F469995

General Info

Members Datasets Scaffolds Average Seq Length
621 248 1242 248

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10249532|Ga0157378_102495321
Length 304
Sequence LLAPAFNNDSLVNEAFQHPIMRCPDNFYYWRGNKQWICNSSILVAKIADSAAISPKLKKMKLDILAIGVHPDDVELGCSGTLLNESRLGKKTGILDLTQGELGTRGTVATRYEEAAQSAKILGVEVRENLKMRDGFFVNDETHQRLLISAIRKYQPEIVLANILDDRHPDHGRAGHLIADACFLSGLVKIETKDENGNSQDRWRPKQVLHYLQDWYHEPDLLVDITAVFEQRMQSILAYQTQFHSRKAGPEEPQTYISTPDFLEAVTARARLMGKRIGVKYAEGFVTEKKIGIRNLDALVSIET

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
162 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
163 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
164 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
165 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
236 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
237 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
238 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
241 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
242 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
243 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
244 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
245 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
246 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
247 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
248 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.38
Nodule 0
Rhizoplane 0.81
Rhizosphere 93.56
Stem 0
Stem Tuber 0
Unclassified 14.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10249532 3300013297 Bacteria 1699
2 MBSR1b_contig_14028215 2162886012 Bacteria 1171
3 MBSR1b_contig_8237559 2162886012 Bacteria 1171
4 MBSR1b_contig_8586871 2162886012 Bacteria 1171
5 JGI24751J29686_10001206 3300002459 Bacteria 5477
6 rootL2_10026254 3300003322 Bacteria 1537
7 rootL2_10334457 3300003322 Unclassified 1515
8 rootH1_10025210 3300003323 Bacteria 12643
9 rootH1_10149723 3300003323 Bacteria 1864
10 rootH1_10149724 3300003323 Bacteria 1147
11 Ga0065712_10010653 3300005290 Bacteria 2753
12 Ga0065712_10168228 3300005290 Unclassified 1259
13 Ga0065712_10206008 3300005290 Unclassified 1090
14 Ga0065715_10295027 3300005293 Bacteria 1054
15 Ga0065707_10309099 3300005295 Unclassified 988
16 Ga0070676_10025781 3300005328 Bacteria 3325
17 Ga0070676_10262312 3300005328 Unclassified 1157
18 Ga0070683_100004631 3300005329 Bacteria 11359
19 Ga0070683_100011439 3300005329 Bacteria 7671
20 Ga0070683_100113430 3300005329 Bacteria 2558
21 Ga0070690_100019911 3300005330 Bacteria 4082
22 Ga0070690_100170701 3300005330 Bacteria 1496
23 Ga0070670_100048717 3300005331 Unclassified 3646
24 Ga0070670_100072517 3300005331 Bacteria 2957
25 Ga0070670_100092893 3300005331 Bacteria 2595
26 Ga0070670_100130845 3300005331 Bacteria 2167
27 Ga0070670_100248835 3300005331 Unclassified 1548
28 Ga0070670_100250979 3300005331 Bacteria 1541
29 Ga0070670_100354472 3300005331 Bacteria 1289
30 Ga0070677_10001794 3300005333 Bacteria 6789
31 Ga0070677_10100805 3300005333 Bacteria 1273
32 Ga0068869_100008279 3300005334 Bacteria 6699
33 Ga0068869_100017602 3300005334 Bacteria 4847
34 Ga0068869_100078482 3300005334 Bacteria 2459
35 Ga0068869_100147644 3300005334 Bacteria 1821
36 Ga0068869_100582078 3300005334 Unclassified 944
37 Ga0070666_10000135 3300005335 Bacteria 51126
38 Ga0070666_10006706 3300005335 Bacteria 7087
39 Ga0070666_10023370 3300005335 Bacteria 4024
40 Ga0070666_10619451 3300005335 Unclassified 790
41 Ga0070682_100253979 3300005337 Bacteria 1269
42 Ga0068868_100013667 3300005338 Bacteria 5962
43 Ga0068868_100023876 3300005338 Bacteria 4633
44 Ga0068868_100052068 3300005338 Bacteria 3223
45 Ga0068868_100063507 3300005338 Bacteria 2929
46 Ga0068868_100248522 3300005338 Bacteria 1496
47 Ga0070689_100020116 3300005340 Unclassified 4949
48 Ga0070689_100055284 3300005340 Unclassified 3075
49 Ga0070689_100118384 3300005340 Unclassified 2113
50 Ga0070689_100233982 3300005340 Bacteria 1511
51 Ga0070689_100604593 3300005340 Bacteria 950
52 Ga0070687_100032832 3300005343 Bacteria 2557
53 Ga0070661_100003972 3300005344 Bacteria 10173
54 Ga0070661_100024577 3300005344 Bacteria 4321
55 Ga0070661_100036304 3300005344 Unclassified 3582
56 Ga0070668_100049495 3300005347 Bacteria 3233
57 Ga0070668_100174319 3300005347 Bacteria 1753
58 Ga0070669_100567642 3300005353 Unclassified 948
59 Ga0070675_100117133 3300005354 Bacteria 2260
60 Ga0070671_100008005 3300005355 Bacteria 8461
61 Ga0070671_100073117 3300005355 Bacteria 2863
62 Ga0070671_100094064 3300005355 Bacteria 2511
63 Ga0070671_100514724 3300005355 Bacteria 1030
64 Ga0070674_100102997 3300005356 Unclassified 2083
65 Ga0070674_100255289 3300005356 Unclassified 1379
66 Ga0070673_100061285 3300005364 Unclassified 2984
67 Ga0070673_100119283 3300005364 Bacteria 2198
68 Ga0070673_100131643 3300005364 Bacteria 2099
69 Ga0070673_100162187 3300005364 Bacteria 1902
70 Ga0070673_100721911 3300005364 Unclassified 916
71 Ga0070688_100000797 3300005365 Bacteria 15547
72 Ga0070688_100037727 3300005365 Bacteria 2946
73 Ga0070688_100243000 3300005365 Bacteria 1278
74 Ga0070659_100002732 3300005366 Bacteria 12552
75 Ga0070667_100007115 3300005367 Bacteria 9303
76 Ga0070667_100026170 3300005367 Bacteria 4852
77 Ga0070667_100087878 3300005367 Bacteria 2668
78 Ga0070667_100090221 3300005367 Bacteria 2634
79 Ga0070667_100094204 3300005367 Bacteria 2580
80 Ga0070667_100653668 3300005367 Unclassified 971
81 Ga0070701_10016422 3300005438 Bacteria 3442
82 Ga0070700_100095203 3300005441 Bacteria 1951
83 Ga0070700_100101505 3300005441 Bacteria 1896
84 Ga0070663_100246423 3300005455 Bacteria 1413
85 Ga0070663_100514782 3300005455 Bacteria 995
86 Ga0070678_100115240 3300005456 Bacteria 2109
87 Ga0070678_100137570 3300005456 Unclassified 1950
88 Ga0070678_100185390 3300005456 Bacteria 1707
89 Ga0070678_100244723 3300005456 Bacteria 1501
90 Ga0070678_100365359 3300005456 Bacteria 1245
91 Ga0070678_100543784 3300005456 Bacteria 1030
92 Ga0070662_100005152 3300005457 Bacteria 8336
