria | 22576 |
| 380 | Ga0466957_0044788 | 3300044842 | Bacteria | 2682 |
| 381 | Ga0466957_0435123 | 3300044842 | Bacteria | 902 |
| 382 | Ga0466960_0114570 | 3300044901 | Bacteria | 1405 |
| 383 | Ga0466959_0000435 | 3300045049 | Bacteria | 24320 |
| 384 | Ga0466959_0013400 | 3300045049 | Bacteria | 5943 |
| 385 | Ga0466959_0095285 | 3300045049 | Bacteria | 2135 |
| 386 | Ga0466959_0750195 | 3300045049 | Bacteria | 653 |
| 387 | Ga0466958_0007727 | 3300045836 | Bacteria | 5931 |
| 388 | Ga0466967_0000265 | 3300045976 | Bacteria | 23015 |
| 389 | Ga0466967_0000781 | 3300045976 | Bacteria | 16563 |
| 390 | Ga0466967_0009902 | 3300045976 | Bacteria | 7111 |
| 391 | Ga0466967_0014620 | 3300045976 | Bacteria | 6123 |
| 392 | Ga0466967_0015693 | 3300045976 | Bacteria | 5948 |
| 393 | Ga0466967_0021416 | 3300045976 | Bacteria | 5249 |
| 394 | Ga0466967_0055394 | 3300045976 | Bacteria | 3492 |
| 395 | Ga0466967_0058281 | 3300045976 | Bacteria | 3413 |
| 396 | Ga0466967_0187637 | 3300045976 | Bacteria | 1953 |
| 397 | Ga0466967_0615907 | 3300045976 | Bacteria | 1072 |
| 398 | Ga0466967_0638195 | 3300045976 | Bacteria | 1052 |
| 399 | Ga0466967_1045234 | 3300045976 | Bacteria | 813 |
| 400 | Ga0495603_0051258 | 3300046455 | Bacteria | 2453 |
| 401 | Ga0495603_0436176 | 3300046455 | Bacteria | 750 |
| 402 | Ga0495629_0015277 | 3300046459 | Bacteria | 5514 |
| 403 | Ga0495629_0275730 | 3300046459 | Bacteria | 1155 |
| 404 | Ga0495641_0107746 | 3300046461 | Bacteria | 1243 |
| 405 | Ga0495641_0130355 | 3300046461 | Bacteria | 1122 |
| 406 | Ga0495641_0425669 | 3300046461 | Unclassified | 603 |
| 407 | Ga0495651_0151737 | 3300046462 | Bacteria | 1669 |
| 408 | Ga0495651_0381103 | 3300046462 | Bacteria | 925 |
| 409 | Ga0495653_0961513 | 3300046463 | Bacteria | 506 |
| 410 | Ga0495639_0099624 | 3300046475 | Bacteria | 1371 |
| 411 | Ga0495664_0183925 | 3300046477 | Bacteria | 1267 |
| 412 | Ga0495584_0187884 | 3300046491 | Bacteria | 1050 |
| 413 | Ga0495608_0023600 | 3300046511 | Bacteria | 4215 |
| 414 | Ga0495628_0478322 | 3300046516 | Bacteria | 902 |
| 415 | Ga0495630_0023500 | 3300046517 | Bacteria | 4557 |
| 416 | Ga0495630_0528620 | 3300046517 | Unclassified | 904 |
| 417 | Ga0495667_0050896 | 3300046559 | Bacteria | 2734 |
| 418 | Ga0495634_0065766 | 3300046642 | Bacteria | 2402 |
| 419 | Ga0495634_0067785 | 3300046642 | Bacteria | 2359 |
| 420 | Ga0495635_0151199 | 3300046663 | Bacteria | 1580 |
| 421 | Ga0495588_0436242 | 3300046674 | Bacteria | 687 |
| 422 | Ga0495657_0071504 | 3300046675 | Bacteria | 2264 |
| 423 | Ga0495657_0095709 | 3300046675 | Bacteria | 1898 |
| 424 | Ga0495647_0218484 | 3300046681 | Bacteria | 840 |
| 425 | Ga0495658_0007224 | 3300046683 | Bacteria | 5489 |
| 426 | Ga0495658_0473699 | 3300046683 | Bacteria | 800 |
| 427 | Ga0495613_0011876 | 3300046689 | Bacteria | 6473 |
| 428 | Ga0495613_0169117 | 3300046689 | Bacteria | 1552 |
| 429 | Ga0495600_0058724 | 3300046809 | Bacteria | 2513 |
| 430 | Ga0495581_0536245 | 3300047315 | Bacteria | 680 |
| 431 | Ga0495581_0872471 | 3300047315 | Bacteria | 514 |
| 432 | Ga0495604_0387400 | 3300047317 | Bacteria | 922 |
| 433 | Ga0495674_0432494 | 3300047319 | Bacteria | 1059 |
| 434 | Ga0495676_0208900 | 3300047321 | Bacteria | 1352 |
| 435 | Ga0495680_0003274 | 3300047322 | Bacteria | 16061 |
| 436 | Ga0495675_0290220 | 3300047444 | Bacteria | 974 |
| 437 | Ga0495684_0020392 | 3300047471 | Bacteria | 5108 |
| 438 | Ga0495602_0474423 | 3300048088 | Bacteria | 879 |
| 439 | Ga0496100_0029557 | 3300048903 | Bacteria | 3391 |
| 440 | Ga0496100_0077896 | 3300048903 | Bacteria | 2230 |
| 441 | Ga0496100_0084589 | 3300048903 | Bacteria | 2150 |
| 442 | Ga0496100_0101088 | 3300048903 | Bacteria | 1987 |
| 443 | Ga0496101_0006731 | 3300048904 | Bacteria | 7414 |
| 444 | Ga0496101_0022064 | 3300048904 | Bacteria | 4380 |
| 445 | Ga0496101_0023532 | 3300048904 | Bacteria | 4257 |
| 446 | Ga0496101_0024266 | 3300048904 | Bacteria | 4195 |
| 447 | Ga0496101_0137026 | 3300048904 | Bacteria | 1863 |
| 448 | Ga0496101_0334281 | 3300048904 | Bacteria | 1189 |
| 449 | Ga0496102_0019711 | 3300048905 | Bacteria | 5944 |
| 450 | Ga0496102_0082066 | 3300048905 | Bacteria | 2973 |
| 451 | Ga0496102_0126921 | 3300048905 | Bacteria | 2385 |
| 452 | Ga0496102_0318292 | 3300048905 | Bacteria | 1466 |
| 453 | Ga0496102_0335188 | 3300048905 | Bacteria | 1425 |
| 454 | Ga0496102_0361135 | 3300048905 | Bacteria | 1367 |
| 455 | Ga0496102_0905256 | 3300048905 | Bacteria | 804 |
| 456 | Ga0496103_0104386 | 3300048906 | Bacteria | 1796 |
| 457 | Ga0496103_0193328 | 3300048906 | Bacteria | 1308 |
| 458 | Ga0496104_0000319 | 3300048907 | Bacteria | 42768 |
| 459 | Ga0496104_0202649 | 3300048907 | Bacteria | 1896 |
| 460 | Ga0496104_0607734 | 3300048907 | Bacteria | 1004 |
| 461 | Ga0496104_0851558 | 3300048907 | Bacteria | 817 |
| 462 | Ga0496104_0997379 | 3300048907 | Bacteria | 741 |
| 463 | Ga0496105_0000194 | 3300048908 | Bacteria | 40666 |
| 464 | Ga0496105_0110862 | 3300048908 | Bacteria | 2265 |
| 465 | Ga0496105_0156256 | 3300048908 | Bacteria | 1873 |
| 466 | Ga0496105_0740634 | 3300048908 | Bacteria | 751 |
| 467 | Ga0496105_1313953 | 3300048908 | Bacteria | 527 |
| 468 | Ga0496106_0023028 | 3300048909 | Bacteria | 4626 |
| 469 | Ga0496106_0241093 | 3300048909 | Bacteria | 1445 |
| 470 | Ga0496106_0446576 | 3300048909 | Bacteria | 1039 |
| 471 | Ga0496107_0009958 | 3300048910 | Bacteria | 6595 |
| 472 | Ga0496107_0024981 | 3300048910 | Bacteria | 4229 |
| 473 | Ga0496107_0187715 | 3300048910 | Bacteria | 1535 |
| 474 | Ga0496107_0384314 | 3300048910 | Bacteria | 1044 |
| 475 | Ga0496107_0565479 | 3300048910 | Bacteria | 842 |
| 476 | Ga0496108_0000971 | 3300048911 | Bacteria | 22338 |
| 477 | Ga0496108_0296482 | 3300048911 | Bacteria | 1408 |
| 478 | Ga0496108_1263181 | 3300048911 | Bacteria | 622 |
| 479 | Ga0496109_0000458 | 3300048912 | Bacteria | 34881 |
| 480 | Ga0496109_0050601 | 3300048912 | Bacteria | 3783 |
| 481 | Ga0496109_0381927 | 3300048912 | Bacteria | 1331 |
| 482 | Ga0496109_0569398 | 3300048912 | Bacteria | 1068 |
| 483 | Ga0496110_0002903 | 3300048913 | Bacteria | 12976 |
| 484 | Ga0496110_0010229 | 3300048913 | Bacteria | 7622 |
| 485 | Ga0496110_0239912 | 3300048913 | Bacteria | 1649 |
| 486 | Ga0496111_0034631 | 3300048914 | Bacteria | 3606 |
| 487 | Ga0496111_0137652 | 3300048914 | Bacteria | 1809 |
| 488 | Ga0496111_0496374 | 3300048914 | Bacteria | 898 |
| 489 | Ga0496112_0372830 | 3300048915 | Unclassified | 1369 |
| 490 | Ga0496112_0454903 | 3300048915 | Bacteria | 1218 |
| 491 | Ga0496112_0936647 | 3300048915 | Bacteria | 787 |
| 492 | Ga0496113_0089594 | 3300048916 | Bacteria | 2368 |
| 493 | Ga0496113_0172567 | 3300048916 | Bacteria | 1713 |
| 494 | Ga0496113_0813216 | 3300048916 | Bacteria | 742 |
| 495 | Ga0496114_0000510 | 3300048917 | Bacteria | 28469 |
| 496 | Ga0496114_0004175 | 3300048917 | Bacteria | 11183 |
| 497 | Ga0496114_0007371 | 3300048917 | Bacteria | 8691 |
| 498 | Ga0496114_0050597 | 3300048917 | Bacteria | 3459 |
| 499 | Ga0496114_0103213 | 3300048917 | Bacteria | 2437 |
| 500 | Ga0496114_0425916 | 3300048917 | Bacteria | 1176 |
| 501 | Ga0496115_0000431 | 3300048918 | Bacteria | 33991 |
| 502 | Ga0496115_0073089 | 3300048918 | Bacteria | 2783 |
| 503 | Ga0496115_0388241 | 3300048918 | Bacteria | 1134 |
| 504 | Ga0496115_0610758 | 3300048918 | Bacteria | 866 |
| 505 | Ga0496115_0771195 | 3300048918 | Bacteria | 750 |
| 506 | Ga0501031_0004013 | 3300049568 | Bacteria | 9496 |
| 507 | Ga0501031_0011292 | 3300049568 | Bacteria | 5819 |
| 508 | Ga0501032_0035558 | 3300049569 | Bacteria | 3405 |
| 509 | Ga0501032_0137322 | 3300049569 | Bacteria | 1611 |
| 510 | Ga0501033_0027299 | 3300049570 | Bacteria | 4292 |