93 Ga0070662_100069184 3300005457 Unclassified 2597
94 Ga0068867_100026189 3300005459 Bacteria 4186
95 Ga0068867_100049670 3300005459 Bacteria 3089
96 Ga0068867_100121730 3300005459 Unclassified 2017
97 Ga0068867_100128333 3300005459 Bacteria 1967
98 Ga0068867_100134048 3300005459 Bacteria 1928
99 Ga0068867_100136047 3300005459 Bacteria 1915
100 Ga0068867_100405624 3300005459 Unclassified 1151
101 Ga0070685_10021915 3300005466 Bacteria 3476
102 Ga0070685_10037819 3300005466 Bacteria 2735
103 Ga0070685_10046832 3300005466 Bacteria 2484
104 Ga0070685_10051544 3300005466 Bacteria 2379
105 Ga0070685_10344546 3300005466 Bacteria 1017
106 Ga0070698_100001497 3300005471 Bacteria 25950
107 Ga0070698_100010867 3300005471 Bacteria 9686
108 Ga0070684_100002706 3300005535 Bacteria 13093
109 Ga0070684_100062723 3300005535 Unclassified 3256
110 Ga0068853_100002920 3300005539 Bacteria 12997
111 Ga0068853_100205366 3300005539 Bacteria 1794
112 Ga0070672_100061466 3300005543 Bacteria 2961
113 Ga0070672_100079600 3300005543 Bacteria 2623
114 Ga0070672_100098607 3300005543 Bacteria 2367
115 Ga0070672_100406316 3300005543 Bacteria 1168
116 Ga0070672_100510584 3300005543 Bacteria 1040
117 Ga0070693_100199785 3300005547 Bacteria 1298
118 Ga0070665_100130723 3300005548 Bacteria 2513
119 Ga0070704_100452291 3300005549 Bacteria 1106
120 Ga0068855_100003029 3300005563 Bacteria 20562
121 Ga0068855_100007823 3300005563 Bacteria 12912
122 Ga0070664_100004774 3300005564 Bacteria 10857
123 Ga0070664_100034556 3300005564 Bacteria 4241
124 Ga0070664_100057696 3300005564 Bacteria 3300
125 Ga0070664_100060571 3300005564 Unclassified 3223
126 Ga0070664_100658997 3300005564 Bacteria 973
127 Ga0068857_100015228 3300005577 Bacteria 6711
128 Ga0068857_100018587 3300005577 Bacteria 6098
129 Ga0068857_100049312 3300005577 Bacteria 3735
130 Ga0068857_100170871 3300005577 Bacteria 1976
131 Ga0068857_100562805 3300005577 Bacteria 1075
132 Ga0068854_100013566 3300005578 Bacteria 5353
133 Ga0068854_100038918 3300005578 Bacteria 3347
134 Ga0068854_100086750 3300005578 Bacteria 2321
135 Ga0068854_100318816 3300005578 Bacteria 1263
136 Ga0068856_100553535 3300005614 Bacteria 1171
137 Ga0068852_100003713 3300005616 Bacteria 10697
138 Ga0068852_100004864 3300005616 Bacteria 9542
139 Ga0068852_100154668 3300005616 Bacteria 2135
140 Ga0068859_100000127 3300005617 Bacteria 72136
141 Ga0068859_100020688 3300005617 Bacteria 6603
142 Ga0068859_100021414 3300005617 Bacteria 6488
143 Ga0068859_100064949 3300005617 Unclassified 3683
144 Ga0068859_100065804 3300005617 Bacteria 3658
145 Ga0068859_100069771 3300005617 Unclassified 3550
146 Ga0068859_100157420 3300005617 Bacteria 2350
147 Ga0068859_100225170 3300005617 Bacteria 1963
148 Ga0068859_100238545 3300005617 Bacteria 1907
149 Ga0068864_100053379 3300005618 Bacteria 3486
150 Ga0068864_100104838 3300005618 Bacteria 2512
151 Ga0068864_100114608 3300005618 Bacteria 2404
152 Ga0068864_100184387 3300005618 Bacteria 1910
153 Ga0068866_10031840 3300005718 Bacteria 2544
154 Ga0068861_100010078 3300005719 Bacteria 6553
155 Ga0068861_100105363 3300005719 Bacteria 2251
156 Ga0068851_10036193 3300005834 Unclassified 2471
157 Ga0068870_10009000 3300005840 Bacteria 4518
158 Ga0068870_10386566 3300005840 Unclassified 907
159 Ga0068863_100001425 3300005841 Bacteria 23686
160 Ga0068863_100023248 3300005841 Bacteria 5924
161 Ga0068863_100034806 3300005841 Bacteria 4797
162 Ga0068863_100059614 3300005841 Bacteria 3611
163 Ga0068863_100417870 3300005841 Bacteria 1313
164 Ga0068863_100423479 3300005841 Bacteria 1304
165 Ga0068858_100002322 3300005842 Bacteria 19226
166 Ga0068858_100105591 3300005842 Bacteria 2628
167 Ga0068858_100276628 3300005842 Bacteria 1598
168 Ga0068858_100853790 3300005842 Bacteria 889
169 Ga0068858_100880195 3300005842 Bacteria 875
170 Ga0068860_100002119 3300005843 Bacteria 20918
171 Ga0068860_100013041 3300005843 Bacteria 8157
172 Ga0068860_100018651 3300005843 Bacteria 6747
173 Ga0068860_100111999 3300005843 Bacteria 2609
174 Ga0068860_100155138 3300005843 Bacteria 2206
175 Ga0068860_100218461 3300005843 Bacteria 1851
176 Ga0068860_100337363 3300005843 Bacteria 1481
177 Ga0068862_100226233 3300005844 Bacteria 1695
178 Ga0068862_100724962 3300005844 Bacteria 965
179 Ga0068862_100779596 3300005844 Bacteria 932
180 Ga0070715_10005844 3300006163 Bacteria 4141
181 Ga0075366_10011952 3300006195 Bacteria 4916
182 Ga0075366_10121874 3300006195 Bacteria 1571
183 Ga0097621_100000586 3300006237 Bacteria 25626
184 Ga0097621_100002660 3300006237 Bacteria 12228
185 Ga0097621_100007600 3300006237 Bacteria 7766
186 Ga0097621_100045109 3300006237 Bacteria 3559
187 Ga0097621_100107935 3300006237 Unclassified 2350
188 Ga0097621_100126227 3300006237 Bacteria 2173
189 Ga0068871_100231229 3300006358 Bacteria 1605
190 Ga0068871_100357663 3300006358 Bacteria 1293
191 Ga0075428_100049741 3300006844 Bacteria 4599
192 Ga0075428_100179564 3300006844 Bacteria 2292
193 Ga0075430_100218807 3300006846 Bacteria 1580
194 Ga0075431_100032821 3300006847 Bacteria 5350
195 Ga0075429_100002013 3300006880 Bacteria 16893
196 Ga0075429_100053015 3300006880 Bacteria 3529
197 Ga0068865_100173820 3300006881 Bacteria 1653
198 Ga0068865_100421639 3300006881 Unclassified 1097
199 Ga0097620_100000127 3300006931 Bacteria 72136
200 Ga0097620_100020689 3300006931 Bacteria 6603
201 Ga0097620_100021415 3300006931 Bacteria 6488
202 Ga0097620_100064950 3300006931 Unclassified 3683
203 Ga0097620_100065800 3300006931 Bacteria 3658
204 Ga0097620_100069772 3300006931 Unclassified 3550
205 Ga0097620_100157418 3300006931 Bacteria 2350
206 Ga0097620_100190652 3300006931 Bacteria 2134
207 Ga0097620_100225172 3300006931 Bacteria 1963
208 Ga0097620_100238522 3300006931 Bacteria 1907
209 Ga0105240_10000513 3300009093 Bacteria 71427
210 Ga0105240_10013866 3300009093 Bacteria 11038
211 Ga0105240_10042091 3300009093 Bacteria 5823
212 Ga0105240_10280308 3300009093 Bacteria 1915
213 Ga0105240_10291122 3300009093 Bacteria 1872