| 511 | Ga0501033_0113835 | 3300049570 | Bacteria | 1967 |
| 512 | Ga0501033_0163547 | 3300049570 | Bacteria | 1601 |
| 513 | Ga0501036_0000261 | 3300049572 | Bacteria | 35846 |
| 514 | Ga0501036_0005893 | 3300049572 | Bacteria | 9930 |
| 515 | Ga0501036_0086238 | 3300049572 | Bacteria | 2654 |
| 516 | Ga0501037_0026288 | 3300049573 | Bacteria | 4302 |
| 517 | Ga0501037_0325890 | 3300049573 | Bacteria | 1063 |
| 518 | Ga0501038_0023050 | 3300049574 | Bacteria | 5571 |
| 519 | Ga0501038_0081648 | 3300049574 | Bacteria | 2724 |
| 520 | Ga0501038_0094569 | 3300049574 | Bacteria | 2498 |
| 521 | Ga0501039_0011079 | 3300049575 | Bacteria | 6871 |
| 522 | Ga0501039_0026396 | 3300049575 | Bacteria | 4463 |
| 523 | Ga0501039_0165654 | 3300049575 | Bacteria | 1738 |
| 524 | Ga0501039_0297433 | 3300049575 | Bacteria | 1269 |
| 525 | Ga0501039_0817216 | 3300049575 | Bacteria | 727 |
| 526 | Ga0501040_0000344 | 3300049576 | Bacteria | 27241 |
| 527 | Ga0501040_0013668 | 3300049576 | Bacteria | 5338 |
| 528 | Ga0501040_0070788 | 3300049576 | Bacteria | 2407 |
| 529 | Ga0501040_0134327 | 3300049576 | Bacteria | 1741 |
| 530 | Ga0501041_0001411 | 3300049577 | Bacteria | 13273 |
| 531 | Ga0501041_0006031 | 3300049577 | Bacteria | 7089 |
| 532 | Ga0501041_0092786 | 3300049577 | Bacteria | 1864 |
| 533 | Ga0501041_0247781 | 3300049577 | Bacteria | 1120 |
| 534 | Ga0501042_0004621 | 3300049578 | Bacteria | 8790 |
| 535 | Ga0501042_0022168 | 3300049578 | Bacteria | 4435 |
| 536 | Ga0501042_0209885 | 3300049578 | Bacteria | 1405 |
| 537 | Ga0501042_0707372 | 3300049578 | Unclassified | 733 |
| 538 | Ga0501043_0215405 | 3300049579 | Bacteria | 1487 |
| 539 | Ga0501046_0006023 | 3300049580 | Bacteria | 10784 |
| 540 | Ga0501046_0082969 | 3300049580 | Bacteria | 2475 |
| 541 | Ga0501046_0726374 | 3300049580 | Bacteria | 699 |
| 542 | Ga0501046_0796298 | 3300049580 | Bacteria | 662 |
| 543 | Ga0501048_0034079 | 3300049582 | Bacteria | 3676 |
| 544 | Ga0501048_0186287 | 3300049582 | Bacteria | 1471 |
| 545 | Ga0501048_0694602 | 3300049582 | Bacteria | 730 |
| 546 | Ga0501048_0712095 | 3300049582 | Bacteria | 721 |
| 547 | Ga0501067_0000208 | 3300049583 | Bacteria | 32744 |
| 548 | Ga0501067_0067263 | 3300049583 | Bacteria | 1983 |
| 549 | Ga0501068_0010528 | 3300049584 | Bacteria | 5197 |
| 550 | Ga0501068_0033981 | 3300049584 | Bacteria | 3040 |
| 551 | Ga0501068_0141766 | 3300049584 | Bacteria | 1507 |
| 552 | Ga0501069_0000901 | 3300049585 | Bacteria | 14162 |
| 553 | Ga0501069_0090169 | 3300049585 | Bacteria | 1733 |
| 554 | Ga0501069_0106346 | 3300049585 | Bacteria | 1595 |
| 555 | Ga0501069_0214676 | 3300049585 | Bacteria | 1117 |
| 556 | Ga0501071_0000430 | 3300049587 | Bacteria | 20980 |
| 557 | Ga0501071_0013850 | 3300049587 | Bacteria | 5504 |
| 558 | Ga0501071_0138107 | 3300049587 | Bacteria | 1814 |
| 559 | Ga0501072_0000897 | 3300049588 | Bacteria | 21843 |
| 560 | Ga0501072_0008013 | 3300049588 | Bacteria | 8018 |
| 561 | Ga0501072_0468167 | 3300049588 | Bacteria | 998 |
| 562 | Ga0501072_0587448 | 3300049588 | Bacteria | 878 |
| 563 | Ga0501073_0129538 | 3300049589 | Bacteria | 1749 |
| 564 | Ga0501074_0016767 | 3300049590 | Bacteria | 5315 |
| 565 | Ga0501074_0019812 | 3300049590 | Bacteria | 4886 |
| 566 | Ga0501074_0645978 | 3300049590 | Bacteria | 747 |
| 567 | Ga0501075_0001217 | 3300049591 | Bacteria | 16683 |
| 568 | Ga0501075_0159348 | 3300049591 | Bacteria | 1721 |
| 569 | Ga0501076_0000330 | 3300049592 | Bacteria | 29312 |
| 570 | Ga0501076_0003143 | 3300049592 | Bacteria | 11515 |
| 571 | Ga0501076_0003676 | 3300049592 | Bacteria | 10783 |
| 572 | Ga0501076_0242116 | 3300049592 | Bacteria | 1476 |
| 573 | Ga0501077_0002421 | 3300049593 | Bacteria | 11194 |
| 574 | Ga0501077_0008570 | 3300049593 | Bacteria | 6337 |
| 575 | Ga0501077_0014090 | 3300049593 | Bacteria | 5015 |
| 576 | Ga0501077_0376351 | 3300049593 | Bacteria | 907 |
| 577 | Ga0501079_0004782 | 3300049741 | Bacteria | 10035 |
| 578 | Ga0501079_0015023 | 3300049741 | Bacteria | 5902 |
| 579 | Ga0501079_0030332 | 3300049741 | Bacteria | 4154 |
| 580 | Ga0501080_0011873 | 3300049742 | Bacteria | 7979 |
| 581 | Ga0501080_0153657 | 3300049742 | Bacteria | 2126 |
| 582 | Ga0501081_0001194 | 3300049743 | Bacteria | 15741 |
| 583 | Ga0501081_0006646 | 3300049743 | Bacteria | 7518 |
| 584 | Ga0501081_0014696 | 3300049743 | Bacteria | 5164 |
| 585 | Ga0501081_0025578 | 3300049743 | Bacteria | 3972 |
| 586 | Ga0501081_0239846 | 3300049743 | Bacteria | 1322 |
| 587 | Ga0501081_0997088 | 3300049743 | Bacteria | 633 |
| 588 | Ga0501083_0016010 | 3300049744 | Bacteria | 5252 |
| 589 | Ga0501083_0060454 | 3300049744 | Bacteria | 2531 |
| 590 | Ga0501083_0820310 | 3300049744 | Bacteria | 605 |
| 591 | Ga0501035_0014888 | 3300049822 | Bacteria | 7178 |
| 592 | Ga0501035_0242717 | 3300049822 | Bacteria | 1532 |
| 593 | Ga0501035_0375604 | 3300049822 | Bacteria | 1186 |
| 594 | Ga0501045_0000784 | 3300049824 | Bacteria | 20425 |
| 595 | Ga0501045_0002106 | 3300049824 | Bacteria | 13459 |
| 596 | Ga0501045_0009831 | 3300049824 | Bacteria | 6693 |
| 597 | Ga0501045_0976966 | 3300049824 | Bacteria | 621 |
| 598 | nmdc:mga03n38_764770_c1 | 3300050490 | Bacteria | 560 |
| 599 | nmdc:mga0yw44_298610_c1 | 3300050492 | Bacteria | 1079 |
| 600 | nmdc:mga06z11_421127_c1 | 3300050494 | Bacteria | 805 |
| 601 | nmdc:mga08y16_960391_c1 | 3300050511 | Bacteria | 837 |
| 602 | nmdc:mga0rr50_178194_c1 | 3300050513 | Bacteria | 1736 |
| 603 | nmdc:mga0rr50_238276_c1 | 3300050513 | Bacteria | 1507 |
| 604 | Ga0495601_0105291 | 3300053077 | Bacteria | 1824 |
| 605 | Ga0495595_0114381 | 3300053084 | Bacteria | 1311 |
| 606 | Ga0495595_0430911 | 3300053084 | Bacteria | 669 |
| 607 | Ga0495619_0050809 | 3300053085 | Bacteria | 2738 |
| 608 | Ga0501084_0000982 | 3300054114 | Bacteria | 22117 |
| 609 | Ga0501084_0005384 | 3300054114 | Bacteria | 10491 |
| 610 | Ga0501084_0007211 | 3300054114 | Bacteria | 9162 |
| 611 | Ga0501084_0079394 | 3300054114 | Bacteria | 2750 |
| 612 | Ga0501084_0152886 | 3300054114 | Bacteria | 1945 |
| 613 | Ga0590077_110220 | 3300059426 | Bacteria | 647 |
| 614 | Ga0501082_0003519 | 3300060353 | Bacteria | 13680 |
| 615 | Ga0501082_0015919 | 3300060353 | Bacteria | 6468 |
| 616 | Ga0501082_0035686 | 3300060353 | Bacteria | 4285 |
| 617 | Ga0501082_0094983 | 3300060353 | Bacteria | 2576 |
| 618 | Ga0466962_0004212 | 3300061719 | Bacteria | 6890 |
| 619 | Ga0530510_0006712 | 3300061734 | Bacteria | 8023 |
| 620 | Ga0530510_0022478 | 3300061734 | Bacteria | 4493 |
| 621 | Ga0530510_0147608 | 3300061734 | Bacteria | 1735 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025900 | Ga0207710_10542204 | Ga0207710_105422042 | 119 |
| 2 | 3300025914 | Ga0207671_11213255 | Ga0207671_112132551 | 119 |
| 3 | 3300026035 | Ga0207703_10140023 | Ga0207703_101400232 | 119 |
| 4 | 3300041503 | Ga0451847_0324892 | Ga0451847_0324892_100_459 | 119 |
| 5 | 3300042147 | Ga0450910_035542 | Ga0450910_035542_178_540 | 119 |
| 6 | 3300049570 | Ga0501033_0163547 | Ga0501033_0163547_1092_1469 | 119 |
| 7 | 3300049572 | Ga0501036_0086238 | Ga0501036_0086238_327_704 | 119 |
| 8 | 3300049574 | Ga0501038_0094569 | Ga0501038_0094569_1889_2266 | 119 |
| 9 | 3300049575 | Ga0501039_0026396 | Ga0501039_0026396_1508_1885 | 119 |
| 10 | 3300049576 | Ga0501040_0070788 | Ga0501040_0070788_984_1361 | 119 |
| 11 | 3300049577 | Ga0501041_0006031 | Ga0501041_0006031_1522_1899 | 119 |
| 12 | 3300049578 | Ga0501042_0707372 | Ga0501042_0707372_26_403 | 119 |
| 13 | 3300049580 | Ga0501046_0082969 | Ga0501046_0082969_1760_2137 | 119 |
| 14 | 3300049584 | Ga0501068_0033981 | Ga0501068_0033981_2298_2675 | 119 |
| 15 | 3300049585 | Ga0501069_0090169 | Ga0501069_0090169_561_938 | 119 |