214 Ga0111539_10001795 3300009094 Bacteria 28548
215 Ga0111539_10082729 3300009094 Bacteria 3776
216 Ga0105247_10004365 3300009101 Bacteria 9034
217 Ga0114129_10082280 3300009147 Bacteria 4474
218 Ga0114129_10154899 3300009147 Unclassified 3134
219 Ga0114129_10164802 3300009147 Bacteria 3026
220 Ga0105243_10443819 3300009148 Unclassified 1216
221 Ga0105243_10593174 3300009148 Unclassified 1065
222 Ga0105241_10058844 3300009174 Bacteria 2952
223 Ga0105241_10395990 3300009174 Bacteria 1210
224 Ga0105241_10935767 3300009174 Unclassified 807
225 Ga0105242_10012895 3300009176 Bacteria 6442
226 Ga0105242_10043275 3300009176 Bacteria 3643
227 Ga0105242_10129340 3300009176 Bacteria 2177
228 Ga0105242_10145766 3300009176 Bacteria 2059
229 Ga0105242_10161501 3300009176 Bacteria 1962
230 Ga0105242_10257315 3300009176 Bacteria 1575
231 Ga0105248_10088776 3300009177 Bacteria 3479
232 Ga0105248_10889993 3300009177 Bacteria 1005
233 Ga0105237_10000528 3300009545 Bacteria 53756
234 Ga0105237_10000959 3300009545 Bacteria 38808
235 Ga0105237_10013498 3300009545 Bacteria 8560
236 Ga0105237_10021302 3300009545 Bacteria 6666
237 Ga0105238_10045942 3300009551 Bacteria 4410
238 Ga0105249_10004091 3300009553 Bacteria 12592
239 Ga0105249_10013937 3300009553 Bacteria 7106
240 Ga0105249_10019556 3300009553 Bacteria 6043
241 Ga0105249_10020018 3300009553 Bacteria 5975
242 Ga0105249_10053584 3300009553 Bacteria 3687
243 Ga0105249_10083226 3300009553 Unclassified 2978
244 Ga0105249_10095705 3300009553 Bacteria 2785
245 Ga0105239_10000314 3300010375 Bacteria 71313
246 Ga0105239_10000853 3300010375 Bacteria 43358
247 Ga0105239_10699122 3300010375 Bacteria 1159
248 Ga0105246_10010437 3300011119 Bacteria 5748
249 Ga0105246_10031640 3300011119 Bacteria 3502
250 Ga0157373_10025136 3300013100 Unclassified 4311
251 Ga0157370_10001415 3300013104 Bacteria 29777
252 Ga0157370_10090306 3300013104 Bacteria 2877
253 Ga0157369_10071400 3300013105 Bacteria 3727
254 Ga0157374_10131353 3300013296 Bacteria 2424
255 Ga0157374_10212938 3300013296 Bacteria 1895
256 Ga0157374_10254801 3300013296 Bacteria 1727
257 Ga0157378_10007196 3300013297 Bacteria 9719
258 Ga0157378_10059214 3300013297 Bacteria 3417
259 Ga0157378_10067150 3300013297 Bacteria 3213
260 Ga0157378_10073652 3300013297 Unclassified 3071
261 Ga0157378_10222722 3300013297 Bacteria 1794
262 Ga0157378_10291777 3300013297 Bacteria 1576
263 Ga0157378_10454191 3300013297 Bacteria 1272
264 Ga0157378_10751280 3300013297 Bacteria 998
265 Ga0163162_10000101 3300013306 Bacteria 77114
266 Ga0163162_10002080 3300013306 Bacteria 18806
267 Ga0163162_10018896 3300013306 Bacteria 6758
268 Ga0163162_10031957 3300013306 Bacteria 5225
269 Ga0163162_10054154 3300013306 Bacteria 4035
270 Ga0163162_10209333 3300013306 Bacteria 2080
271 Ga0157372_10000804 3300013307 Bacteria 34050
272 Ga0157372_10046610 3300013307 Bacteria 4812
273 Ga0157372_10163039 3300013307 Bacteria 2577
274 Ga0157375_10000118 3300013308 Bacteria 77255
275 Ga0157375_10007574 3300013308 Bacteria 9494
276 Ga0157375_10043460 3300013308 Bacteria 4359
277 Ga0157375_10046139 3300013308 Bacteria 4246
278 Ga0157375_10077744 3300013308 Bacteria 3349
279 Ga0157375_10124965 3300013308 Unclassified 2686
280 Ga0157375_10144543 3300013308 Unclassified 2508
281 Ga0157375_10276112 3300013308 Bacteria 1843
282 Ga0157375_10379490 3300013308 Bacteria 1580
283 Ga0157375_10455450 3300013308 Bacteria 1445
284 Ga0157375_10456116 3300013308 Bacteria 1444
285 Ga0157375_10897890 3300013308 Bacteria 1030
286 Ga0163163_10000078 3300014325 Bacteria 107017
287 Ga0163163_10000636 3300014325 Bacteria 30223
288 Ga0163163_10107139 3300014325 Bacteria 2821
289 Ga0163163_10182571 3300014325 Bacteria 2146
290 Ga0163163_10182792 3300014325 Bacteria 2144
291 Ga0163163_10448001 3300014325 Unclassified 1351
292 Ga0163163_10601975 3300014325 Bacteria 1162
293 Ga0157380_10008693 3300014326 Bacteria 7259
294 Ga0157380_10032056 3300014326 Bacteria 4039
295 Ga0157380_10055217 3300014326 Unclassified 3153
296 Ga0157377_10004058 3300014745 Bacteria 6682
297 Ga0157377_10084304 3300014745 Bacteria 1864
298 Ga0157377_10098499 3300014745 Bacteria 1738
299 Ga0157377_10217671 3300014745 Bacteria 1221
300 Ga0157379_10021147 3300014968 Bacteria 5758
301 Ga0157379_10045049 3300014968 Bacteria 3938
302 Ga0157379_10158830 3300014968 Bacteria 2040
303 Ga0157376_10000378 3300014969 Bacteria 29031
304 Ga0157376_10001271 3300014969 Bacteria 16567
305 Ga0157376_10004501 3300014969 Bacteria 9711
306 Ga0157376_10062805 3300014969 Bacteria 3127
307 Ga0157376_10118185 3300014969 Bacteria 2345
308 Ga0157376_10119413 3300014969 Bacteria 2334
309 Ga0157376_10221579 3300014969 Unclassified 1752
310 Ga0157376_10681150 3300014969 Unclassified 1031
311 Ga0157376_10945314 3300014969 Unclassified 882
312 Ga0163161_10003903 3300017792 Bacteria 10455
313 Ga0163161_10022509 3300017792 Bacteria 4439
314 Ga0163161_10040002 3300017792 Bacteria 3367
315 Ga0163161_10085477 3300017792 Bacteria 2327
316 Ga0163161_10515423 3300017792 Bacteria 976
317 Ga0163161_10558794 3300017792 Unclassified 939
318 Ga0207697_10038539 3300025315 Bacteria 1960
319 Ga0207656_10174391 3300025321 Unclassified 1029
320 Ga0207682_10008876 3300025893 Bacteria 3975
321 Ga0207682_10045807 3300025893 Bacteria 1796
322 Ga0207688_10009233 3300025901 Bacteria 5373
323 Ga0207680_10000057 3300025903 Bacteria 50978
324 Ga0207680_10005367 3300025903 Bacteria 6119
325 Ga0207680_10160814 3300025903 Bacteria 1505
326 Ga0207680_10530106 3300025903 Unclassified 840
327 Ga0207647_10006207 3300025904 Bacteria 8710
328 Ga0207647_10011499 3300025904 Bacteria 6205
329 Ga0207645_10002535 3300025907 Bacteria 14293
330 Ga0207645_10011599 3300025907 Bacteria 6010
331 Ga0207643_10008176 3300025908 Bacteria 5615
332 Ga0207643_10021539 3300025908 Bacteria 3542
333 Ga0207643_10042481 3300025908 Bacteria 2564
334 Ga0207643_10166266 3300025908 Bacteria 1329
335 Ga0207654_10430202 3300025911 Bacteria 922
336 Ga0207695_10000084 3300025913 Bacteria 282392
337 Ga0207695_10000323 3300025913 Bacteria 114265