| 16 | 3300049587 | Ga0501071_0000430 | Ga0501071_0000430_697_1074 | 119 |
| 17 | 3300049588 | Ga0501072_0000897 | Ga0501072_0000897_16537_16914 | 119 |
| 18 | 3300049590 | Ga0501074_0645978 | Ga0501074_0645978_34_411 | 119 |
| 19 | 3300049592 | Ga0501076_0003676 | Ga0501076_0003676_6990_7367 | 119 |
| 20 | 3300049593 | Ga0501077_0002421 | Ga0501077_0002421_5509_5886 | 119 |
| 21 | 3300049741 | Ga0501079_0030332 | Ga0501079_0030332_2053_2430 | 119 |
| 22 | 3300049742 | Ga0501080_0011873 | Ga0501080_0011873_5839_6216 | 119 |
| 23 | 3300049743 | Ga0501081_0014696 | Ga0501081_0014696_1570_1947 | 119 |
| 24 | 3300049744 | Ga0501083_0060454 | Ga0501083_0060454_867_1244 | 119 |
| 25 | 3300049824 | Ga0501045_0009831 | Ga0501045_0009831_5245_5622 | 119 |
| 26 | 3300054114 | Ga0501084_0005384 | Ga0501084_0005384_7807_8184 | 119 |
| 27 | 3300060353 | Ga0501082_0003519 | Ga0501082_0003519_1247_1624 | 119 |
| 28 | 3300061734 | Ga0530510_0022478 | Ga0530510_0022478_4094_4471 | 119 |
| 29 | 3300005327 | Ga0070658_10244811 | Ga0070658_102448112 | 120 |
| 30 | 3300005327 | Ga0070658_10258221 | Ga0070658_102582211 | 120 |
| 31 | 3300005329 | Ga0070683_100093616 | Ga0070683_1000936164 | 120 |
| 32 | 3300005329 | Ga0070683_100328744 | Ga0070683_1003287442 | 120 |
| 33 | 3300005329 | Ga0070683_100746731 | Ga0070683_1007467312 | 120 |
| 34 | 3300005336 | Ga0070680_100216681 | Ga0070680_1002166813 | 120 |
| 35 | 3300005336 | Ga0070680_100604099 | Ga0070680_1006040991 | 120 |
| 36 | 3300005337 | Ga0070682_100051110 | Ga0070682_1000511103 | 120 |
| 37 | 3300005337 | Ga0070682_100087692 | Ga0070682_1000876924 | 120 |
| 38 | 3300005339 | Ga0070660_100001227 | Ga0070660_10000122711 | 120 |
| 39 | 3300005339 | Ga0070660_100064925 | Ga0070660_1000649253 | 120 |
| 40 | 3300005339 | Ga0070660_100160434 | Ga0070660_1001604341 | 120 |
| 41 | 3300005339 | Ga0070660_100224027 | Ga0070660_1002240273 | 120 |
| 42 | 3300005339 | Ga0070660_100274547 | Ga0070660_1002745472 | 120 |
| 43 | 3300005341 | Ga0070691_10477961 | Ga0070691_104779611 | 120 |
| 44 | 3300005344 | Ga0070661_100005972 | Ga0070661_1000059728 | 120 |
| 45 | 3300005344 | Ga0070661_100011452 | Ga0070661_1000114525 | 120 |
| 46 | 3300005344 | Ga0070661_100021829 | Ga0070661_1000218295 | 120 |
| 47 | 3300005366 | Ga0070659_100015315 | Ga0070659_1000153153 | 120 |
| 48 | 3300005366 | Ga0070659_101799714 | Ga0070659_1017997141 | 120 |
| 49 | 3300005434 | Ga0070709_10101218 | Ga0070709_101012182 | 120 |
| 50 | 3300005434 | Ga0070709_10314920 | Ga0070709_103149202 | 120 |
| 51 | 3300005436 | Ga0070713_101135743 | Ga0070713_1011357432 | 120 |
| 52 | 3300005458 | Ga0070681_10003001 | Ga0070681_1000300112 | 120 |
| 53 | 3300005458 | Ga0070681_10008477 | Ga0070681_100084775 | 120 |
| 54 | 3300005458 | Ga0070681_10277886 | Ga0070681_102778863 | 120 |
| 55 | 3300005530 | Ga0070679_100023955 | Ga0070679_1000239555 | 120 |
| 56 | 3300005530 | Ga0070679_100262126 | Ga0070679_1002621263 | 120 |
| 57 | 3300005530 | Ga0070679_100348204 | Ga0070679_1003482042 | 120 |
| 58 | 3300005530 | Ga0070679_100523621 | Ga0070679_1005236212 | 120 |
| 59 | 3300005535 | Ga0070684_100050016 | Ga0070684_1000500164 | 120 |
| 60 | 3300005535 | Ga0070684_100094686 | Ga0070684_1000946862 | 120 |
| 61 | 3300005535 | Ga0070684_100178815 | Ga0070684_1001788152 | 120 |
| 62 | 3300005535 | Ga0070684_100578051 | Ga0070684_1005780512 | 120 |
| 63 | 3300005539 | Ga0068853_100071494 | Ga0068853_1000714944 | 120 |
| 64 | 3300005539 | Ga0068853_100898304 | Ga0068853_1008983041 | 120 |
| 65 | 3300005539 | Ga0068853_102192928 | Ga0068853_1021929282 | 120 |
| 66 | 3300005546 | Ga0070696_101011454 | Ga0070696_1010114541 | 120 |
| 67 | 3300005548 | Ga0070665_100004675 | Ga0070665_10000467516 | 120 |
| 68 | 3300005563 | Ga0068855_100005572 | Ga0068855_10000557212 | 120 |
| 69 | 3300005563 | Ga0068855_100008007 | Ga0068855_1000080076 | 120 |
| 70 | 3300005563 | Ga0068855_100228049 | Ga0068855_1002280494 | 120 |
| 71 | 3300005563 | Ga0068855_100351036 | Ga0068855_1003510362 | 120 |
| 72 | 3300005563 | Ga0068855_100352576 | Ga0068855_1003525762 | 120 |
| 73 | 3300005577 | Ga0068857_100067465 | Ga0068857_1000674653 | 120 |
| 74 | 3300005614 | Ga0068856_100025011 | Ga0068856_1000250114 | 120 |
| 75 | 3300005614 | Ga0068856_100028973 | Ga0068856_1000289734 | 120 |
| 76 | 3300005614 | Ga0068856_100700949 | Ga0068856_1007009492 | 120 |
| 77 | 3300005616 | Ga0068852_100006341 | Ga0068852_1000063415 | 120 |
| 78 | 3300009093 | Ga0105240_10061243 | Ga0105240_100612434 | 120 |
| 79 | 3300009093 | Ga0105240_10291542 | Ga0105240_102915422 | 120 |
| 80 | 3300009174 | Ga0105241_11550452 | Ga0105241_115504522 | 120 |
| 81 | 3300009545 | Ga0105237_10028148 | Ga0105237_100281488 | 120 |
| 82 | 3300009545 | Ga0105237_12693965 | Ga0105237_126939651 | 120 |
| 83 | 3300009551 | Ga0105238_10207211 | Ga0105238_102072114 | 120 |
| 84 | 3300010375 | Ga0105239_11206563 | Ga0105239_112065632 | 120 |
| 85 | 3300013100 | Ga0157373_10188324 | Ga0157373_101883242 | 120 |
| 86 | 3300013102 | Ga0157371_10047405 | Ga0157371_100474054 | 120 |
| 87 | 3300013104 | Ga0157370_10025745 | Ga0157370_100257455 | 120 |
| 88 | 3300013104 | Ga0157370_10083856 | Ga0157370_100838564 | 120 |
| 89 | 3300013104 | Ga0157370_10330492 | Ga0157370_103304922 | 120 |
| 90 | 3300013104 | Ga0157370_11052768 | Ga0157370_110527681 | 120 |
| 91 | 3300013105 | Ga0157369_10006969 | Ga0157369_1000696911 | 120 |
| 92 | 3300013105 | Ga0157369_10062629 | Ga0157369_100626296 | 120 |
| 93 | 3300013105 | Ga0157369_10201157 | Ga0157369_102011572 | 120 |
| 94 | 3300013105 | Ga0157369_10220231 | Ga0157369_102202313 | 120 |
| 95 | 3300013307 | Ga0157372_10026405 | Ga0157372_100264054 | 120 |
| 96 | 3300013307 | Ga0157372_10076616 | Ga0157372_100766162 | 120 |
| 97 | 3300013307 | Ga0157372_10447418 | Ga0157372_104474183 | 120 |
| 98 | 3300013307 | Ga0157372_11465941 | Ga0157372_114659412 | 120 |
| 99 | 3300015261 | Ga0182006_1065253 | Ga0182006_10652531 | 120 |
| 100 | 3300015262 | Ga0182007_10185851 | Ga0182007_101858512 | 120 |
| 101 | 3300020069 | Ga0197907_10898572 | Ga0197907_108985722 | 120 |
| 102 | 3300020069 | Ga0197907_11164167 | Ga0197907_111641671 | 120 |
| 103 | 3300020070 | Ga0206356_10772295 | Ga0206356_107722951 | 120 |
| 104 | 3300020081 | Ga0206354_10108151 | Ga0206354_101081511 | 120 |
| 105 | 3300020081 | Ga0206354_10842383 | Ga0206354_108423832 | 120 |
| 106 | 3300020081 | Ga0206354_11481859 | Ga0206354_114818592 | 120 |
| 107 | 3300020082 | Ga0206353_10039946 | Ga0206353_100399462 | 120 |
| 108 | 3300020082 | Ga0206353_10567668 | Ga0206353_105676682 | 120 |
| 109 | 3300020082 | Ga0206353_11608262 | Ga0206353_116082622 | 120 |
| 110 | 3300022467 | Ga0224712_10103283 | Ga0224712_101032832 | 120 |
| 111 | 3300025906 | Ga0207699_10095020 | Ga0207699_100950202 | 120 |
| 112 | 3300025909 | Ga0207705_10352623 | Ga0207705_103526232 | 120 |
| 113 | 3300025909 | Ga0207705_11532620 | Ga0207705_115326201 | 120 |
| 114 | 3300025911 | Ga0207654_10138778 | Ga0207654_101387782 | 120 |
| 115 | 3300025911 | Ga0207654_10748855 | Ga0207654_107488552 | 120 |
| 116 | 3300025912 | Ga0207707_10002237 | Ga0207707_1000223711 | 120 |
| 117 | 3300025912 | Ga0207707_10072257 | Ga0207707_100722572 | 120 |
| 118 | 3300025913 | Ga0207695_10155311 | Ga0207695_101553114 | 120 |
| 119 | 3300025913 | Ga0207695_10181083 | Ga0207695_101810832 | 120 |
| 120 | 3300025914 | Ga0207671_10045482 | Ga0207671_100454825 | 120 |
| 121 | 3300025916 | Ga0207663_10539037 | Ga0207663_105390372 | 120 |
| 122 | 3300025916 | Ga0207663_11144924 | Ga0207663_111449242 | 120 |
| 123 | 3300025917 | Ga0207660_10008381 | Ga0207660_100083814 | 120 |
| 124 | 3300025917 | Ga0207660_10138108 | Ga0207660_101381082 | 120 |
| 125 | 3300025919 | Ga0207657_10000467 | Ga0207657_1000046742 | 120 |
| 126 | 3300025919 | Ga0207657_10000731 | Ga0207657_1000073120 | 120 |
| 127 | 3300025919 | Ga0207657_10035446 | Ga0207657_100354464 | 120 |
| 128 | 3300025919 | Ga0207657_10128274 | Ga0207657_101282742 | 120 |
| 129 | 3300025919 | Ga0207657_10175722 | Ga0207657_101757223 | 120 |
| 130 | 3300025920 | Ga0207649_10106584 | Ga0207649_101065842 | 120 |
| 131 | 3300025920 | Ga0207649_10158046 | Ga0207649_101580462 | 120 |
| 132 | 3300025921 | Ga0207652_10061576 | Ga0207652_100615763 | 120 |
| 133 | 3300025921 | Ga0207652_10526231 | Ga0207652_105262312 | 120 |
| 134 | 3300025921 | Ga0207652_10608704 | Ga0207652_106087042 | 120 |
| 135 | 3300025921 | Ga0207652_10756180 | Ga0207652_107561802 | 120 |
| 136 | 3300025924 | Ga0207694_10119177 | Ga0207694_101191774 | 120 |
| 137 | 3300025928 | Ga0207700_10401255 | Ga0207700_104012552 | 120 |
| 138 | 3300025932 | Ga0207690_10010005 | Ga0207690_100100054 | 120 |
| 139 | 3300025932 | Ga0207690_10038365 | Ga0207690_100383652 | 120 |
| 140 | 3300025932 | Ga0207690_10099492 | Ga0207690_100994923 | 120 |
| 141 | 3300025933 | Ga0207706_10329705 | Ga0207706_103297052 | 120 |
| 142 | 3300025944 | Ga0207661_10416106 | Ga0207661_104161063 | 120 |
| 143 | 3300025944 | Ga0207661_10425529 | Ga0207661_104255292 | 120 |
| 144 | 3300025945 | Ga0207679_10360714 | Ga0207679_103607142 | 120 |
| 145 | 3300025949 | Ga0207667_10027576 | Ga0207667_100275764 | 120 |
| 146 | 3300025949 | Ga0207667_10287406 | Ga0207667_102874062 | 120 |
| 147 | 3300025949 | Ga0207667_11870790 | Ga0207667_118707902 | 120 |
| 148 | 3300026041 | Ga0207639_10052524 | Ga0207639_100525244 | 120 |
| 149 | 3300026041 | Ga0207639_10136468 | Ga0207639_101364682 | 120 |
| 150 | 3300026041 | Ga0207639_10400080 | Ga0207639_104000802 | 120 |
| 151 | 3300026041 | Ga0207639_11651351 | Ga0207639_116513511 | 120 |
| 152 | 3300026067 | Ga0207678_10430940 | Ga0207678_104309403 | 120 |
| 153 | 3300026078 | Ga0207702_10476942 | Ga0207702_104769422 | 120 |
| 154 | 3300026116 | Ga0207674_10088605 | Ga0207674_100886052 | 120 |
| 155 | 3300026116 | Ga0207674_10090008 | Ga0207674_100900082 | 120 |
| 156 | 3300026142 | Ga0207698_10043082 | Ga0207698_100430823 | 120 |
| 157 | 3300028379 | Ga0268266_10028962 | Ga0268266_100289625 | 120 |
| 158 | 3300032002 | Ga0307416_100783665 | Ga0307416_1007836652 | 120 |
| 159 | 3300037312 | Ga0395899_0219864 | Ga0395899_0219864_125_505 | 120 |
| 160 | 3300037418 | Ga0395900_0025838 | Ga0395900_0025838_3105_3485 | 120 |
| 161 | 3300037466 | Ga0395898_0040304 | Ga0395898_0040304_1826_2206 | 120 |
| 162 | 3300037466 | Ga0395898_1131220 | Ga0395898_1131220_272_637 | 120 |
| 163 | 3300038443 | Ga0395901_0022533 | Ga0395901_0022533_577_942 | 120 |
| 164 | 3300041405 | Ga0439438_032702 | Ga0439438_032702_261_626 | 120 |
| 165 | 3300041997 | Ga0439431_0050098 | Ga0439431_0050098_421_786 | 120 |
| 166 | 3300042002 | Ga0439442_112613 | Ga0439442_112613_49_417 | 120 |
| 167 | 3300042122 | Ga0450920_014080 | Ga0450920_014080_212_577 | 120 |
| 168 | 3300042146 | Ga0450907_009372 | Ga0450907_009372_1037_1402 | 120 |
| 169 | 3300042147 | Ga0450910_061432 | Ga0450910_061432_142_507 | 120 |
| 170 | 3300042156 | Ga0439446_0009477 | Ga0439446_0009477_1598_1963 | 120 |
| 171 | 3300042435 | Ga0439434_0013357 | Ga0439434_0013357_191_556 | 120 |
| 172 | 3300044694 | Ga0466963_0045643 | Ga0466963_0045643_322_687 | 120 |
| 173 | 3300044694 | Ga0466963_0170504 | Ga0466963_0170504_841_1209 | 120 |
| 174 | 3300044706 | Ga0466964_0006383 | Ga0466964_0006383_1059_1424 | 120 |
| 175 | 3300044719 | Ga0466971_0644785 | Ga0466971_0644785_112_477 | 120 |
| 176 | 3300045049 | Ga0466959_0095285 | Ga0466959_0095285_1004_1369 | 120 |
| 177 | 3300045976 | Ga0466967_0009902 | Ga0466967_0009902_3565_3933 | 120 |
| 178 | 3300045976 | Ga0466967_0055394 | Ga0466967_0055394_2267_2632 | 120 |
| 179 | 3300045976 | Ga0466967_0638195 | Ga0466967_0638195_622_987 | 120 |
| 180 | 3300048903 | Ga0496100_0077896 | Ga0496100_0077896_175_540 | 120 |
| 181 | 3300048904 | Ga0496101_0006731 | Ga0496101_0006731_3568_3933 | 120 |
| 182 | 3300048905 | Ga0496102_0361135 | Ga0496102_0361135_494_859 | 120 |
| 183 | 3300048907 | Ga0496104_0202649 | Ga0496104_0202649_96_461 | 120 |
| 184 | 3300048908 | Ga0496105_0110862 | Ga0496105_0110862_553_918 | 120 |
| 185 | 3300048909 | Ga0496106_0446576 | Ga0496106_0446576_444_809 | 120 |
| 186 | 3300048910 | Ga0496107_0384314 | Ga0496107_0384314_66_431 | 120 |
| 187 | 3300048917 | Ga0496114_0007371 | Ga0496114_0007371_4759_5124 | 120 |
| 188 | 3300048917 | Ga0496114_0425916 | Ga0496114_0425916_43_471 | 120 |
| 189 | 3300048918 | Ga0496115_0000431 | Ga0496115_0000431_21612_21977 | 120 |
| 190 | 3300049575 | Ga0501039_0817216 | Ga0501039_0817216_33_401 | 120 |
| 191 | 3300049583 | Ga0501067_0000208 | Ga0501067_0000208_7848_8213 | 120 |
| 192 | 3300049583 | Ga0501067_0067263 | Ga0501067_0067263_1285_1650 | 120 |
| 193 | 3300049585 | Ga0501069_0000901 | Ga0501069_0000901_6976_7341 | 120 |
| 194 | 3300049585 | Ga0501069_0106346 | Ga0501069_0106346_655_1086 | 120 |
| 195 | 3300049743 | Ga0501081_0239846 | Ga0501081_0239846_660_1025 | 120 |
| 196 | 3300059426 | Ga0590077_110220 | Ga0590077_110220_205_573 | 120 |
| 197 | 3300006175 | Ga0070712_100822167 | Ga0070712_1008221672 | 121 |
| 198 | 3300015262 | Ga0182007_10370163 | Ga0182007_103701631 | 121 |
| 199 | 3300025912 | Ga0207707_10126302 | Ga0207707_101263023 | 121 |
| 200 | 3300025915 | Ga0207693_10405093 | Ga0207693_104050932 | 121 |
| 201 | 3300025921 | Ga0207652_10021861 | Ga0207652_100218612 | 121 |
| 202 | 3300028556 | Ga0265337_1025568 | Ga0265337_10255683 | 121 |
| 203 | 3300028558 | Ga0265326_10014746 | Ga0265326_100147462 | 121 |
| 204 | 3300028563 | Ga0265319_1003775 | Ga0265319_100377510 | 121 |
| 205 | 3300028573 | Ga0265334_10001611 | Ga0265334_1000161111 | 121 |
| 206 | 3300028577 | Ga0265318_10001206 | Ga0265318_100012067 | 121 |
| 207 | 3300028653 | Ga0265323_10124858 | Ga0265323_101248582 | 121 |
| 208 | 3300028654 | Ga0265322_10013711 | Ga0265322_100137112 | 121 |
| 209 | 3300028666 | Ga0265336_10025608 | Ga0265336_100256083 | 121 |
| 210 | 3300028666 | Ga0265336_10130398 | Ga0265336_101303982 | 121 |
| 211 | 3300028800 | Ga0265338_10003587 | Ga0265338_100035876 | 121 |
| 212 | 3300028800 | Ga0265338_10093645 | Ga0265338_100936453 | 121 |
| 213 | 3300028800 | Ga0265338_10313819 | Ga0265338_103138192 | 121 |
| 214 | 3300028800 | Ga0265338_10339654 | Ga0265338_103396542 | 121 |
| 215 | 3300029957 | Ga0265324_10048976 | Ga0265324_100489762 | 121 |
| 216 | 3300031235 | Ga0265330_10011257 | Ga0265330_100112577 | 121 |
| 217 | 3300031238 | Ga0265332_10001674 | Ga0265332_1000167411 | 121 |
| 218 | 3300031239 | Ga0265328_10000898 | Ga0265328_100008983 | 121 |
| 219 | 3300031240 | Ga0265320_10045024 | Ga0265320_100450244 | 121 |
| 220 | 3300031240 | Ga0265320_10184403 | Ga0265320_101844032 | 121 |
| 221 | 3300031241 | Ga0265325_10004860 | Ga0265325_100048609 | 121 |
| 222 | 3300031241 | Ga0265325_10271998 | Ga0265325_102719981 | 121 |
| 223 | 3300031242 | Ga0265329_10002795 | Ga0265329_100027953 | 121 |
| 224 | 3300031242 | Ga0265329_10231220 | Ga0265329_102312202 | 121 |
| 225 | 3300031247 | Ga0265340_10007370 | Ga0265340_100073704 | 121 |
| 226 | 3300031249 | Ga0265339_10006923 | Ga0265339_100069232 | 121 |
| 227 | 3300031249 | Ga0265339_10186831 | Ga0265339_101868312 | 121 |
| 228 | 3300031250 | Ga0265331_10022946 | Ga0265331_100229465 | 121 |
| 229 | 3300031251 | Ga0265327_10004631 | Ga0265327_100046315 | 121 |
| 230 | 3300031344 | Ga0265316_10012197 | Ga0265316_100121973 | 121 |
| 231 | 3300031595 | Ga0265313_10009890 | Ga0265313_100098905 | 121 |
| 232 | 3300031711 | Ga0265314_10026978 | Ga0265314_100269787 | 121 |