338 Ga0207695_10065612 3300025913 Bacteria 3732
339 Ga0207695_10091022 3300025913 Bacteria 3065
340 Ga0207695_10416126 3300025913 Unclassified 1228
341 Ga0207671_10001538 3300025914 Bacteria 26445
342 Ga0207671_10002788 3300025914 Bacteria 18238
343 Ga0207671_10033043 3300025914 Bacteria 3851
344 Ga0207671_10099218 3300025914 Bacteria 2204
345 Ga0207657_10401200 3300025919 Unclassified 1078
346 Ga0207649_10052049 3300025920 Bacteria 2539
347 Ga0207649_10054025 3300025920 Bacteria 2498
348 Ga0207681_10024153 3300025923 Unclassified 3898
349 Ga0207681_10169446 3300025923 Bacteria 1654
350 Ga0207694_10073329 3300025924 Bacteria 2678
351 Ga0207650_10032543 3300025925 Bacteria 3771
352 Ga0207650_10086410 3300025925 Bacteria 2387
353 Ga0207650_10217436 3300025925 Bacteria 1537
354 Ga0207650_10227181 3300025925 Unclassified 1504
355 Ga0207650_10237561 3300025925 Unclassified 1472
356 Ga0207659_10128529 3300025926 Bacteria 1952
357 Ga0207659_10141909 3300025926 Bacteria 1866
358 Ga0207644_10008932 3300025931 Bacteria 6565
359 Ga0207644_10065642 3300025931 Unclassified 2640
360 Ga0207644_10133464 3300025931 Bacteria 1904
361 Ga0207644_10293245 3300025931 Bacteria 1309
362 Ga0207690_10057952 3300025932 Bacteria 2618
363 Ga0207690_10587274 3300025932 Unclassified 908
364 Ga0207706_10020423 3300025933 Bacteria 5955
365 Ga0207706_10079524 3300025933 Bacteria 2883
366 Ga0207686_10006728 3300025934 Bacteria 6193
367 Ga0207686_10069603 3300025934 Bacteria 2258
368 Ga0207686_10075107 3300025934 Bacteria 2187
369 Ga0207686_10078569 3300025934 Bacteria 2146
370 Ga0207686_10096504 3300025934 Unclassified 1964
371 Ga0207709_10587488 3300025935 Unclassified 880
372 Ga0207670_10011453 3300025936 Bacteria 5151
373 Ga0207670_10012045 3300025936 Bacteria 5042
374 Ga0207670_10144172 3300025936 Bacteria 1759
375 Ga0207670_10201711 3300025936 Bacteria 1512
376 Ga0207691_10035080 3300025940 Bacteria 4660
377 Ga0207691_10038775 3300025940 Bacteria 4409
378 Ga0207691_10079706 3300025940 Bacteria 2947
379 Ga0207691_10153081 3300025940 Bacteria 2027
380 Ga0207711_10344041 3300025941 Bacteria 1381
381 Ga0207689_10000482 3300025942 Bacteria 37605
382 Ga0207689_10002539 3300025942 Bacteria 16945
383 Ga0207689_10025673 3300025942 Bacteria 4936
384 Ga0207689_10028313 3300025942 Bacteria 4687
385 Ga0207689_10061519 3300025942 Bacteria 3088
386 Ga0207661_10011446 3300025944 Bacteria 6429
387 Ga0207661_10048223 3300025944 Unclassified 3383
388 Ga0207679_10008992 3300025945 Bacteria 6383
389 Ga0207679_10010266 3300025945 Bacteria 6025
390 Ga0207679_10045764 3300025945 Bacteria 3167
391 Ga0207667_10000135 3300025949 Bacteria 111565
392 Ga0207667_10030139 3300025949 Bacteria 5871
393 Ga0207651_10009245 3300025960 Bacteria 5381
394 Ga0207651_10041730 3300025960 Bacteria 3048
395 Ga0207651_10075832 3300025960 Bacteria 2401
396 Ga0207651_10181399 3300025960 Bacteria 1670
397 Ga0207651_10189260 3300025960 Bacteria 1640
398 Ga0207651_10535100 3300025960 Bacteria 1017
399 Ga0207712_10001348 3300025961 Bacteria 16806
400 Ga0207712_10003852 3300025961 Bacteria 9475
401 Ga0207712_10016748 3300025961 Unclassified 4752
402 Ga0207712_10116540 3300025961 Unclassified 2013
403 Ga0207712_10121173 3300025961 Unclassified 1979
404 Ga0207668_10051291 3300025972 Bacteria 2849
405 Ga0207668_10445557 3300025972 Bacteria 1104
406 Ga0207640_10005009 3300025981 Bacteria 7201
407 Ga0207640_10077923 3300025981 Bacteria 2254
408 Ga0207640_10288333 3300025981 Bacteria 1293
409 Ga0207658_10019785 3300025986 Bacteria 4658
410 Ga0207658_10036662 3300025986 Bacteria 3517
411 Ga0207658_10049911 3300025986 Bacteria 3077
412 Ga0207658_10129136 3300025986 Bacteria 2028
413 Ga0207658_10315537 3300025986 Bacteria 1352
414 Ga0207658_10325513 3300025986 Bacteria 1332
415 Ga0207658_10408204 3300025986 Bacteria 1195
416 Ga0207677_10023328 3300026023 Bacteria 3820
417 Ga0207677_10076582 3300026023 Bacteria 2382
418 Ga0207677_10112629 3300026023 Bacteria 2029
419 Ga0207677_10140129 3300026023 Bacteria 1850
420 Ga0207677_10706347 3300026023 Bacteria 895
421 Ga0207677_10740473 3300026023 Bacteria 875
422 Ga0207703_10000924 3300026035 Bacteria 28603
423 Ga0207703_10042065 3300026035 Bacteria 3663
424 Ga0207703_10129441 3300026035 Bacteria 2178
425 Ga0207703_10538616 3300026035 Bacteria 1100
426 Ga0207639_10002438 3300026041 Bacteria 12502
427 Ga0207639_10010753 3300026041 Bacteria 6341
428 Ga0207639_10194944 3300026041 Bacteria 1733
429 Ga0207678_10047731 3300026067 Bacteria 3702
430 Ga0207708_10143909 3300026075 Bacteria 1872
431 Ga0207708_10446242 3300026075 Bacteria 1077
432 Ga0207702_10008334 3300026078 Bacteria 8751
433 Ga0207702_10559417 3300026078 Bacteria 1119
434 Ga0207641_10000229 3300026088 Bacteria 72315
435 Ga0207641_10006622 3300026088 Bacteria 9727
436 Ga0207641_10145732 3300026088 Unclassified 2141
437 Ga0207641_10242012 3300026088 Bacteria 1682
438 Ga0207641_10415294 3300026088 Bacteria 1294
439 Ga0207641_10462542 3300026088 Unclassified 1227
440 Ga0207648_10009063 3300026089 Bacteria 9571
441 Ga0207648_10035476 3300026089 Bacteria 4393
442 Ga0207648_10066258 3300026089 Unclassified 3149
443 Ga0207648_10081523 3300026089 Bacteria 2822
444 Ga0207648_10101169 3300026089 Unclassified 2526
445 Ga0207676_10045231 3300026095 Bacteria 3400
446 Ga0207676_10373486 3300026095 Bacteria 1325
447 Ga0207676_10694323 3300026095 Bacteria 985
448 Ga0207674_10005175 3300026116 Bacteria 15536
449 Ga0207674_10035928 3300026116 Bacteria 5168
450 Ga0207674_10061318 3300026116 Bacteria 3800
451 Ga0207674_10069369 3300026116 Unclassified 3545
452 Ga0207674_10172218 3300026116 Unclassified 2118
453 Ga0207674_10194117 3300026116 Bacteria 1980
454 Ga0207674_10443762 3300026116 Bacteria 1254
455 Ga0207674_10662131 3300026116 Bacteria 1008
456 Ga0207675_100000938 3300026118 Bacteria 29125
457 Ga0207675_100104638 3300026118 Bacteria 2668
458 Ga0207675_100335359 3300026118 Unclassified 1479
459 Ga0207683_10002317 3300026121 Bacteria 16706