| 233 | 3300031711 | Ga0265314_10306126 | Ga0265314_103061262 | 121 |
| 234 | 3300031712 | Ga0265342_10019024 | Ga0265342_100190247 | 121 |
| 235 | 3300031712 | Ga0265342_10220014 | Ga0265342_102200142 | 121 |
| 236 | 3300031852 | Ga0307410_10335157 | Ga0307410_103351572 | 121 |
| 237 | 3300031901 | Ga0307406_10249536 | Ga0307406_102495362 | 121 |
| 238 | 3300031995 | Ga0307409_101788781 | Ga0307409_1017887811 | 121 |
| 239 | 3300035089 | Ga0373944_0036426 | Ga0373944_0036426_959_1330 | 121 |
| 240 | 3300035113 | Ga0373936_0002175 | Ga0373936_0002175_2644_3015 | 121 |
| 241 | 3300035116 | Ga0373945_0053688 | Ga0373945_0053688_360_731 | 121 |
| 242 | 3300035119 | Ga0373956_0624241 | Ga0373956_0624241_15_389 | 121 |
| 243 | 3300035170 | Ga0373943_0045871 | Ga0373943_0045871_1309_1680 | 121 |
| 244 | 3300035172 | Ga0373955_0202961 | Ga0373955_0202961_750_1124 | 121 |
| 245 | 3300035410 | Ga0373924_0137809 | Ga0373924_0137809_366_740 | 121 |
| 246 | 3300035692 | Ga0373935_0263577 | Ga0373935_0263577_564_935 | 121 |
| 247 | 3300035695 | Ga0373927_0483850 | Ga0373927_0483850_145_516 | 121 |
| 248 | 3300035724 | Ga0373933_0052021 | Ga0373933_0052021_388_762 | 121 |
| 249 | 3300035725 | Ga0373947_0006531 | Ga0373947_0006531_3529_3900 | 121 |
| 250 | 3300036401 | Ga0373937_0053415 | Ga0373937_0053415_30_404 | 121 |
| 251 | 3300037068 | Ga0373925_0010265 | Ga0373925_0010265_6159_6530 | 121 |
| 252 | 3300037312 | Ga0395899_0416579 | Ga0395899_0416579_466_837 | 121 |
| 253 | 3300037471 | Ga0395905_1907011 | Ga0395905_1907011_117_488 | 121 |
| 254 | 3300038443 | Ga0395901_1241643 | Ga0395901_1241643_61_432 | 121 |
| 255 | 3300039437 | Ga0436365_1713197 | Ga0436365_1713197_215_595 | 121 |
| 256 | 3300039450 | Ga0436363_0904841 | Ga0436363_0904841_125_505 | 121 |
| 257 | 3300044684 | Ga0466966_0002628 | Ga0466966_0002628_5753_6118 | 121 |
| 258 | 3300044684 | Ga0466966_0185510 | Ga0466966_0185510_223_588 | 121 |
| 259 | 3300044693 | Ga0466961_0002298 | Ga0466961_0002298_4914_5279 | 121 |
| 260 | 3300044694 | Ga0466963_0002261 | Ga0466963_0002261_1315_1680 | 121 |
| 261 | 3300044694 | Ga0466963_0022468 | Ga0466963_0022468_1101_1469 | 121 |
| 262 | 3300044694 | Ga0466963_0110438 | Ga0466963_0110438_288_653 | 121 |
| 263 | 3300044694 | Ga0466963_0257392 | Ga0466963_0257392_446_817 | 121 |
| 264 | 3300044706 | Ga0466964_0095056 | Ga0466964_0095056_741_1112 | 121 |
| 265 | 3300044719 | Ga0466971_0000910 | Ga0466971_0000910_9154_9519 | 121 |
| 266 | 3300044842 | Ga0466957_0000349 | Ga0466957_0000349_14445_14810 | 121 |
| 267 | 3300044842 | Ga0466957_0435123 | Ga0466957_0435123_287_658 | 121 |
| 268 | 3300045049 | Ga0466959_0000435 | Ga0466959_0000435_2062_2427 | 121 |
| 269 | 3300045049 | Ga0466959_0013400 | Ga0466959_0013400_5061_5426 | 121 |
| 270 | 3300045049 | Ga0466959_0750195 | Ga0466959_0750195_174_539 | 121 |
| 271 | 3300045836 | Ga0466958_0007727 | Ga0466958_0007727_1775_2140 | 121 |
| 272 | 3300045976 | Ga0466967_0000265 | Ga0466967_0000265_9522_9887 | 121 |
| 273 | 3300045976 | Ga0466967_0000781 | Ga0466967_0000781_16149_16520 | 121 |
| 274 | 3300045976 | Ga0466967_0014620 | Ga0466967_0014620_4804_5175 | 121 |
| 275 | 3300045976 | Ga0466967_0015693 | Ga0466967_0015693_3986_4357 | 121 |
| 276 | 3300045976 | Ga0466967_0021416 | Ga0466967_0021416_3570_3938 | 121 |
| 277 | 3300045976 | Ga0466967_0058281 | Ga0466967_0058281_1178_1549 | 121 |
| 278 | 3300045976 | Ga0466967_0615907 | Ga0466967_0615907_383_751 | 121 |
| 279 | 3300045976 | Ga0466967_1045234 | Ga0466967_1045234_367_738 | 121 |
| 280 | 3300046459 | Ga0495629_0275730 | Ga0495629_0275730_379_750 | 121 |
| 281 | 3300046461 | Ga0495641_0107746 | Ga0495641_0107746_707_1078 | 121 |
| 282 | 3300046461 | Ga0495641_0425669 | Ga0495641_0425669_26_397 | 121 |
| 283 | 3300046462 | Ga0495651_0151737 | Ga0495651_0151737_569_943 | 121 |
| 284 | 3300046462 | Ga0495651_0381103 | Ga0495651_0381103_450_824 | 121 |
| 285 | 3300046463 | Ga0495653_0961513 | Ga0495653_0961513_24_395 | 121 |
| 286 | 3300046475 | Ga0495639_0099624 | Ga0495639_0099624_346_717 | 121 |
| 287 | 3300046477 | Ga0495664_0183925 | Ga0495664_0183925_665_1036 | 121 |
| 288 | 3300046511 | Ga0495608_0023600 | Ga0495608_0023600_2764_3138 | 121 |
| 289 | 3300046516 | Ga0495628_0478322 | Ga0495628_0478322_121_492 | 121 |
| 290 | 3300046517 | Ga0495630_0023500 | Ga0495630_0023500_3774_4145 | 121 |
| 291 | 3300046559 | Ga0495667_0050896 | Ga0495667_0050896_1245_1619 | 121 |
| 292 | 3300046642 | Ga0495634_0065766 | Ga0495634_0065766_138_512 | 121 |
| 293 | 3300046663 | Ga0495635_0151199 | Ga0495635_0151199_1194_1568 | 121 |
| 294 | 3300046675 | Ga0495657_0071504 | Ga0495657_0071504_816_1190 | 121 |
| 295 | 3300046675 | Ga0495657_0095709 | Ga0495657_0095709_638_1009 | 121 |
| 296 | 3300046683 | Ga0495658_0007224 | Ga0495658_0007224_1735_2106 | 121 |
| 297 | 3300046689 | Ga0495613_0169117 | Ga0495613_0169117_90_464 | 121 |
| 298 | 3300046809 | Ga0495600_0058724 | Ga0495600_0058724_915_1289 | 121 |
| 299 | 3300047315 | Ga0495581_0536245 | Ga0495581_0536245_88_459 | 121 |
| 300 | 3300047315 | Ga0495581_0872471 | Ga0495581_0872471_117_488 | 121 |
| 301 | 3300047317 | Ga0495604_0387400 | Ga0495604_0387400_522_896 | 121 |
| 302 | 3300047319 | Ga0495674_0432494 | Ga0495674_0432494_656_1027 | 121 |
| 303 | 3300047321 | Ga0495676_0208900 | Ga0495676_0208900_132_503 | 121 |
| 304 | 3300047322 | Ga0495680_0003274 | Ga0495680_0003274_13471_13845 | 121 |
| 305 | 3300047444 | Ga0495675_0290220 | Ga0495675_0290220_562_936 | 121 |
| 306 | 3300047471 | Ga0495684_0020392 | Ga0495684_0020392_3446_3820 | 121 |
| 307 | 3300048088 | Ga0495602_0474423 | Ga0495602_0474423_350_724 | 121 |
| 308 | 3300048912 | Ga0496109_0569398 | Ga0496109_0569398_407_778 | 121 |
| 309 | 3300048915 | Ga0496112_0454903 | Ga0496112_0454903_145_516 | 121 |
| 310 | 3300048918 | Ga0496115_0610758 | Ga0496115_0610758_334_702 | 121 |
| 311 | 3300049568 | Ga0501031_0004013 | Ga0501031_0004013_1951_2322 | 121 |
| 312 | 3300049568 | Ga0501031_0011292 | Ga0501031_0011292_832_1209 | 121 |
| 313 | 3300049569 | Ga0501032_0035558 | Ga0501032_0035558_2539_2916 | 121 |
| 314 | 3300049569 | Ga0501032_0137322 | Ga0501032_0137322_113_484 | 121 |
| 315 | 3300049570 | Ga0501033_0027299 | Ga0501033_0027299_1484_1855 | 121 |
| 316 | 3300049570 | Ga0501033_0113835 | Ga0501033_0113835_1105_1482 | 121 |
| 317 | 3300049572 | Ga0501036_0000261 | Ga0501036_0000261_27038_27409 | 121 |
| 318 | 3300049572 | Ga0501036_0005893 | Ga0501036_0005893_5372_5749 | 121 |
| 319 | 3300049573 | Ga0501037_0026288 | Ga0501037_0026288_381_752 | 121 |
| 320 | 3300049573 | Ga0501037_0325890 | Ga0501037_0325890_258_635 | 121 |
| 321 | 3300049574 | Ga0501038_0023050 | Ga0501038_0023050_1210_1587 | 121 |
| 322 | 3300049574 | Ga0501038_0081648 | Ga0501038_0081648_1446_1817 | 121 |
| 323 | 3300049575 | Ga0501039_0011079 | Ga0501039_0011079_3338_3709 | 121 |
| 324 | 3300049575 | Ga0501039_0165654 | Ga0501039_0165654_461_832 | 121 |
| 325 | 3300049575 | Ga0501039_0297433 | Ga0501039_0297433_359_736 | 121 |
| 326 | 3300049576 | Ga0501040_0000344 | Ga0501040_0000344_13047_13418 | 121 |
| 327 | 3300049576 | Ga0501040_0013668 | Ga0501040_0013668_495_872 | 121 |
| 328 | 3300049577 | Ga0501041_0001411 | Ga0501041_0001411_8205_8576 | 121 |
| 329 | 3300049577 | Ga0501041_0092786 | Ga0501041_0092786_1457_1834 | 121 |
| 330 | 3300049577 | Ga0501041_0247781 | Ga0501041_0247781_305_676 | 121 |
| 331 | 3300049578 | Ga0501042_0004621 | Ga0501042_0004621_8261_8638 | 121 |
| 332 | 3300049578 | Ga0501042_0022168 | Ga0501042_0022168_3819_4190 | 121 |
| 333 | 3300049578 | Ga0501042_0209885 | Ga0501042_0209885_247_618 | 121 |
| 334 | 3300049579 | Ga0501043_0215405 | Ga0501043_0215405_504_875 | 121 |