460 Ga0207683_10019840 3300026121 Bacteria 5743
461 Ga0207683_10149483 3300026121 Unclassified 2107
462 Ga0207683_10630719 3300026121 Bacteria 993
463 Ga0207683_10662663 3300026121 Unclassified 967
464 Ga0207698_10005346 3300026142 Bacteria 7920
465 Ga0207698_10014331 3300026142 Bacteria 5267
466 Ga0207428_10104003 3300027907 Bacteria 2192
467 Ga0207428_10235278 3300027907 Bacteria 1370
468 Ga0268266_10150518 3300028379 Bacteria 2097
469 Ga0268266_10175687 3300028379 Bacteria 1947
470 Ga0268266_10262734 3300028379 Bacteria 1600
471 Ga0268265_10003979 3300028380 Bacteria 10413
472 Ga0268265_10142952 3300028380 Bacteria 2006
473 Ga0268265_10244739 3300028380 Unclassified 1585
474 Ga0268265_10330288 3300028380 Bacteria 1385
475 Ga0268265_10417627 3300028380 Bacteria 1245
476 Ga0268264_10000313 3300028381 Bacteria 77820
477 Ga0268264_10003106 3300028381 Bacteria 14382
478 Ga0268264_10006832 3300028381 Bacteria 9583
479 Ga0268264_10007090 3300028381 Bacteria 9391
480 Ga0268264_10225414 3300028381 Bacteria 1728
481 Ga0268264_10269981 3300028381 Bacteria 1589
482 Ga0265334_10022849 3300028573 Unclassified 2546
483 Ga0307515_10004330 3300028794 Bacteria 29440
484 Ga0265327_10008831 3300031251 Bacteria 7420
485 Ga0307513_10149923 3300031456 Bacteria 2243
486 Ga0307513_10157683 3300031456 Bacteria 2167
487 Ga0307509_10136425 3300031507 Bacteria 2398
488 Ga0265314_10024679 3300031711 Unclassified 4553
489 Ga0307516_10001231 3300031730 Bacteria 35640
490 Ga0307516_10376417 3300031730 Unclassified 1082
491 Ga0307510_10008266 3300033180 Bacteria 12402
492 Ga0373936_0122724 3300035113 Unclassified 1111
493 Ga0373955_0070345 3300035172 Bacteria 1955
494 Ga0373935_0072285 3300035692 Bacteria 2227
495 Ga0373933_0052234 3300035724 Bacteria 2445
496 Ga0451841_0084566 3300041498 Bacteria 1476
497 Ga0451853_1876422 3300041512 Bacteria 1113
498 Ga0439441_012946 3300042001 Unclassified 1440
499 Ga0439445_0016833 3300042004 Unclassified 1803
500 Ga0439449_0059771 3300042007 Bacteria 1407
501 Ga0439457_002393 3300042014 Bacteria 5364
502 Ga0439434_0002629 3300042435 Bacteria 5233
503 Ga0451577_0084867 3300042876 Unclassified 2826
504 Ga0451577_0281652 3300042876 Bacteria 1506
505 Ga0451577_0605361 3300042876 Bacteria 994
506 Ga0466972_0000038 3300044658 Bacteria 135937
507 Ga0466961_0105210 3300044693 Bacteria 1777
508 Ga0466964_0059034 3300044706 Bacteria 1592
509 Ga0453684_0093866 3300044712 Bacteria 3694
510 Ga0453684_0127380 3300044712 Bacteria 3062
511 Ga0466968_0011055 3300044735 Bacteria 3512
512 Ga0466968_0059275 3300044735 Bacteria 1649
513 Ga0466957_0000186 3300044842 Bacteria 28257
514 Ga0466957_0002253 3300044842 Bacteria 10334
515 Ga0466959_0000157 3300045049 Bacteria 44458
516 Ga0495592_0099941 3300046454 Bacteria 2068
517 Ga0495629_0164964 3300046459 Bacteria 1538
518 Ga0495638_0037053 3300046460 Bacteria 3104
519 Ga0495638_0053614 3300046460 Bacteria 2510
520 Ga0495580_0113824 3300046472 Bacteria 1879
521 Ga0495664_0112102 3300046477 Bacteria 1647
522 Ga0495664_0493080 3300046477 Unclassified 732
523 Ga0495606_0012902 3300046507 Bacteria 6650
524 Ga0495608_0173054 3300046511 Bacteria 1369
525 Ga0495618_0292271 3300046514 Unclassified 1014
526 Ga0495628_0047817 3300046516 Bacteria 3392
527 Ga0495630_0006101 3300046517 Bacteria 8544
528 Ga0495630_0213040 3300046517 Unclassified 1474
529 Ga0495643_0020469 3300046522 Bacteria 3813
530 Ga0495648_0017177 3300046524 Bacteria 5183
531 Ga0495586_0136080 3300046535 Bacteria 1377
532 Ga0495587_0025834 3300046536 Bacteria 3586
533 Ga0495621_0059612 3300046539 Unclassified 1383
534 Ga0495668_0005369 3300046616 Bacteria 8731
535 Ga0495635_0244662 3300046663 Bacteria 1210
536 Ga0495657_0068201 3300046675 Bacteria 2332
537 Ga0495658_0008440 3300046683 Bacteria 5105
538 Ga0495674_0070137 3300047319 Bacteria 3029
539 Ga0495672_0025408 3300047320 Unclassified 3792
540 Ga0495672_0056727 3300047320 Bacteria 2277
541 Ga0495687_000001 3300047443 Bacteria 1215582
542 Ga0495684_0072743 3300047471 Bacteria 2612
543 Ga0495686_0141323 3300047472 Bacteria 1420
544 Ga0496104_0298542 3300048907 Bacteria 1523
545 Ga0496104_0423813 3300048907 Unclassified 1243
546 Ga0496105_0124171 3300048908 Bacteria 2128
547 Ga0496111_0052003 3300048914 Unclassified 2958
548 Ga0496114_0081057 3300048917 Bacteria 2741
549 Ga0501031_0209290 3300049568 Bacteria 1271
550 Ga0501032_0002810 3300049569 Bacteria 13533
551 Ga0501033_0307250 3300049570 Bacteria 1116
552 Ga0501034_0026330 3300049571 Bacteria 5924
553 Ga0501034_0028766 3300049571 Bacteria 5654
554 Ga0501034_0239319 3300049571 Bacteria 1761
555 Ga0501036_0006337 3300049572 Bacteria 9602
556 Ga0501036_0154793 3300049572 Bacteria 1933
557 Ga0501037_0007731 3300049573 Bacteria 7868
558 Ga0501037_0032924 3300049573 Bacteria 3830
559 Ga0501037_0096137 3300049573 Bacteria 2141
560 Ga0501038_0010161 3300049574 Bacteria 8616
561 Ga0501038_0010781 3300049574 Bacteria 8354
562 Ga0501039_0050945 3300049575 Unclassified 3204
563 Ga0501039_0076202 3300049575 Bacteria 2607
564 Ga0501043_0002617 3300049579 Bacteria 15178
565 Ga0501043_0010495 3300049579 Bacteria 7255
566 Ga0501043_0027182 3300049579 Bacteria 4492
567 Ga0501043_0033385 3300049579 Bacteria 4049
568 Ga0501046_0025486 3300049580 Bacteria 4839
569 Ga0501047_0019192 3300049581 Bacteria 6558
570 Ga0501047_0043311 3300049581 Bacteria 4348
571 Ga0501048_0392187 3300049582 Unclassified 992
572 Ga0501067_0014205 3300049583 Bacteria 4411
573 Ga0501068_0080365 3300049584 Bacteria 2000
574 Ga0501069_0242804 3300049585 Bacteria 1050
575 Ga0501070_0113996 3300049586 Bacteria 2233
576 Ga0501074_0015164 3300049590 Bacteria 5604
577 Ga0501077_0112018 3300049593 Bacteria 1730
578 Ga0501225_0000277 3300049705 Bacteria 16169
579 Ga0501079_0155880 3300049741 Bacteria 1780
580 Ga0501080_0179813 3300049742 Bacteria 1947
581 Ga0501083_0019383 3300049744 Bacteria 4739
582 Ga0501035_0010571 3300049822 Bacteria 8551
583 Ga0501035_0065127 3300049822 Bacteria 3237
584 Ga0501035_0096075 3300049822 Bacteria 2604
585 Ga0501044_0012622 3300049823 Bacteria 9148
586 Ga0501044_0039615 3300049823 Bacteria 4915
587 Ga0501044_0045281 3300049823 Bacteria 4559
588 Ga0501044_0076559 3300049823 Bacteria 3395
589 Ga0501044_0092738 3300049823 Bacteria 3046
590 Ga0501044_0292268 3300049823 Bacteria 1561
591 Ga0501045_0194396 3300049824 Bacteria 1512
592 Ga0501284_00029 3300050005 Bacteria 74818
593 nmdc:mga0k408_13677_c2 3300050493 Bacteria 3480
594 nmdc:mga0k408_9565_c1 3300050493 Bacteria 5229
595 nmdc:mga05p37_18450_c2 3300050507 Bacteria 3051
596 nmdc:mga05p37_68874_c1 3300050507 Bacteria 4351
597 nmdc:mga09592_6092_c1 3300050508 Bacteria 9824
598 nmdc:mga0qj67_17832_c1 3300050509 Bacteria 5401
599 nmdc:mga06r32_62932_c1 3300050510 Unclassified 3575
600 nmdc:mga08y16_423839_c1 3300050511 Unclassified 1360
601 nmdc:mga08y16_66757_c1 3300050511 Bacteria 3754
602 nmdc:mga08y16_87186_c1 3300050511 Bacteria 3252
603 nmdc:mga08y16_9862_c1 3300050511 Bacteria 10028
604 nmdc:mga0n895_102525_c1 3300050512 Bacteria 2872
605 Ga0500578_0000009 3300053086 Bacteria 219807
606 Ga0500646_0011119 3300053090 Bacteria 2312
607 Ga0500583_0000147 3300053092 Bacteria 29930
608 Ga0500583_0051333 3300053092 Bacteria 1915
609 Ga0500651_0344513 3300053093 Bacteria 847
610 Ga0500641_0018632 3300053096 Bacteria 2614
611 Ga0500562_016423 3300053108 Bacteria 1903
612 Ga0500652_064377 3300053131 Bacteria 1514
613 Ga0500652_074065 3300053131 Bacteria 1414
614 Ga0500658_0107788 3300053134 Bacteria 1223
615 Ga0500559_0048935 3300053136 Unclassified 1861
616 Ga0500568_0002028 3300053139 Bacteria 12326
617 Ga0500573_0078531 3300053140 Bacteria 1878
618 Ga0500589_122817 3300053147 Bacteria 1097
619 Ga0500616_0015853 3300053153 Bacteria 4301
620 Ga0500622_0027852 3300053156 Bacteria 2977
621 Ga0500622_0060246 3300053156 Bacteria 1937
622 Ga0157378_10249532
623 MBSR1b_contig_14028215
624 MBSR1b_contig_8237559
625 MBSR1b_contig_8586871
626 JGI24751J29686_10001206
627 rootL2_10026254
628 rootL2_10334457
629 rootH1_10025210
630 rootH1_10149723
631 rootH1_10149724
632 Ga0065712_10010653
633 Ga0065712_10168228
634 Ga0065712_10206008
635 Ga0065715_10295027
636 Ga0065707_10309099
637 Ga0070676_10025781
638 Ga0070676_10262312
639 Ga0070683_100004631
640 Ga0070683_100011439
641 Ga0070683_100113430
642 Ga0070690_100019911
643 Ga0070690_100170701
644 Ga0070670_100048717
645 Ga0070670_100072517
646 Ga0070670_100092893
647 Ga0070670_100130845
648 Ga0070670_100248835
649 Ga0070670_100250979
650 Ga0070670_100354472
651 Ga0070677_10001794
652 Ga0070677_10100805
653 Ga0068869_100008279
654 Ga0068869_100017602
655 Ga0068869_100078482
656 Ga0068869_100147644
657 Ga0068869_100582078
658 Ga0070666_10000135
659 Ga0070666_10006706
660 Ga0070666_10023370
661 Ga0070666_10619451
662 Ga0070682_100253979
663 Ga0068868_100013667
664 Ga0068868_100023876
665 Ga0068868_100052068
666 Ga0068868_100063507
667 Ga0068868_100248522
668 Ga0070689_100020116
669 Ga0070689_100055284
670 Ga0070689_100118384
671 Ga0070689_100233982
672 Ga0070689_100604593
673 Ga0070687_100032832
674 Ga0070661_100003972
675 Ga0070661_100024577
676 Ga0070661_100036304
677 Ga0070668_100049495
678 Ga0070668_100174319
679 Ga0070669_100567642
680 Ga0070675_100117133
681 Ga0070671_100008005
682 Ga0070671_100073117
683 Ga0070671_100094064
684 Ga0070671_100514724
685 Ga0070674_100102997
686 Ga0070674_100255289
687 Ga0070673_100061285
688 Ga0070673_100119283
689 Ga0070673_100131643
690 Ga0070673_100162187
691 Ga0070673_100721911
692 Ga0070688_100000797
693 Ga0070688_100037727
694 Ga0070688_100243000
695 Ga0070659_100002732
696 Ga0070667_100007115
697 Ga0070667_100026170
698 Ga0070667_100087878
699 Ga0070667_100090221
700 Ga0070667_100094204
701 Ga0070667_100653668
702 Ga0070701_10016422
703 Ga0070700_100095203
704 Ga0070700_100101505
705 Ga0070663_100246423
706 Ga0070663_100514782
707 Ga0070678_100115240
708 Ga0070678_100137570
709 Ga0070678_100185390
710 Ga0070678_100244723
711 Ga0070678_100365359
712 Ga0070678_100543784
713 Ga0070662_100005152
714 Ga0070662_100069184
715 Ga0068867_100026189
716 Ga0068867_100049670
717 Ga0068867_100121730
718 Ga0068867_100128333
719 Ga0068867_100134048
720 Ga0068867_100136047
721 Ga0068867_100405624
722 Ga0070685_10021915
723 Ga0070685_10037819
724 Ga0070685_10046832
725 Ga0070685_10051544
726 Ga0070685_10344546
727 Ga0070698_100001497
728 Ga0070698_100010867
729 Ga0070684_100002706
730 Ga0070684_100062723
731 Ga0068853_100002920
732 Ga0068853_100205366
733 Ga0070672_100061466
734 Ga0070672_100079600
735 Ga0070672_100098607
736 Ga0070672_100406316
737 Ga0070672_100510584
738 Ga0070693_100199785
739 Ga0070665_100130723
740 Ga0070704_100452291
741 Ga0068855_100003029
742 Ga0068855_100007823
743 Ga0070664_100004774
744 Ga0070664_100034556
745 Ga0070664_100057696
746 Ga0070664_100060571
747 Ga0070664_100658997
748 Ga0068857_100015228
749 Ga0068857_100018587
750 Ga0068857_100049312
751 Ga0068857_100170871
752 Ga0068857_100562805
753 Ga0068854_100013566
754 Ga0068854_100038918
755 Ga0068854_100086750
756 Ga0068854_100318816
757 Ga0068856_100553535
758 Ga0068852_100003713
759 Ga0068852_100004864
760 Ga0068852_100154668
761 Ga0068859_100000127
762 Ga0068859_100020688
763 Ga0068859_100021414
764 Ga0068859_100064949
765 Ga0068859_100065804
766 Ga0068859_100069771
767 Ga0068859_100157420
768 Ga0068859_100225170
769 Ga0068859_100238545
770 Ga0068864_100053379
771 Ga0068864_100104838
772 Ga0068864_100114608
773 Ga0068864_100184387
774 Ga0068866_10031840
775 Ga0068861_100010078
776 Ga0068861_100105363
777 Ga0068851_10036193
778 Ga0068870_10009000
779 Ga0068870_10386566
780 Ga0068863_100001425
781 Ga0068863_100023248
782 Ga0068863_100034806
783 Ga0068863_100059614
784 Ga0068863_100417870
785 Ga0068863_100423479
786 Ga0068858_100002322
787 Ga0068858_100105591
788 Ga0068858_100276628
789 Ga0068858_100853790
790 Ga0068858_100880195
791 Ga0068860_100002119
792 Ga0068860_100013041
793 Ga0068860_100018651
794 Ga0068860_100111999
795 Ga0068860_100155138
796 Ga0068860_100218461
797 Ga0068860_100337363
798 Ga0068862_100226233
799 Ga0068862_100724962
800 Ga0068862_100779596
801 Ga0070715_10005844
802 Ga0075366_10011952
803 Ga0075366_10121874
804 Ga0097621_100000586
805 Ga0097621_100002660
806 Ga0097621_100007600
807 Ga0097621_100045109
808 Ga0097621_100107935
809 Ga0097621_100126227
810 Ga0068871_100231229
811 Ga0068871_100357663
812 Ga0075428_100049741
813 Ga0075428_100179564
814 Ga0075430_100218807
815 Ga0075431_100032821
816 Ga0075429_100002013
817 Ga0075429_100053015
818 Ga0068865_100173820
819 Ga0068865_100421639
820 Ga0097620_100000127
821 Ga0097620_100020689
822 Ga0097620_100021415
823 Ga0097620_100064950
824 Ga0097620_100065800
825 Ga0097620_100069772
826 Ga0097620_100157418
827 Ga0097620_100190652
828 Ga0097620_100225172
829 Ga0097620_100238522
830 Ga0105240_10000513
831 Ga0105240_10013866
832 Ga0105240_10042091
833 Ga0105240_10280308
834 Ga0105240_10291122
835 Ga0111539_10001795
836 Ga0111539_10082729
837 Ga0105247_10004365
838 Ga0114129_10082280
839 Ga0114129_10154899
840 Ga0114129_10164802
841 Ga0105243_10443819
842 Ga0105243_10593174
843 Ga0105241_10058844
844 Ga0105241_10395990
845 Ga0105241_10935767
846 Ga0105242_10012895
847 Ga0105242_10043275
848 Ga0105242_10129340
849 Ga0105242_10145766
850 Ga0105242_10161501
851 Ga0105242_10257315
852 Ga0105248_10088776
853 Ga0105248_10889993
854 Ga0105237_10000528
855 Ga0105237_10000959
856 Ga0105237_10013498
857 Ga0105237_10021302
858 Ga0105238_10045942
859 Ga0105249_10004091
860 Ga0105249_10013937
861 Ga0105249_10019556
862 Ga0105249_10020018
863 Ga0105249_10053584
864 Ga0105249_10083226
865 Ga0105249_10095705
866 Ga0105239_10000314
867 Ga0105239_10000853
868 Ga0105239_10699122
869 Ga0105246_10010437
870 Ga0105246_10031640
871 Ga0157373_10025136
872 Ga0157370_10001415
873 Ga0157370_10090306
874 Ga0157369_10071400
875 Ga0157374_10131353
876 Ga0157374_10212938
877 Ga0157374_10254801
878 Ga0157378_10007196
879 Ga0157378_10059214
880 Ga0157378_10067150
881 Ga0157378_10073652
882 Ga0157378_10222722
883 Ga0157378_10291777
884 Ga0157378_10454191
885 Ga0157378_10751280
886 Ga0163162_10000101
887 Ga0163162_10002080
888 Ga0163162_10018896
889 Ga0163162_10031957
890 Ga0163162_10054154
891 Ga0163162_10209333
892 Ga0157372_10000804
893 Ga0157372_10046610
894 Ga0157372_10163039
895 Ga0157375_10000118
896 Ga0157375_10007574
897 Ga0157375_10043460
898 Ga0157375_10046139
899 Ga0157375_10077744
900 Ga0157375_10124965
901 Ga0157375_10144543
902 Ga0157375_10276112
903 Ga0157375_10379490
904 Ga0157375_10455450
905 Ga0157375_10456116
906 Ga0157375_10897890
907 Ga0163163_10000078
908 Ga0163163_10000636
909 Ga0163163_10107139
910 Ga0163163_10182571
911 Ga0163163_10182792
912 Ga0163163_10448001
913 Ga0163163_10601975
914 Ga0157380_10008693
915 Ga0157380_10032056
916 Ga0157380_10055217
917 Ga0157377_10004058
918 Ga0157377_10084304
919 Ga0157377_10098499
920 Ga0157377_10217671
921 Ga0157379_10021147
922 Ga0157379_10045049
923 Ga0157379_10158830
924 Ga0157376_10000378
925 Ga0157376_10001271
926 Ga0157376_10004501
927 Ga0157376_10062805
928 Ga0157376_10118185
929 Ga0157376_10119413
930 Ga0157376_10221579
931 Ga0157376_10681150
932 Ga0157376_10945314
933 Ga0163161_10003903
934 Ga0163161_10022509
935 Ga0163161_10040002
936 Ga0163161_10085477
937 Ga0163161_10515423
938 Ga0163161_10558794
939 Ga0207697_10038539
940 Ga0207656_10174391
941 Ga0207682_10008876
942 Ga0207682_10045807
943 Ga0207688_10009233
944 Ga0207680_10000057
945 Ga0207680_10005367
946 Ga0207680_10160814
947 Ga0207680_10530106
948 Ga0207647_10006207
949 Ga0207647_10011499
950 Ga0207645_10002535
951 Ga0207645_10011599
952 Ga0207643_10008176
953 Ga0207643_10021539
954 Ga0207643_10042481
955 Ga0207643_10166266
956 Ga0207654_10430202
957 Ga0207695_10000084
958 Ga0207695_10000323
959 Ga0207695_10065612
960 Ga0207695_10091022
961 Ga0207695_10416126
962 Ga0207671_10001538
963 Ga0207671_10002788
964 Ga0207671_10033043
965 Ga0207671_10099218
966 Ga0207657_10401200
967 Ga0207649_10052049
968 Ga0207649_10054025
969 Ga0207681_10024153
970 Ga0207681_10169446
971 Ga0207694_10073329
972 Ga0207650_10032543
973 Ga0207650_10086410
974 Ga0207650_10217436
975 Ga0207650_10227181
976 Ga0207650_10237561
977 Ga0207659_10128529
978 Ga0207659_10141909
979 Ga0207644_10008932
980 Ga0207644_10065642
981 Ga0207644_10133464
982 Ga0207644_10293245
983 Ga0207690_10057952
984 Ga0207690_10587274
985 Ga0207706_10020423
986 Ga0207706_10079524
987 Ga0207686_10006728
988 Ga0207686_10069603
989 Ga0207686_10075107
990 Ga0207686_10078569
991 Ga0207686_10096504
992 Ga0207709_10587488
993 Ga0207670_10011453
994 Ga0207670_10012045
995 Ga0207670_10144172
996 Ga0207670_10201711
997 Ga0207691_10035080
998 Ga0207691_10038775
999 Ga0207691_10079706
1000 Ga0207691_10153081
1001 Ga0207711_10344041
1002 Ga0207689_10000482
1003 Ga0207689_10002539
1004 Ga0207689_10025673
1005 Ga0207689_10028313
1006 Ga0207689_10061519
1007 Ga0207661_10011446
1008 Ga0207661_10048223
1009 Ga0207679_10008992
1010 Ga0207679_10010266
1011 Ga0207679_10045764
1012 Ga0207667_10000135
1013 Ga0207667_10030139
1014 Ga0207651_10009245
1015 Ga0207651_10041730
1016 Ga0207651_10075832
1017 Ga0207651_10181399
1018 Ga0207651_10189260
1019 Ga0207651_10535100
1020 Ga0207712_10001348
1021 Ga0207712_10003852
1022 Ga0207712_10016748
1023 Ga0207712_10116540
1024 Ga0207712_10121173
1025 Ga0207668_10051291
1026 Ga0207668_10445557
1027 Ga0207640_10005009
1028 Ga0207640_10077923
1029 Ga0207640_10288333
1030 Ga0207658_10019785
1031 Ga0207658_10036662
1032 Ga0207658_10049911
1033 Ga0207658_10129136
1034 Ga0207658_10315537
1035 Ga0207658_10325513
1036 Ga0207658_10408204
1037 Ga0207677_10023328
1038 Ga0207677_10076582
1039 Ga0207677_10112629
1040 Ga0207677_10140129
1041 Ga0207677_10706347
1042 Ga0207677_10740473
1043 Ga0207703_10000924
1044 Ga0207703_10042065
1045 Ga0207703_10129441
1046 Ga0207703_10538616
1047 Ga0207639_10002438
1048 Ga0207639_10010753
1049 Ga0207639_10194944
1050 Ga0207678_10047731
1051 Ga0207708_10143909
1052 Ga0207708_10446242
1053 Ga0207702_10008334
1054 Ga0207702_10559417
1055 Ga0207641_10000229
1056 Ga0207641_10006622
1057 Ga0207641_10145732
1058 Ga0207641_10242012
1059 Ga0207641_10415294
1060 Ga0207641_10462542
1061 Ga0207648_10009063
1062 Ga0207648_10035476
1063 Ga0207648_10066258
1064 Ga0207648_10081523
1065 Ga0207648_10101169
1066 Ga0207676_10045231
1067 Ga0207676_10373486
1068 Ga0207676_10694323
1069 Ga0207674_10005175
1070 Ga0207674_10035928
1071 Ga0207674_10061318
1072 Ga0207674_10069369
1073 Ga0207674_10172218
1074 Ga0207674_10194117
1075 Ga0207674_10443762
1076 Ga0207674_10662131
1077 Ga0207675_100000938
1078 Ga0207675_100104638
1079 Ga0207675_100335359
1080 Ga0207683_10002317
1081 Ga0207683_10019840
1082 Ga0207683_10149483
1083 Ga0207683_10630719
1084 Ga0207683_10662663
1085 Ga0207698_10005346
1086 Ga0207698_10014331
1087 Ga0207428_10104003
1088 Ga0207428_10235278
1089 Ga0268266_10150518
1090 Ga0268266_10175687
1091 Ga0268266_10262734
1092 Ga0268265_10003979
1093 Ga0268265_10142952
1094 Ga0268265_10244739
1095 Ga0268265_10330288
1096 Ga0268265_10417627
1097 Ga0268264_10000313
1098 Ga0268264_10003106
1099 Ga0268264_10006832
1100 Ga0268264_10007090
1101 Ga0268264_10225414
1102 Ga0268264_10269981
1103 Ga0265334_10022849
1104 Ga0307515_10004330
1105 Ga0265327_10008831
1106 Ga0307513_10149923
1107 Ga0307513_10157683
1108 Ga0307509_10136425
1109 Ga0265314_10024679
1110 Ga0307516_10001231
1111 Ga0307516_10376417
1112 Ga0307510_10008266
1113 Ga0373936_0122724
1114 Ga0373955_0070345
1115 Ga0373935_0072285
1116 Ga0373933_0052234
1117 Ga0451841_0084566
1118 Ga0451853_1876422
1119 Ga0439441_012946
1120 Ga0439445_0016833
1121 Ga0439449_0059771
1122 Ga0439457_002393
1123 Ga0439434_0002629
1124 Ga0451577_0084867
1125 Ga0451577_0281652
1126 Ga0451577_0605361
1127 Ga0466972_0000038
1128 Ga0466961_0105210
1129 Ga0466964_0059034
1130 Ga0453684_0093866
1131 Ga0453684_0127380
1132 Ga0466968_0011055
1133 Ga0466968_0059275
1134 Ga0466957_0000186
1135 Ga0466957_0002253
1136 Ga0466959_0000157
1137 Ga0495592_0099941
1138 Ga0495629_0164964
1139 Ga0495638_0037053
1140 Ga0495638_0053614
1141 Ga0495580_0113824
1142 Ga0495664_0112102
1143 Ga0495664_0493080
1144 Ga0495606_0012902
1145 Ga0495608_0173054
1146 Ga0495618_0292271
1147 Ga0495628_0047817
1148 Ga0495630_0006101
1149 Ga0495630_0213040
1150 Ga0495643_0020469
1151 Ga0495648_0017177
1152 Ga0495586_0136080
1153 Ga0495587_0025834
1154 Ga0495621_0059612
1155 Ga0495668_0005369
1156 Ga0495635_0244662
1157 Ga0495657_0068201
1158 Ga0495658_0008440
1159 Ga0495674_0070137
1160 Ga0495672_0025408
1161 Ga0495672_0056727
1162 Ga0495687_000001
1163 Ga0495684_0072743
1164 Ga0495686_0141323
1165 Ga0496104_0298542
1166 Ga0496104_0423813
1167 Ga0496105_0124171
1168 Ga0496111_0052003
1169 Ga0496114_0081057
1170 Ga0501031_0209290
1171 Ga0501032_0002810
1172 Ga0501033_0307250
1173 Ga0501034_0026330
1174 Ga0501034_0028766
1175 Ga0501034_0239319
1176 Ga0501036_0006337
1177 Ga0501036_0154793
1178 Ga0501037_0007731
1179 Ga0501037_0032924
1180 Ga0501037_0096137
1181 Ga0501038_0010161
1182 Ga0501038_0010781
1183 Ga0501039_0050945
1184 Ga0501039_0076202
1185 Ga0501043_0002617
1186 Ga0501043_0010495
1187 Ga0501043_0027182
1188 Ga0501043_0033385
1189 Ga0501046_0025486
1190 Ga0501047_0019192
1191 Ga0501047_0043311
1192 Ga0501048_0392187
1193 Ga0501067_0014205
1194 Ga0501068_0080365
1195 Ga0501069_0242804
1196 Ga0501070_0113996
1197 Ga0501074_0015164
1198 Ga0501077_0112018
1199 Ga0501225_0000277
1200 Ga0501079_0155880
1201 Ga0501080_0179813
1202 Ga0501083_0019383
1203 Ga0501035_0010571
1204 Ga0501035_0065127
1205 Ga0501035_0096075
1206 Ga0501044_0012622
1207 Ga0501044_0039615
1208 Ga0501044_0045281
1209 Ga0501044_0076559
1210 Ga0501044_0092738
1211 Ga0501044_0292268
1212 Ga0501045_0194396
1213 Ga0501284_00029
1214 nmdc:mga0k408_13677_c2
1215 nmdc:mga0k408_9565_c1
1216 nmdc:mga05p37_18450_c2
1217 nmdc:mga05p37_68874_c1
1218 nmdc:mga09592_6092_c1
1219 nmdc:mga0qj67_17832_c1
1220 nmdc:mga06r32_62932_c1
1221 nmdc:mga08y16_423839_c1
1222 nmdc:mga08y16_66757_c1
1223 nmdc:mga08y16_87186_c1
1224 nmdc:mga08y16_9862_c1
1225 nmdc:mga0n895_102525_c1
1226 Ga0500578_0000009
1227 Ga0500646_0011119
1228 Ga0500583_0000147
1229 Ga0500583_0051333
1230 Ga0500651_0344513
1231 Ga0500641_0018632
1232 Ga0500562_016423
1233 Ga0500652_064377
1234 Ga0500652_074065
1235 Ga0500658_0107788
1236 Ga0500559_0048935
1237 Ga0500568_0002028
1238 Ga0500573_0078531
1239 Ga0500589_122817
1240 Ga0500616_0015853
1241 Ga0500622_0027852
1242 Ga0500622_0060246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

65

182

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uan-assembly1.cif.gz_A crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.9536 19 250
1uan-assembly1.cif.gz_B crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.9463 19 250
6p2t-assembly1.cif.gz_A bshb from bacillus subtilis complexed with citrate 0.9408 18 256
2ixd-assembly1.cif.gz_A crystal structure of the putative deacetylase bc1534 from bacillus cereus 0.9385 17 256
6p2t-assembly1.cif.gz_A bshb from bacillus subtilis complexed with citrate 0.929 18 256
ID Description Score Start End Superfamily
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9463 19 250 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9385 17 256 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.919 17 256 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9127 19 250 3.40.50.10320
af_P71311_1_185_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8538 21 198 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A7Y2F151-F1-model_v4 Bacillithiol biosynthesis deacetylase BshB1 0.9894 18 200 GO:0016811
GO:0019213
GO:0071793
AF-A0A2D9Y499-F1-model_v4 Bacillithiol biosynthesis deacetylase BshB1 0.9859 18 140 GO:0016811
AF-A0A4Q5QUZ2-F1-model_v4 Bacillithiol biosynthesis deacetylase BshB1 0.9852 17 165 GO:0016811
GO:0019213
GO:0071793
AF-A0A519WPM3-F1-model_v4 Bacillithiol biosynthesis deacetylase BshB1 0.9852 18 131 GO:0016811
AF-A0A7Y7DDY5-F1-model_v4 Bacillithiol biosynthesis deacetylase BshB1 0.9851 17 152 GO:0016811
GO:0019213
GO:0071793

Map