| 335 | 3300049580 | Ga0501046_0006023 | Ga0501046_0006023_7677_8048 | 121 |
| 336 | 3300049580 | Ga0501046_0726374 | Ga0501046_0726374_106_477 | 121 |
| 337 | 3300049582 | Ga0501048_0034079 | Ga0501048_0034079_2932_3303 | 121 |
| 338 | 3300049582 | Ga0501048_0186287 | Ga0501048_0186287_578_949 | 121 |
| 339 | 3300049582 | Ga0501048_0694602 | Ga0501048_0694602_298_675 | 121 |
| 340 | 3300049584 | Ga0501068_0010528 | Ga0501068_0010528_3841_4212 | 121 |
| 341 | 3300049585 | Ga0501069_0214676 | Ga0501069_0214676_449_820 | 121 |
| 342 | 3300049587 | Ga0501071_0013850 | Ga0501071_0013850_4283_4654 | 121 |
| 343 | 3300049587 | Ga0501071_0138107 | Ga0501071_0138107_211_588 | 121 |
| 344 | 3300049588 | Ga0501072_0008013 | Ga0501072_0008013_2819_3190 | 121 |
| 345 | 3300049588 | Ga0501072_0468167 | Ga0501072_0468167_581_952 | 121 |
| 346 | 3300049588 | Ga0501072_0587448 | Ga0501072_0587448_150_527 | 121 |
| 347 | 3300049589 | Ga0501073_0129538 | Ga0501073_0129538_1130_1501 | 121 |
| 348 | 3300049590 | Ga0501074_0016767 | Ga0501074_0016767_1020_1391 | 121 |
| 349 | 3300049590 | Ga0501074_0019812 | Ga0501074_0019812_1295_1672 | 121 |
| 350 | 3300049591 | Ga0501075_0001217 | Ga0501075_0001217_12440_12811 | 121 |
| 351 | 3300049591 | Ga0501075_0159348 | Ga0501075_0159348_832_1209 | 121 |
| 352 | 3300049592 | Ga0501076_0000330 | Ga0501076_0000330_24807_25178 | 121 |
| 353 | 3300049592 | Ga0501076_0003143 | Ga0501076_0003143_2455_2832 | 121 |
| 354 | 3300049592 | Ga0501076_0242116 | Ga0501076_0242116_798_1169 | 121 |
| 355 | 3300049593 | Ga0501077_0008570 | Ga0501077_0008570_3920_4291 | 121 |
| 356 | 3300049593 | Ga0501077_0014090 | Ga0501077_0014090_66_443 | 121 |
| 357 | 3300049741 | Ga0501079_0004782 | Ga0501079_0004782_8667_9038 | 121 |
| 358 | 3300049741 | Ga0501079_0015023 | Ga0501079_0015023_881_1258 | 121 |
| 359 | 3300049742 | Ga0501080_0153657 | Ga0501080_0153657_796_1167 | 121 |
| 360 | 3300049743 | Ga0501081_0001194 | Ga0501081_0001194_4970_5341 | 121 |
| 361 | 3300049743 | Ga0501081_0006646 | Ga0501081_0006646_6499_6876 | 121 |
| 362 | 3300049743 | Ga0501081_0997088 | Ga0501081_0997088_176_547 | 121 |
| 363 | 3300049744 | Ga0501083_0016010 | Ga0501083_0016010_3857_4228 | 121 |
| 364 | 3300049744 | Ga0501083_0820310 | Ga0501083_0820310_17_394 | 121 |
| 365 | 3300049822 | Ga0501035_0014888 | Ga0501035_0014888_3941_4312 | 121 |
| 366 | 3300049822 | Ga0501035_0242717 | Ga0501035_0242717_308_679 | 121 |
| 367 | 3300049822 | Ga0501035_0375604 | Ga0501035_0375604_65_442 | 121 |
| 368 | 3300049824 | Ga0501045_0000784 | Ga0501045_0000784_8774_9145 | 121 |
| 369 | 3300049824 | Ga0501045_0002106 | Ga0501045_0002106_2367_2744 | 121 |
| 370 | 3300049824 | Ga0501045_0976966 | Ga0501045_0976966_86_457 | 121 |
| 371 | 3300053077 | Ga0495601_0105291 | Ga0495601_0105291_792_1163 | 121 |
| 372 | 3300053084 | Ga0495595_0114381 | Ga0495595_0114381_837_1208 | 121 |
| 373 | 3300053084 | Ga0495595_0430911 | Ga0495595_0430911_115_489 | 121 |
| 374 | 3300053085 | Ga0495619_0050809 | Ga0495619_0050809_1301_1675 | 121 |
| 375 | 3300054114 | Ga0501084_0000982 | Ga0501084_0000982_14578_14949 | 121 |
| 376 | 3300054114 | Ga0501084_0007211 | Ga0501084_0007211_8506_8883 | 121 |
| 377 | 3300054114 | Ga0501084_0152886 | Ga0501084_0152886_635_1006 | 121 |
| 378 | 3300060353 | Ga0501082_0035686 | Ga0501082_0035686_3290_3661 | 121 |
| 379 | 3300060353 | Ga0501082_0094983 | Ga0501082_0094983_399_776 | 121 |
| 380 | 3300061719 | Ga0466962_0004212 | Ga0466962_0004212_2396_2761 | 121 |
| 381 | 3300061734 | Ga0530510_0006712 | Ga0530510_0006712_2531_2902 | 121 |
| 382 | 3300061734 | Ga0530510_0147608 | Ga0530510_0147608_1101_1478 | 121 |
| 383 | 3300009101 | Ga0105247_11220245 | Ga0105247_112202452 | 122 |
| 384 | 3300035121 | Ga0373960_0112452 | Ga0373960_0112452_94_462 | 122 |
| 385 | 3300005329 | Ga0070683_100004744 | Ga0070683_1000047442 | 123 |
| 386 | 3300005334 | Ga0068869_100919399 | Ga0068869_1009193992 | 123 |
| 387 | 3300005336 | Ga0070680_100243559 | Ga0070680_1002435592 | 123 |
| 388 | 3300005338 | Ga0068868_100144035 | Ga0068868_1001440352 | 123 |
| 389 | 3300005341 | Ga0070691_10313981 | Ga0070691_103139812 | 123 |
| 390 | 3300005343 | Ga0070687_100531590 | Ga0070687_1005315901 | 123 |
| 391 | 3300005343 | Ga0070687_101049616 | Ga0070687_1010496161 | 123 |
| 392 | 3300005353 | Ga0070669_101391095 | Ga0070669_1013910952 | 123 |
| 393 | 3300005354 | Ga0070675_100778454 | Ga0070675_1007784542 | 123 |
| 394 | 3300005354 | Ga0070675_102208542 | Ga0070675_1022085421 | 123 |
| 395 | 3300005355 | Ga0070671_100398071 | Ga0070671_1003980712 | 123 |
| 396 | 3300005356 | Ga0070674_100185349 | Ga0070674_1001853492 | 123 |
| 397 | 3300005356 | Ga0070674_100681019 | Ga0070674_1006810192 | 123 |
| 398 | 3300005366 | Ga0070659_100605198 | Ga0070659_1006051981 | 123 |
| 399 | 3300005440 | Ga0070705_100468713 | Ga0070705_1004687131 | 123 |
| 400 | 3300005455 | Ga0070663_100443280 | Ga0070663_1004432801 | 123 |
| 401 | 3300005456 | Ga0070678_100033988 | Ga0070678_1000339884 | 123 |
| 402 | 3300005458 | Ga0070681_10074014 | Ga0070681_100740143 | 123 |
| 403 | 3300005530 | Ga0070679_100060985 | Ga0070679_1000609855 | 123 |
| 404 | 3300005535 | Ga0070684_100000539 | Ga0070684_10000053917 | 123 |
| 405 | 3300005539 | Ga0068853_100471069 | Ga0068853_1004710692 | 123 |
| 406 | 3300005544 | Ga0070686_101416316 | Ga0070686_1014163161 | 123 |
| 407 | 3300005545 | Ga0070695_101754918 | Ga0070695_1017549181 | 123 |
| 408 | 3300005547 | Ga0070693_100006379 | Ga0070693_1000063792 | 123 |
| 409 | 3300005548 | Ga0070665_100293892 | Ga0070665_1002938923 | 123 |
| 410 | 3300005549 | Ga0070704_100097656 | Ga0070704_1000976562 | 123 |
| 411 | 3300005549 | Ga0070704_100784041 | Ga0070704_1007840411 | 123 |
| 412 | 3300005564 | Ga0070664_100428085 | Ga0070664_1004280852 | 123 |
| 413 | 3300005614 | Ga0068856_100281607 | Ga0068856_1002816073 | 123 |
| 414 | 3300005614 | Ga0068856_100660002 | Ga0068856_1006600022 | 123 |
| 415 | 3300005615 | Ga0070702_100247813 | Ga0070702_1002478132 | 123 |
| 416 | 3300005616 | Ga0068852_100597129 | Ga0068852_1005971292 | 123 |
| 417 | 3300005616 | Ga0068852_100790140 | Ga0068852_1007901402 | 123 |
| 418 | 3300005617 | Ga0068859_102726217 | Ga0068859_1027262172 | 123 |
| 419 | 3300005718 | Ga0068866_10103851 | Ga0068866_101038512 | 123 |
| 420 | 3300005719 | Ga0068861_100533155 | Ga0068861_1005331552 | 123 |
| 421 | 3300005719 | Ga0068861_101112385 | Ga0068861_1011123852 | 123 |
| 422 | 3300005844 | Ga0068862_100800780 | Ga0068862_1008007802 | 123 |
| 423 | 3300006038 | Ga0075365_10309463 | Ga0075365_103094632 | 123 |
| 424 | 3300006175 | Ga0070712_100377024 | Ga0070712_1003770242 | 123 |
| 425 | 3300006175 | Ga0070712_100474704 | Ga0070712_1004747042 | 123 |
| 426 | 3300006178 | Ga0075367_10401549 | Ga0075367_104015492 | 123 |
| 427 | 3300006237 | Ga0097621_100323606 | Ga0097621_1003236062 | 123 |
| 428 | 3300006237 | Ga0097621_100424049 | Ga0097621_1004240492 | 123 |
| 429 | 3300006358 | Ga0068871_100214961 | Ga0068871_1002149612 | 123 |
| 430 | 3300006358 | Ga0068871_100583839 | Ga0068871_1005838392 | 123 |
| 431 | 3300006881 | Ga0068865_100667582 | Ga0068865_1006675822 | 123 |
| 432 | 3300006881 | Ga0068865_101924277 | Ga0068865_1019242771 | 123 |
| 433 | 3300006914 | Ga0075436_100282010 | Ga0075436_1002820102 | 123 |
| 434 | 3300006931 | Ga0097620_102727477 | Ga0097620_1027274772 | 123 |
| 435 | 3300007076 | Ga0075435_100166819 | Ga0075435_1001668192 | 123 |
| 436 | 3300009094 | Ga0111539_10646680 | Ga0111539_106466802 | 123 |
| 437 | 3300009098 | Ga0105245_10012899 | Ga0105245_100128993 | 123 |
| 438 | 3300009098 | Ga0105245_10041206 | Ga0105245_100412064 | 123 |
| 439 | 3300009098 | Ga0105245_10217240 | Ga0105245_102172402 | 123 |
| 440 | 3300009148 | Ga0105243_10044497 | Ga0105243_100444974 | 123 |
| 441 | 3300009174 | Ga0105241_10590458 | Ga0105241_105904582 | 123 |
| 442 | 3300009176 | Ga0105242_10061296 | Ga0105242_100612963 | 123 |
| 443 | 3300009176 | Ga0105242_10195039 | Ga0105242_101950393 | 123 |
| 444 | 3300009177 | Ga0105248_12600148 | Ga0105248_126001481 | 123 |
| 445 | 3300009553 | Ga0105249_11014162 | Ga0105249_110141622 | 123 |
| 446 | 3300009553 | Ga0105249_11141045 | Ga0105249_111410452 | 123 |
| 447 | 3300010375 | Ga0105239_10178074 | Ga0105239_101780743 | 123 |
| 448 | 3300010375 | Ga0105239_11109112 | Ga0105239_111091122 | 123 |
| 449 | 3300010375 | Ga0105239_12250842 | Ga0105239_122508422 | 123 |
| 450 | 3300013102 | Ga0157371_10177588 | Ga0157371_101775882 | 123 |
| 451 | 3300013296 | Ga0157374_11417573 | Ga0157374_114175732 | 123 |
| 452 | 3300013297 | Ga0157378_11595705 | Ga0157378_115957051 | 123 |
| 453 | 3300013306 | Ga0163162_10219805 | Ga0163162_102198052 | 123 |
| 454 | 3300013307 | Ga0157372_11674972 | Ga0157372_116749722 | 123 |
| 455 | 3300013308 | Ga0157375_10165490 | Ga0157375_101654901 | 123 |
| 456 | 3300013308 | Ga0157375_10724876 | Ga0157375_107248761 | 123 |
| 457 | 3300014325 | Ga0163163_11368179 | Ga0163163_113681792 | 123 |
| 458 | 3300014325 | Ga0163163_12109044 | Ga0163163_121090441 | 123 |
| 459 | 3300014326 | Ga0157380_10765366 | Ga0157380_107653662 | 123 |
| 460 | 3300014968 | Ga0157379_10624563 | Ga0157379_106245631 | 123 |
| 461 | 3300014969 | Ga0157376_10555571 | Ga0157376_105555712 | 123 |
| 462 | 3300014969 | Ga0157376_12308853 | Ga0157376_123088531 | 123 |
| 463 | 3300025899 | Ga0207642_10107077 | Ga0207642_101070772 | 123 |
| 464 | 3300025901 | Ga0207688_10049842 | Ga0207688_100498423 | 123 |
| 465 | 3300025901 | Ga0207688_10859823 | Ga0207688_108598232 | 123 |
| 466 | 3300025912 | Ga0207707_10009006 | Ga0207707_100090063 | 123 |
| 467 | 3300025915 | Ga0207693_10326465 | Ga0207693_103264652 | 123 |
| 468 | 3300025917 | Ga0207660_10323497 | Ga0207660_103234972 | 123 |
| 469 | 3300025918 | Ga0207662_10272065 | Ga0207662_102720652 | 123 |
| 470 | 3300025919 | Ga0207657_10421509 | Ga0207657_104215092 | 123 |
| 471 | 3300025919 | Ga0207657_10455941 | Ga0207657_104559412 | 123 |
| 472 | 3300025921 | Ga0207652_10074730 | Ga0207652_100747304 | 123 |
| 473 | 3300025923 | Ga0207681_11024055 | Ga0207681_110240552 | 123 |
| 474 | 3300025924 | Ga0207694_10671161 | Ga0207694_106711612 | 123 |
| 475 | 3300025926 | Ga0207659_10168850 | Ga0207659_101688503 | 123 |
| 476 | 3300025926 | Ga0207659_11815606 | Ga0207659_118156062 | 123 |
| 477 | 3300025927 | Ga0207687_10152821 | Ga0207687_101528212 | 123 |
| 478 | 3300025927 | Ga0207687_10281477 | Ga0207687_102814772 | 123 |
| 479 | 3300025927 | Ga0207687_10341137 | Ga0207687_103411372 | 123 |
| 480 | 3300025932 | Ga0207690_10415765 | Ga0207690_104157652 | 123 |
| 481 | 3300025934 | Ga0207686_10172850 | Ga0207686_101728502 | 123 |
| 482 | 3300025934 | Ga0207686_10402221 | Ga0207686_104022211 | 123 |
| 483 | 3300025935 | Ga0207709_10032476 | Ga0207709_100324763 | 123 |
| 484 | 3300025936 | Ga0207670_10723085 | Ga0207670_107230852 | 123 |
| 485 | 3300025937 | Ga0207669_10532358 | Ga0207669_105323582 | 123 |
| 486 | 3300025937 | Ga0207669_10539968 | Ga0207669_105399682 | 123 |
| 487 | 3300025940 | Ga0207691_10269009 | Ga0207691_102690093 | 123 |
| 488 | 3300025941 | Ga0207711_10817060 | Ga0207711_108170602 | 123 |
| 489 | 3300025941 | Ga0207711_11474236 | Ga0207711_114742362 | 123 |
| 490 | 3300025941 | Ga0207711_11619844 | Ga0207711_116198441 | 123 |
| 491 | 3300025942 | Ga0207689_10591332 | Ga0207689_105913322 | 123 |
| 492 | 3300025942 | Ga0207689_11024206 | Ga0207689_110242062 | 123 |
| 493 | 3300025944 | Ga0207661_10003566 | Ga0207661_100035662 | 123 |
| 494 | 3300025944 | Ga0207661_10660464 | Ga0207661_106604642 | 123 |
| 495 | 3300025945 | Ga0207679_10384033 | Ga0207679_103840332 | 123 |
| 496 | 3300025945 | Ga0207679_11312566 | Ga0207679_113125661 | 123 |
| 497 | 3300025960 | Ga0207651_10294711 | Ga0207651_102947112 | 123 |
| 498 | 3300025961 | Ga0207712_10337323 | Ga0207712_103373231 | 123 |
| 499 | 3300025961 | Ga0207712_10989628 | Ga0207712_109896282 | 123 |
| 500 | 3300025961 | Ga0207712_11006006 | Ga0207712_110060061 | 123 |
| 501 | 3300025981 | Ga0207640_10305509 | Ga0207640_103055092 | 123 |
| 502 | 3300025986 | Ga0207658_11039433 | Ga0207658_110394331 | 123 |
| 503 | 3300026023 | Ga0207677_10130773 | Ga0207677_101307732 | 123 |
| 504 | 3300026023 | Ga0207677_10563192 | Ga0207677_105631922 | 123 |
| 505 | 3300026041 | Ga0207639_10467369 | Ga0207639_104673692 | 123 |
| 506 | 3300026075 | Ga0207708_10243492 | Ga0207708_102434922 | 123 |
| 507 | 3300026078 | Ga0207702_10990978 | Ga0207702_109909782 | 123 |
| 508 | 3300026118 | Ga0207675_100559259 | Ga0207675_1005592592 | 123 |
| 509 | 3300026118 | Ga0207675_100847934 | Ga0207675_1008479342 | 123 |
| 510 | 3300026121 | Ga0207683_10033247 | Ga0207683_100332472 | 123 |
| 511 | 3300026142 | Ga0207698_10849935 | Ga0207698_108499352 | 123 |
| 512 | 3300026142 | Ga0207698_11825483 | Ga0207698_118254831 | 123 |
| 513 | 3300028381 | Ga0268264_10961134 | Ga0268264_109611341 | 123 |
| 514 | 3300035170 | Ga0373943_0045170 | Ga0373943_0045170_309_683 | 123 |
| 515 | 3300035171 | Ga0373946_0235138 | Ga0373946_0235138_180_554 | 123 |
| 516 | 3300035725 | Ga0373947_0295939 | Ga0373947_0295939_320_694 | 123 |
| 517 | 3300037312 | Ga0395899_0023348 | Ga0395899_0023348_4179_4559 | 123 |
| 518 | 3300037418 | Ga0395900_0628158 | Ga0395900_0628158_455_835 | 123 |
| 519 | 3300037466 | Ga0395898_0014525 | Ga0395898_0014525_5186_5566 | 123 |
| 520 | 3300037471 | Ga0395905_0070140 | Ga0395905_0070140_89_469 | 123 |
| 521 | 3300037471 | Ga0395905_0661994 | Ga0395905_0661994_89_463 | 123 |
| 522 | 3300038443 | Ga0395901_0518662 | Ga0395901_0518662_263_637 | 123 |
| 523 | 3300041460 | Ga0451802_0683445 | Ga0451802_0683445_340_714 | 123 |
| 524 | 3300041512 | Ga0451853_0962046 | Ga0451853_0962046_59_433 | 123 |
| 525 | 3300042001 | Ga0439441_023784 | Ga0439441_023784_162_539 | 123 |
| 526 | 3300042008 | Ga0439450_061542 | Ga0439450_061542_406_783 | 123 |
| 527 | 3300042119 | Ga0450915_015225 | Ga0450915_015225_43_420 | 123 |
| 528 | 3300046455 | Ga0495603_0051258 | Ga0495603_0051258_1411_1785 | 123 |
| 529 | 3300046455 | Ga0495603_0436176 | Ga0495603_0436176_33_407 | 123 |
| 530 | 3300046459 | Ga0495629_0015277 | Ga0495629_0015277_2922_3296 | 123 |
| 531 | 3300046461 | Ga0495641_0130355 | Ga0495641_0130355_237_611 | 123 |
| 532 | 3300046491 | Ga0495584_0187884 | Ga0495584_0187884_305_679 | 123 |
| 533 | 3300046517 | Ga0495630_0528620 | Ga0495630_0528620_462_836 | 123 |
| 534 | 3300046642 | Ga0495634_0067785 | Ga0495634_0067785_803_1177 | 123 |
| 535 | 3300046674 | Ga0495588_0436242 | Ga0495588_0436242_32_406 | 123 |
| 536 | 3300046681 | Ga0495647_0218484 | Ga0495647_0218484_456_830 | 123 |
| 537 | 3300046683 | Ga0495658_0473699 | Ga0495658_0473699_261_635 | 123 |
| 538 | 3300046689 | Ga0495613_0011876 | Ga0495613_0011876_5821_6195 | 123 |
| 539 | 3300048903 | Ga0496100_0029557 | Ga0496100_0029557_2846_3244 | 123 |
| 540 | 3300048903 | Ga0496100_0101088 | Ga0496100_0101088_930_1304 | 123 |
| 541 | 3300048904 | Ga0496101_0023532 | Ga0496101_0023532_2051_2425 | 123 |
| 542 | 3300048904 | Ga0496101_0024266 | Ga0496101_0024266_3639_4013 | 123 |
| 543 | 3300048904 | Ga0496101_0137026 | Ga0496101_0137026_892_1266 | 123 |
| 544 | 3300048904 | Ga0496101_0334281 | Ga0496101_0334281_322_696 | 123 |
| 545 | 3300048905 | Ga0496102_0019711 | Ga0496102_0019711_116_490 | 123 |
| 546 | 3300048905 | Ga0496102_0082066 | Ga0496102_0082066_988_1386 | 123 |
| 547 | 3300048905 | Ga0496102_0126921 | Ga0496102_0126921_1529_1903 | 123 |
| 548 | 3300048905 | Ga0496102_0318292 | Ga0496102_0318292_248_622 | 123 |
| 549 | 3300048905 | Ga0496102_0335188 | Ga0496102_0335188_548_922 | 123 |
| 550 | 3300048906 | Ga0496103_0104386 | Ga0496103_0104386_253_651 | 123 |
| 551 | 3300048906 | Ga0496103_0193328 | Ga0496103_0193328_694_1068 | 123 |
| 552 | 3300048907 | Ga0496104_0000319 | Ga0496104_0000319_31106_31480 | 123 |
| 553 | 3300048907 | Ga0496104_0607734 | Ga0496104_0607734_499_873 | 123 |
| 554 | 3300048907 | Ga0496104_0851558 | Ga0496104_0851558_84_458 | 123 |
| 555 | 3300048907 | Ga0496104_0997379 | Ga0496104_0997379_352_726 | 123 |
| 556 | 3300048908 | Ga0496105_0000194 | Ga0496105_0000194_25396_25770 | 123 |
| 557 | 3300048908 | Ga0496105_0156256 | Ga0496105_0156256_1315_1689 | 123 |
| 558 | 3300048908 | Ga0496105_0740634 | Ga0496105_0740634_75_449 | 123 |
| 559 | 3300048908 | Ga0496105_1313953 | Ga0496105_1313953_36_410 | 123 |
| 560 | 3300048909 | Ga0496106_0241093 | Ga0496106_0241093_48_422 | 123 |
| 561 | 3300048910 | Ga0496107_0024981 | Ga0496107_0024981_2295_2669 | 123 |
| 562 | 3300048910 | Ga0496107_0187715 | Ga0496107_0187715_333_707 | 123 |
| 563 | 3300048910 | Ga0496107_0565479 | Ga0496107_0565479_313_687 | 123 |
| 564 | 3300048911 | Ga0496108_0000971 | Ga0496108_0000971_14995_15369 | 123 |
| 565 | 3300048911 | Ga0496108_0296482 | Ga0496108_0296482_1004_1378 | 123 |
| 566 | 3300048911 | Ga0496108_1263181 | Ga0496108_1263181_101_475 | 123 |
| 567 | 3300048912 | Ga0496109_0000458 | Ga0496109_0000458_26340_26714 | 123 |
| 568 | 3300048912 | Ga0496109_0050601 | Ga0496109_0050601_1750_2124 | 123 |
| 569 | 3300048912 | Ga0496109_0381927 | Ga0496109_0381927_235_609 | 123 |
| 570 | 3300048913 | Ga0496110_0002903 | Ga0496110_0002903_7332_7706 | 123 |
| 571 | 3300048913 | Ga0496110_0010229 | Ga0496110_0010229_6797_7171 | 123 |
| 572 | 3300048913 | Ga0496110_0239912 | Ga0496110_0239912_893_1267 | 123 |
| 573 | 3300048914 | Ga0496111_0034631 | Ga0496111_0034631_1132_1506 | 123 |
| 574 | 3300048914 | Ga0496111_0137652 | Ga0496111_0137652_801_1175 | 123 |
| 575 | 3300048914 | Ga0496111_0496374 | Ga0496111_0496374_62_436 | 123 |
| 576 | 3300048915 | Ga0496112_0372830 | Ga0496112_0372830_838_1212 | 123 |
| 577 | 3300048915 | Ga0496112_0936647 | Ga0496112_0936647_384_758 | 123 |
| 578 | 3300048916 | Ga0496113_0089594 | Ga0496113_0089594_1760_2134 | 123 |
| 579 | 3300048916 | Ga0496113_0172567 | Ga0496113_0172567_1294_1668 | 123 |
| 580 | 3300048916 | Ga0496113_0813216 | Ga0496113_0813216_58_432 | 123 |
| 581 | 3300048917 | Ga0496114_0000510 | Ga0496114_0000510_28069_28443 | 123 |
| 582 | 3300048917 | Ga0496114_0004175 | Ga0496114_0004175_10567_10941 | 123 |
| 583 | 3300048917 | Ga0496114_0050597 | Ga0496114_0050597_2126_2500 | 123 |
| 584 | 3300048917 | Ga0496114_0103213 | Ga0496114_0103213_819_1193 | 123 |
| 585 | 3300048918 | Ga0496115_0073089 | Ga0496115_0073089_960_1358 | 123 |
| 586 | 3300048918 | Ga0496115_0388241 | Ga0496115_0388241_140_514 | 123 |
| 587 | 3300048918 | Ga0496115_0771195 | Ga0496115_0771195_47_421 | 123 |
| 588 | 3300049576 | Ga0501040_0134327 | Ga0501040_0134327_647_1021 | 123 |
| 589 | 3300049580 | Ga0501046_0796298 | Ga0501046_0796298_165_539 | 123 |
| 590 | 3300049582 | Ga0501048_0712095 | Ga0501048_0712095_92_466 | 123 |
| 591 | 3300049584 | Ga0501068_0141766 | Ga0501068_0141766_178_552 | 123 |
| 592 | 3300049593 | Ga0501077_0376351 | Ga0501077_0376351_406_780 | 123 |
| 593 | 3300049743 | Ga0501081_0025578 | Ga0501081_0025578_1488_1862 | 123 |
| 594 | 3300050490 | nmdc:mga03n38_764770_c1 | nmdc:mga03n38_764770_c1_130_504 | 123 |
| 595 | 3300050492 | nmdc:mga0yw44_298610_c1 | nmdc:mga0yw44_298610_c1_269_643 | 123 |
| 596 | 3300050494 | nmdc:mga06z11_421127_c1 | nmdc:mga06z11_421127_c1_285_659 | 123 |
| 597 | 3300050511 | nmdc:mga08y16_960391_c1 | nmdc:mga08y16_960391_c1_418_792 | 123 |
| 598 | 3300050513 | nmdc:mga0rr50_178194_c1 | nmdc:mga0rr50_178194_c1_830_1204 | 123 |
| 599 | 3300050513 | nmdc:mga0rr50_238276_c1 | nmdc:mga0rr50_238276_c1_1018_1392 | 123 |
| 600 | 3300054114 | Ga0501084_0079394 | Ga0501084_0079394_425_799 | 123 |
| 601 | 3300060353 | Ga0501082_0015919 | Ga0501082_0015919_5661_6035 | 123 |
| 602 | 3300005336 | Ga0070680_101846063 | Ga0070680_1018460631 | 124 |
| 603 | 3300005436 | Ga0070713_101038896 | Ga0070713_1010388962 | 124 |
| 604 | 3300005530 | Ga0070679_100721614 | Ga0070679_1007216141 | 124 |
| 605 | 3300006163 | Ga0070715_10006063 | Ga0070715_100060632 | 124 |
| 606 | 3300006175 | Ga0070712_100148143 | Ga0070712_1001481431 | 124 |
| 607 | 3300013296 | Ga0157374_10345845 | Ga0157374_103458453 | 124 |
| 608 | 3300025905 | Ga0207685_10028113 | Ga0207685_100281132 | 124 |
| 609 | 3300025917 | Ga0207660_11244943 | Ga0207660_112449431 | 124 |
| 610 | 3300025921 | Ga0207652_10789797 | Ga0207652_107897972 | 124 |
| 611 | 3300042005 | Ga0439448_0037808 | Ga0439448_0037808_295_681 | 124 |
| 612 | 3300044842 | Ga0466957_0044788 | Ga0466957_0044788_1248_1625 | 124 |
| 613 | 3300044901 | Ga0466960_0114570 | Ga0466960_0114570_777_1157 | 124 |
| 614 | 3300045976 | Ga0466967_0187637 | Ga0466967_0187637_1519_1896 | 124 |
| 615 | 3300048903 | Ga0496100_0084589 | Ga0496100_0084589_1368_1766 | 124 |
| 616 | 3300048904 | Ga0496101_0022064 | Ga0496101_0022064_969_1367 | 124 |
| 617 | 3300048905 | Ga0496102_0905256 | Ga0496102_0905256_259_657 | 124 |
| 618 | 3300048909 | Ga0496106_0023028 | Ga0496106_0023028_810_1208 | 124 |
| 619 | 3300048910 | Ga0496107_0009958 | Ga0496107_0009958_5670_6068 | 124 |
| 620 | 3300003373 | JGI25407J50210_10003190 | JGI25407J50210_100031904 | 125 |
| 621 | 3300005981 | Ga0081538_10000809 | Ga0081538_1000080916 | 125 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d30-assembly1.cif.gz_A | crystal structure of cytidine deaminase cdd-2 (ba4525) from bacillus anthracis at 2.40a resolution | 0.8989 | 6 | 120 |
| 1mq0-assembly1.cif.gz_A | crystal structure of human cytidine deaminase | 0.8895 | 5 | 121 |
| 3dmo-assembly1.cif.gz_C | 1.6 a crystal structure of cytidine deaminase from burkholderia pseudomallei | 0.8864 | 1 | 121 |
| 1jtk-assembly1.cif.gz_A | crystal structure of cytidine deaminase from bacillus subtilis in complex with the inhibitor tetrahydrodeoxyuridine | 0.8846 | 6 | 122 |
| 1ux0-assembly1.cif.gz_B-2 | bacillus subtilis cytidine deaminase with an arg56 - gln substitution | 0.8838 | 6 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_R4GEK6_29_122_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.9613 | 28 | 43 | 2.60.40.10 |
| af_F4KH86_156_399_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.9154 | 76 | 103 | 3.40.140.10 |
| af_Q4D5I0_402_512_3.30.1490.100 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;DNA polymerase, Y-family, little finger domain | 0.8811 | 28 | 43 | 3.30.1490.100 |
| 4eg2C02 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.869 | 1 | 79 | 3.40.140.10 |
| af_Q2FY04_3_129_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8625 | 1 | 122 | 3.40.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538EGM8-F1-model_v4 | Cytidine deaminase (EC 3.5.4.5) | 0.9595 | 1 | 125 |
GO:0004126
GO:0005829 GO:0008270 GO:0009972 GO:0042802 |
| AF-A0A7W0PZU2-F1-model_v4 | Cytidine deaminase (EC 3.5.4.5) | 0.9537 | 1 | 123 |
GO:0004126
GO:0005829 GO:0008270 GO:0009972 GO:0042802 |
| AF-A0A353HWN1-F1-model_v4 | Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase) | 0.9523 | 7 | 94 |
GO:0004126
GO:0005829 GO:0008270 GO:0009972 |
| AF-A0A538EGM8-F1-model_v4 | Cytidine deaminase (EC 3.5.4.5) | 0.952 | 1 | 125 |
GO:0004126
GO:0005829 GO:0008270 GO:0009972 GO:0042802 |
| AF-A0A538D7I5-F1-model_v4 | Cytidine deaminase (EC 3.5.4.5) | 0.9489 | 1 | 85 |
GO:0004126
GO:0005829 GO:0008270 GO:0009972 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar