F470107

General Info

Members Datasets Scaffolds Average Seq Length
622 347 1239 480

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1024086|Ga0265319_10240862
Length 543
Sequence MSQEHDVSHPHHPDRRRFLQRAASMSAMGAALPFGLNMGTLTQASAQSAGGNYKALVCLFFNGGNDAFNMVLATDSTSWGHYLHHRRPTDGSTSIALMEAGVAPVNTASGATPERLGGVLPINHAGRSVHAGRTFALHPALTRLQQIHNAGRACVVANVGPLTRPTSKLDYASAAASKPAKLFSHNDQQSTWQSFKPEGASEGWGGLMGDLLMSGNGGGRNATDAAIVQRMFTCMTPAQTSVWLAGRSVLPYQSSGTGIQSLGNSGRIYGNAGLQAAVASVMSTPPSGGSMPNDRASLFVLDQQKLVERALTASALLGSALAPLGTGPWSSPGATNPYSDTLLNYTSPIDGTQKFNGVALQLQMIARLIDTNRTANLGITRQLFMVNMGGFDTHDNQIREQADRLASLDHALSYFDNVLANMPGGDMRSQVTTFTASEFGRSFTSNGDGTDHGWGAHHIVMGGAVNGTEVYGTFPQYSSADTAGNFSSPDQIQNGVLIPTTSVDQYAYTLGKWMGVGTSDLAALLPNLSQFNASTHDLAFMKA

Samples

Sample ID Description Type Environment
1 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
66 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
67 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
68 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
149 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
150 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
152 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
160 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
191 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
192 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
193 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
194 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
195 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
196 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
197 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
219 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
222 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
233 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
241 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
242 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
243 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
244 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
245 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
246 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
247 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
272 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
273 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
274 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
280 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
281 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
284 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
285 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
286 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
287 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
290 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
291 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
292 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
293 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
294 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
295 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
296 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
297 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
298 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
299 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
300 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
301 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
302 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
303 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
304 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
305 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
306 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
307 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
308 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
309 2547132374 Acidovorax radicis N35 Isolate Unclassified
310 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
311 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
312 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
313 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
314 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
315 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
316 2643221570 Acidovorax sp. Root568 Isolate Unclassified
317 2643221585 Pelomonas sp. Root662 Isolate Unclassified
318 2643221596 Acidovorax sp. Root70 Isolate Unclassified
319 2643221609 Acidovorax sp. Root217 Isolate Unclassified
320 2643221611 Acidovorax sp. Root219 Isolate Unclassified
321 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
322 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
323 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
324 2643221652 Acidovorax sp. Root402 Isolate Unclassified
325 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
326 2643221656 Pelomonas sp. Root405 Isolate Unclassified
327 2643221672 Variovorax sp. Root434 Isolate Unclassified
328 2643221717 Acidovorax sp. Root267 Isolate Unclassified
329 2721755523 Delftia sp. HK171 Isolate Unclassified
330 2738541277 Variovorax sp. GV051 Isolate Unclassified
331 2738543012 Acidovorax sp. CF301 Isolate Unclassified
332 2738543019 Variovorax sp. GV040 Isolate Unclassified
333 2816332133 Acidovorax radicis 2721A Isolate Unclassified
334 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
335 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
336 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
337 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
338 2842711865 Duganella sp. R-73148 Isolate Unclassified
339 2857558681 Duganella sp. R-74565 Isolate Unclassified
340 2857564685 Duganella sp. R-74599 Isolate Unclassified
341 2885198086 Variovorax sp. 679 Isolate Unclassified
342 2885211737 Variovorax sp. 553 Isolate Unclassified
343 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
344 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
345 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
346 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
347 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.25
Metatranscriptomes 0.32
Isolates 6.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.94
Nodule 1.45
Rhizoplane 2.41
Rhizosphere 61.9
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265319_1024086 3300028563 Bacteria 2196
2 JGI24740J21852_10007769 3300001979 Bacteria 4333
3 JGI25150J39212_1000845 3300002774 Bacteria 10242
4 JGI25159J45721_1002918 3300002987 Bacteria 6233
5 JGI25151J46595_10000507 3300003187 Bacteria 36540
6 rootH1_10001187 3300003316 Bacteria 5206
7 rootH1_10021293 3300003316 Bacteria 8669
8 rootH1_10034163 3300003316 Bacteria 3731
9 rootH2_10051907 3300003320 Bacteria 8638
10 rootH2_10236065 3300003320 Unclassified 3878
11 rootL2_10026577 3300003322 Bacteria 4533
12 rootL2_10057017 3300003322 Bacteria 2894
13 rootL2_10063119 3300003322 Bacteria 10161
14 rootL2_10069657 3300003322 Bacteria 5441
15 rootH1_10002908 3300003316 Bacteria 4973
16 rootH1_10002908 3300003323 Bacteria 22675
17 rootH1_10048416 3300003323 Bacteria 5759
18 rootH1_10199011 3300003323 Bacteria 2496
19 Ga0055526_1000019 3300003771 Bacteria 189698
20 Ga0055526_1000283 3300003771 Bacteria 42457
21 Ga0055537_1000063 3300003773 Bacteria 77468
22 Ga0055524_1000025 3300003775 Bacteria 216427
23 Ga0055524_1000231 3300003775 Bacteria 59530
24 Ga0055534_1000208 3300003784 Bacteria 43225
25 Ga0055528_1000013 3300003790 Bacteria 176239
26 Ga0055530_10001969 3300003791 Bacteria 13982
27 Ga0055530_10003523 3300003791 Bacteria 8838
28 Ga0055530_10005653 3300003791 Bacteria 5856
29 Ga0055540_1000002 3300003792 Bacteria 436954
30 Ga0055540_1000007 3300003792 Bacteria 318178
31 Ga0055540_1000365 3300003792 Bacteria 38078
32 Ga0055531_10000330 3300003794 Bacteria 46755
33 Ga0055531_10000454 3300003794 Bacteria 38078
34 Ga0055531_10004266 3300003794 Bacteria 8787
35 Ga0055531_10005653 3300003794 Bacteria 7265
36 Ga0055543_1004851 3300004625 Bacteria 3563
37 Ga0065165_1000005 3300005262 Bacteria 370361
38 Ga0065165_1000600 3300005262 Bacteria 52753
39 Ga0065165_1022534 3300005262 Bacteria 2157
40 Ga0070676_10043747 3300005328 Bacteria 2603
41 Ga0070683_100009180 3300005329 Bacteria 8443
42 Ga0070683_100080553 3300005329 Bacteria 3048
43 Ga0070683_100132244 3300005329 Bacteria 2361
44 Ga0070690_100010947 3300005330 Bacteria 5294
45 Ga0070670_100023816 3300005331 Bacteria 5268
46 Ga0070670_100168566 3300005331 Bacteria 1899
47 Ga0070677_10046585 3300005333 Bacteria 1734
48 Ga0068869_100015798 3300005334 Bacteria 5074
49 Ga0070666_10013184 3300005335 Bacteria 5239
50 Ga0068868_100000459 3300005338 Bacteria 27077
51 Ga0068868_100012059 3300005338 Bacteria 6311
52 Ga0070689_100028788 3300005340 Bacteria 4202
53 Ga0070661_100018235 3300005344 Bacteria 4988
54 Ga0070661_100140469 3300005344 Bacteria 1820
55 Ga0070669_100000003 3300005353 Bacteria 338807
56 Ga0070669_100003404 3300005353 Bacteria 11448
57 Ga0070675_100003600 3300005354 Bacteria 11783
58 Ga0070671_100002176 3300005355 Bacteria 15130
59 Ga0070671_100010892 3300005355 Bacteria 7302
60 Ga0070673_100090375 3300005364 Bacteria 2501
61 Ga0070659_100001364 3300005366 Bacteria 17584
62 Ga0070667_100003020 3300005367 Bacteria 14462
63 Ga0070714_100022255 3300005435 Bacteria 5195
64 Ga0070708_100163057 3300005445 Bacteria 2078
65 Ga0070663_100016762 3300005455 Bacteria 4768
66 Ga0070678_100009945 3300005456 Bacteria 5784
67 Ga0068867_100000104 3300005459 Bacteria 53850
68 Ga0068853_100021881 3300005539 Bacteria 5333
69 Ga0068853_100193960 3300005539 Bacteria 1846
70 Ga0070672_100017706 3300005543 Bacteria 5133
71 Ga0070665_100045053 3300005548 Unclassified 4429
72 Ga0068855_100002944 3300005563 Bacteria 20808
73 Ga0068855_100003346 3300005563 Bacteria 19628
74 Ga0068855_100017040 3300005563 Bacteria 8740
75 Ga0068855_100135831 3300005563 Bacteria 2806
76 Ga0070664_100011153 3300005564 Bacteria 7288
77 Ga0070664_100106188 3300005564 Bacteria 2446
78 Ga0068857_100029350 3300005577 Bacteria 4853
79 Ga0068857_100069422 3300005577 Bacteria 3138
80 Ga0068854_100107239 3300005578 Bacteria 2102
81 Ga0068852_100000029 3300005616 Bacteria 105168
82 Ga0068852_100065174 3300005616 Bacteria 3177
83 Ga0068852_100098610 3300005616 Bacteria 2632
84 Ga0068852_100115605 3300005616 Unclassified 2446
85 Ga0068859_100009449 3300005617 Bacteria 9847
86 Ga0068859_100011237 3300005617 Bacteria 9006
87 Ga0068864_100000508 3300005618 Bacteria 33518
88 Ga0068851_10031800 3300005834 Bacteria 2623
89 Ga0068863_100004264 3300005841 Bacteria 14102
90 Ga0068858_100003059 3300005842 Bacteria 16764
91 Ga0068858_100007399 3300005842 Bacteria 10621
92 Ga0068860_100002923 3300005843 Bacteria 17679
93 Ga0068860_100029800 3300005843 Bacteria 5250
94 Ga0068862_100188068 3300005844 Bacteria 1857
95 Ga0075368_10034903 3300006042 Bacteria 1961
96 Ga0075368_10049595 3300006042 Bacteria 1666
97 Ga0070716_100008307 3300006173 Bacteria 5150
98 Ga0075362_10003212 3300006177 Bacteria 5665
99 Ga0075367_10095764 3300006178 Bacteria 1810
100 Ga0075366_10000953 3300006195 Bacteria 14096
101 Ga0075366_10006014 3300006195 Bacteria 6612
102 Ga0075366_10006123 3300006195 Bacteria 6559
103 Ga0075366_10006670 3300006195 Bacteria 6336
104 Ga0075366_10010043 3300006195 Bacteria 5305
105 Ga0075366_10013544 3300006195 Bacteria 4647
106 Ga0075366_10080707 3300006195 Bacteria 1943
107 Ga0097621_100024443 3300006237 Bacteria 4718
108 Ga0097621_100084865 3300006237 Bacteria 2641
109 Ga0075370_10002530 3300006353 Bacteria 8492
110 Ga0075370_10006406 3300006353 Bacteria 5917
111 Ga0075370_10014495 3300006353 Bacteria 4206
112 Ga0075370_10020690 3300006353 Bacteria 3599
113 Ga0075370_10047533 3300006353 Bacteria 2430
114 Ga0068871_100002115 3300006358 Bacteria 13446
115 Ga0068871_100009407 3300006358 Bacteria 7080
116 Ga0097620_100009449 3300006931 Bacteria 9847
117 Ga0097620_100011237 3300006931 Bacteria 9006
118 Ga0099823_1000486 3300006944 Bacteria 26577
119 Ga0079104_1000009 3300006946 Bacteria 367015
120 Ga0079104_1000026 3300006946 Bacteria 216566
121 Ga0099826_10000005 3300006948 Bacteria 465206
122 Ga0105244_10014545 3300009036 Bacteria 4545
123 Ga0105250_10011713 3300009092 Bacteria 3634
124 Ga0105240_10000065 3300009093 Bacteria 213992
125 Ga0105240_10001689 3300009093 Bacteria 37381
126 Ga0105240_10002980 3300009093 Bacteria 26646
127 Ga0105240_10019655 3300009093 Bacteria 9021
128 Ga0105245_10031127 3300009098 Unclassified 4720
129 Ga0105247_10010043 3300009101 Bacteria 5732
130 Ga0105243_10028774 3300009148 Bacteria 4268
131 Ga0105243_10065810 3300009148 Bacteria 2913
132 Ga0105243_10095312 3300009148 Bacteria 2459
133 Ga0105241_10000041 3300009174 Bacteria 107393
134 Ga0105241_10015877 3300009174 Bacteria 5516
135 Ga0105242_10002719 3300009176 Bacteria 13857
136 Ga0105242_10004451 3300009176 Bacteria 10893
137 Ga0105248_10001095 3300009177 Bacteria 29976
138 Ga0105248_10007574 3300009177 Bacteria 11925
139 Ga0105248_10007741 3300009177 Bacteria 11797
140 Ga0105248_10017921 3300009177 Bacteria 7814
141 Ga0105248_10053312 3300009177 Bacteria 4538
142 Ga0105237_10038549 3300009545 Bacteria 4826
143 Ga0105237_10101519 3300009545 Bacteria 2869
144 Ga0105238_10000801 3300009551 Bacteria 32620
145 Ga0105238_10001399 3300009551 Bacteria 24200
146 Ga0105238_10022854 3300009551 Bacteria 6374
147 Ga0105238_10067384 3300009551 Bacteria 3581
148 Ga0105239_10003395 3300010375 Bacteria 19535
149 Ga0105239_10017636 3300010375 Bacteria 7896
150 Ga0105239_10094985 3300010375 Bacteria 3294
151 Ga0157370_10000009 3300013104 Bacteria 231270
152 Ga0157370_10004596 3300013104 Bacteria 15797
153 Ga0157369_10000022 3300013105 Bacteria 233081
154 Ga0157369_10005047 3300013105 Bacteria 15454
155 Ga0157369_10050421 3300013105 Bacteria 4508
156 Ga0157369_10056323 3300013105 Bacteria 4242
157 Ga0157374_10001997 3300013296 Bacteria 17129
158 Ga0157374_10007172 3300013296 Bacteria 9495
159 Ga0157374_10026227 3300013296 Bacteria 5243
160 Ga0157374_10059589 3300013296 Bacteria 3570
161 Ga0157374_10081211 3300013296 Bacteria 3076
162 Ga0157374_10086228 3300013296 Bacteria 2987
163 Ga0157378_10002642 3300013297 Bacteria 15975
164 Ga0157378_10021006 3300013297 Bacteria 5744
165 Ga0157378_10041080 3300013297 Bacteria 4102
166 Ga0157372_10000040 3300013307 Bacteria 163677
167 Ga0157372_10033363 3300013307 Bacteria 5654
168 Ga0157372_10109399 3300013307 Bacteria 3165
169 Ga0163163_10004179 3300014325 Bacteria 12301
170 Ga0163163_10004762 3300014325 Bacteria 11640
171 Ga0163163_10045881 3300014325 Bacteria 4291
172 Ga0163163_10198094 3300014325 Bacteria 2057
173 Ga0182008_10010462 3300014497 Bacteria 4963
174 Ga0157377_10000010 3300014745 Bacteria 380929
175 Ga0157379_10002001 3300014968 Bacteria 16874
176 Ga0157379_10017963 3300014968 Bacteria 6233
177 Ga0157379_10023321 3300014968 Bacteria 5491
178 Ga0183363_1015 3300015690 Bacteria 74376
179 Ga0163161_10013846 3300017792 Bacteria 5618
180 Ga0213876_10012608 3300021384 Bacteria 4497
181 Ga0207425_1000297 3300025245 Bacteria 36240
182 Ga0209129_1004819 3300025258 Bacteria 5084
183 Ga0209565_1000003 3300025263 Bacteria 1099648
184 Ga0209673_1000003 3300025273 Bacteria 980859
185 Ga0209673_1002870 3300025273 Bacteria 10968
186 Ga0209130_1000046 3300025284 Bacteria 236658
187 Ga0209675_1000003 3300025291 Bacteria 1003982
188 Ga0209675_1001875 3300025291 Bacteria 11364
189 Ga0209676_1000383 3300025292 Bacteria 81259
190 Ga0209025_1000104 3300025294 Bacteria 226895
191 Ga0209025_1009487 3300025294 Bacteria 6767
192 Ga0209025_1019246 3300025294 Bacteria 3807
193 Ga0209564_1000007 3300025295 Bacteria 1028582
194 Ga0209564_1000012 3300025295 Bacteria 792078
195 Ga0209758_1000470 3300025297 Bacteria 66488
196 Ga0209050_1000457 3300025298 Bacteria 73281
197 Ga0209050_1000952 3300025298 Bacteria 37637
198 Ga0209050_1002564 3300025298 Bacteria 15154
199 Ga0209050_1003116 3300025298 Bacteria 12700
200 Ga0209050_1007715 3300025298 Bacteria 5943
201 Ga0209256_1000019 3300025299 Bacteria 558627
202 Ga0209256_1000040 3300025299 Bacteria 366839
203 Ga0209256_1000112 3300025299 Bacteria 178432
204 Ga0209256_1001512 3300025299 Bacteria 23519
205 Ga0209051_1000004 3300025303 Bacteria 1155596
206 Ga0209051_1000024 3300025303 Bacteria 437007
207 Ga0209051_1000259 3300025303 Bacteria 88311
208 Ga0209051_1001071 3300025303 Bacteria 25392
209 Ga0209257_1000032 3300025304 Bacteria 680354
210 Ga0209257_1000038 3300025304 Bacteria 609032
211 Ga0209257_1000044 3300025304 Bacteria 486709
212 Ga0209257_1000079 3300025304 Bacteria 316420
213 Ga0209257_1000116 3300025304 Bacteria 228733
214 Ga0209257_1001479 3300025304 Bacteria 27607
215 Ga0209257_1012510 3300025304 Bacteria 3908
216 Ga0207656_10041693 3300025321 Unclassified 1951
217 Ga0207696_1018588 3300025711 Bacteria 2278
218 Ga0207682_10014949 3300025893 Bacteria 3023
219 Ga0207680_10003657 3300025903 Bacteria 7226
220 Ga0207645_10050339 3300025907 Bacteria 2660
221 Ga0207705_10092283 3300025909 Bacteria 2218
222 Ga0207654_10000071 3300025911 Bacteria 66350
223 Ga0207695_10000052 3300025913 Bacteria 398089
224 Ga0207695_10000108 3300025913 Bacteria 252306
225 Ga0207695_10000871 3300025913 Bacteria 54947
226 Ga0207695_10001287 3300025913 Bacteria 42580
227 Ga0207695_10007296 3300025913 Bacteria 14115
228 Ga0207695_10034453 3300025913 Bacteria 5506
229 Ga0207671_10041368 3300025914 Bacteria 3411
230 Ga0207649_10002578 3300025920 Bacteria 10084
231 Ga0207649_10032172 3300025920 Bacteria 3124
232 Ga0207649_10114977 3300025920 Bacteria 1804
233 Ga0207681_10000007 3300025923 Bacteria 483669
234 Ga0207681_10003171 3300025923 Bacteria 10324
235 Ga0207694_10000325 3300025924 Bacteria 44875
236 Ga0207694_10001907 3300025924 Bacteria 17284
237 Ga0207694_10029904 3300025924 Bacteria 4159
238 Ga0207650_10030324 3300025925 Bacteria 3894
239 Ga0207650_10035438 3300025925 Bacteria 3624
240 Ga0207659_10003304 3300025926 Bacteria 9661
241 Ga0207687_10005795 3300025927 Bacteria 8174
242 Ga0207687_10014384 3300025927 Bacteria 5177
243 Ga0207644_10003061 3300025931 Bacteria 10764
244 Ga0207644_10017370 3300025931 Bacteria 4857
245 Ga0207644_10021046 3300025931 Bacteria 4440
246 Ga0207690_10019544 3300025932 Bacteria 4174
247 Ga0207706_10018657 3300025933 Bacteria 6242
248 Ga0207686_10013295 3300025934 Bacteria 4552
249 Ga0207709_10000079 3300025935 Bacteria 166220
250 Ga0207709_10003711 3300025935 Bacteria 8997
251 Ga0207670_10019961 3300025936 Bacteria 4106
252 Ga0207669_10023996 3300025937 Bacteria 3270
253 Ga0207704_10039101 3300025938 Bacteria 2758
254 Ga0207665_10023938 3300025939 Bacteria 4023
255 Ga0207665_10071907 3300025939 Bacteria 2362
256 Ga0207691_10023893 3300025940 Bacteria 5752
257 Ga0207691_10106302 3300025940 Bacteria 2500
258 Ga0207711_10005291 3300025941 Bacteria 10937
259 Ga0207711_10005714 3300025941 Bacteria 10495
260 Ga0207711_10009838 3300025941 Bacteria 7951
261 Ga0207711_10086363 3300025941 Bacteria 2750
262 Ga0207689_10000130 3300025942 Bacteria 63848
263 Ga0207661_10025351 3300025944 Bacteria 4505
264 Ga0207661_10068305 3300025944 Bacteria 2894
265 Ga0207679_10003600 3300025945 Bacteria 9610
266 Ga0207679_10015513 3300025945 Bacteria 5037
267 Ga0207679_10037210 3300025945 Bacteria 3458
268 Ga0207667_10006870 3300025949 Bacteria 13747
269 Ga0207667_10110980 3300025949 Bacteria 2829
270 Ga0207658_10002873 3300025986 Bacteria 12339
271 Ga0207677_10002815 3300026023 Bacteria 9177
272 Ga0207677_10009409 3300026023 Bacteria 5501
273 Ga0207703_10012835 3300026035 Bacteria 6533
274 Ga0207639_10000180 3300026041 Bacteria 49455
275 Ga0207639_10078531 3300026041 Unclassified 2605
276 Ga0207678_10012387 3300026067 Bacteria 7485
277 Ga0207702_10013479 3300026078 Bacteria 6792
278 Ga0207702_10065861 3300026078 Bacteria 3103
279 Ga0207702_10251827 3300026078 Bacteria 1659
280 Ga0207641_10002565 3300026088 Bacteria 16707
281 Ga0207648_10000002 3300026089 Bacteria 307909
282 Ga0207676_10004582 3300026095 Bacteria 9791
283 Ga0207674_10000910 3300026116 Bacteria 38534
284 Ga0207674_10153284 3300026116 Bacteria 2260
285 Ga0207683_10056178 3300026121 Bacteria 3452
286 Ga0207683_10085729 3300026121 Bacteria 2800
287 Ga0207698_10000007 3300026142 Bacteria 289457
288 Ga0207698_10016734 3300026142 Bacteria 4954
289 Ga0207698_10021579 3300026142 Bacteria 4458
290 Ga0207698_10034846 3300026142 Bacteria 3675
291 Ga0207698_10066809 3300026142 Bacteria 2832
292 Ga0209281_1000023 3300027111 Bacteria 519955
293 Ga0209281_1000067 3300027111 Bacteria 284517
294 Ga0209389_1019082 3300027296 Bacteria 6150
295 Ga0209970_1000371 3300027614 Bacteria 7551
296 Ga0209282_1000003 3300027666 Bacteria 856377
297 Ga0209813_10005387 3300027866 Bacteria 3102
298 Ga0209974_10003224 3300027876 Bacteria 5898
299 Ga0209974_10007078 3300027876 Bacteria 3876
300 Ga0268265_10243245 3300028380 Bacteria 1589
301 Ga0268264_10003544 3300028381 Bacteria 13439
302 Ga0307517_10034295 3300028786 Bacteria 5784
303 Ga0307517_10076967 3300028786 Bacteria 2906
304 Ga0307515_10000013 3300028794 Bacteria 568456
305 Ga0307515_10000123 3300028794 Bacteria 186601
306 Ga0307515_10000821 3300028794 Bacteria 71579
307 Ga0307515_10007649 3300028794 Bacteria 21312
308 Ga0307515_10011224 3300028794 Bacteria 17013
309 Ga0307515_10052885 3300028794 Bacteria 6009
310 Ga0307515_10053868 3300028794 Bacteria 5921
311 Ga0307515_10054206 3300028794 Bacteria 5893
312 Ga0307515_10068407 3300028794 Bacteria 4879
313 Ga0307515_10143864 3300028794 Bacteria 2539
314 Ga0265338_10013956 3300028800 Bacteria 9010
315 Ga0265338_10114529 3300028800 Unclassified 2164
316 Ga0307512_10010148 3300030522 Bacteria 9006
317 Ga0307512_10022819 3300030522 Bacteria 5609
318 Ga0307512_10070486 3300030522 Bacteria 2603
319 Ga0265760_10015107 3300031090 Bacteria 2213
320 Ga0265330_10000828 3300031235 Bacteria 19434
321 Ga0265330_10011853 3300031235 Bacteria 4081
322 Ga0265332_10000006 3300031238 Bacteria 327963
323 Ga0265328_10008184 3300031239 Bacteria 4326
324 Ga0265325_10000664 3300031241 Bacteria 25082
325 Ga0265339_10000089 3300031249 Bacteria 77145
326 Ga0265331_10058357 3300031250 Bacteria 1827
327 Ga0265327_10001820 3300031251 Bacteria 24933
328 Ga0265316_10000668 3300031344 Bacteria 38227
329 Ga0265316_10000687 3300031344 Bacteria 37565
330 Ga0265316_10033744 3300031344 Bacteria 4165
331 Ga0307513_10003902 3300031456 Bacteria 20051
332 Ga0307513_10004611 3300031456 Bacteria 18355
333 Ga0307513_10013254 3300031456 Bacteria 10122
334 Ga0307513_10056384 3300031456 Bacteria 4195
335 Ga0307513_10091445 3300031456 Bacteria 3101
336 Ga0307513_10104709 3300031456 Bacteria 2841
337 Ga0307509_10000293 3300031507 Bacteria 82770
338 Ga0307509_10003313 3300031507 Bacteria 24671
339 Ga0307509_10021372 3300031507 Bacteria 7317
340 Ga0307509_10113167 3300031507 Bacteria 2712
341 Ga0307408_100000046 3300031548 Bacteria 167686
342 Ga0307408_100000298 3300031548 Bacteria 47947
343 Ga0307408_100032935 3300031548 Bacteria 3617
344 Ga0265313_10006038 3300031595 Bacteria 8738
345 Ga0265313_10020751 3300031595 Bacteria 3615
346 Ga0265313_10023895 3300031595 Bacteria 3281
347 Ga0307508_10000134 3300031616 Bacteria 87501
348 Ga0307508_10000524 3300031616 Bacteria 45505
349 Ga0307514_10022006 3300031649 Bacteria 5190
350 Ga0265314_10000081 3300031711 Bacteria 143776
351 Ga0265342_10003868 3300031712 Bacteria 12046
352 Ga0265342_10005184 3300031712 Bacteria 10016
353 Ga0307516_10000672 3300031730 Bacteria 46304
354 Ga0307516_10013080 3300031730 Bacteria 8874
355 Ga0307516_10029199 3300031730 Bacteria 5576
356 Ga0307413_10066872 3300031824 Bacteria 2245
357 Ga0307518_10117944 3300031838 Bacteria 1882
358 Ga0307406_10000234 3300031901 Bacteria 33721
359 Ga0307414_10058803 3300032004 Bacteria 2710
360 Ga0307411_10040292 3300032005 Bacteria 2962
361 Ga0307510_10000207 3300033180 Bacteria 51708
362 Ga0307510_10005691 3300033180 Bacteria 14850
363 Ga0307510_10054384 3300033180 Bacteria 4193
364 Ga0307510_10065288 3300033180 Bacteria 3688
365 Ga0373939_0000004 3300035114 Bacteria 106519
366 Ga0373960_0001935 3300035121 Bacteria 4644
367 Ga0395899_0021331 3300037312 Bacteria 4913
368 Ga0395905_0000117 3300037471 Bacteria 133291
369 Ga0395905_0001029 3300037471 Bacteria 35545
370 Ga0395905_0014246 3300037471 Bacteria 7596
371 Ga0395905_0058968 3300037471 Bacteria 3589
372 Ga0395901_0116165 3300038443 Bacteria 2811
373 Ga0436365_0860276 3300039437 Bacteria 4987
374 Ga0439461_0001755 3300041410 Bacteria 3390
375 Ga0439462_0000640 3300042015 Bacteria 7031
376 Ga0450888_000211 3300042126 Bacteria 5225
377 Ga0450891_000495 3300042129 Bacteria 4115
378 Ga0450903_004917 3300042138 Bacteria 2253
379 Ga0450889_000406 3300042144 Bacteria 4808
380 Ga0450918_000112 3300042531 Bacteria 17468
381 Ga0450893_0004099 3300042532 Bacteria 2317
382 Ga0451577_0002719 3300042876 Bacteria 20577
383 Ga0451577_0012040 3300042876 Bacteria 8138
384 Ga0451577_0023261 3300042876 Bacteria 5652
385 Ga0451577_0085649 3300042876 Bacteria 2812
386 Ga0466969_0019479 3300044656 Bacteria 3526
387 Ga0466969_0067618 3300044656 Bacteria 1724
388 Ga0453683_0058409 3300044673 Bacteria 2413
389 Ga0466965_0011906 3300044683 Bacteria 4083
390 Ga0466965_0067857 3300044683 Bacteria 1790
391 Ga0466966_0073230 3300044684 Bacteria 2143
392 Ga0466961_0010615 3300044693 Bacteria 5878
393 Ga0466963_0005063 3300044694 Bacteria 7701
394 Ga0453684_0017908 3300044712 Bacteria 10930
395 Ga0453684_0115348 3300044712 Bacteria 3255
396 Ga0453684_0194796 3300044712 Bacteria 2368
397 Ga0453684_0272682 3300044712 Bacteria 1932
398 Ga0466970_0093423 3300044765 Bacteria 1634
399 Ga0466960_0021626 3300044901 Bacteria 2867
400 Ga0451576_0004176 3300045051 Bacteria 19014
401 Ga0451576_0006080 3300045051 Bacteria 14882
402 Ga0451576_0069102 3300045051 Bacteria 3675
403 Ga0451576_0132700 3300045051 Bacteria 2596
404 Ga0466967_0000280 3300045976 Bacteria 22598
405 Ga0495617_000033 3300046452 Bacteria 147979
406 Ga0495627_011912 3300046453 Bacteria 3101
407 Ga0495592_0000555 3300046454 Bacteria 26626
408 Ga0495590_0000005 3300046457 Bacteria 384276
409 Ga0495638_0000436 3300046460 Bacteria 50390
410 Ga0495638_0006325 3300046460 Bacteria 8631
411 Ga0495638_0046824 3300046460 Bacteria 2715
412 Ga0495650_0000115 3300046471 Bacteria 190869
413 Ga0495650_0000648 3300046471 Bacteria 45807
414 Ga0495650_0000909 3300046471 Bacteria 34900
415 Ga0495650_0001166 3300046471 Bacteria 28063
416 Ga0495650_0001915 3300046471 Bacteria 18439
417 Ga0495580_0126585 3300046472 Bacteria 1773
418 Ga0495639_0072794 3300046475 Bacteria 1590
419 Ga0495607_0008173 3300046501 Bacteria 7172
420 Ga0495583_0000709 3300046506 Bacteria 42771
421 Ga0495606_0000053 3300046507 Bacteria 200818
422 Ga0495606_0007009 3300046507 Bacteria 10229
423 Ga0495606_0016008 3300046507 Bacteria 5743
424 Ga0495606_0025808 3300046507 Bacteria 4199
425 Ga0495606_0039977 3300046507 Bacteria 3155
426 Ga0495610_0000181 3300046512 Bacteria 70215
427 Ga0495610_0003889 3300046512 Bacteria 11333
428 Ga0495610_0012165 3300046512 Bacteria 5200
429 Ga0495610_0014665 3300046512 Bacteria 4594
430 Ga0495610_0047952 3300046512 Bacteria 2099
431 Ga0495616_0028134 3300046513 Bacteria 2977
432 Ga0495631_0000408 3300046518 Bacteria 29643
433 Ga0495632_0017181 3300046519 Bacteria 4001
434 Ga0495637_0000207 3300046520 Bacteria 46156
435 Ga0495643_0000195 3300046522 Bacteria 96110
436 Ga0495643_0000516 3300046522 Bacteria 48137
437 Ga0495648_0000002 3300046524 Bacteria 593972
438 Ga0495642_0005491 3300046528 Bacteria 4868
439 Ga0495654_0000002 3300046530 Bacteria 1021205
440 Ga0495609_0001952 3300046538 Bacteria 13103
441 Ga0495609_0009864 3300046538 Bacteria 4604
442 Ga0495609_0012100 3300046538 Bacteria 4096
443 Ga0495621_0001025 3300046539 Bacteria 7160
444 Ga0495597_0000322 3300046542 Bacteria 43315
445 Ga0495597_0000936 3300046542 Bacteria 22526
446 Ga0495622_0000810 3300046557 Bacteria 17296
447 Ga0495622_0071767 3300046557 Bacteria 1598
448 Ga0495633_0000382 3300046558 Bacteria 46834
449 Ga0495633_0006458 3300046558 Bacteria 6943
450 Ga0495633_0011051 3300046558 Bacteria 4898
451 Ga0495633_0020109 3300046558 Bacteria 3363
452 Ga0495668_0000006 3300046616 Bacteria 553404
453 Ga0495668_0000931 3300046616 Bacteria 32633
454 Ga0495668_0001037 3300046616 Bacteria 29441
455 Ga0495668_0004618 3300046616 Bacteria 9680
456 Ga0495668_0005457 3300046616 Bacteria 8612
457 Ga0495625_0000124 3300046660 Bacteria 120849
458 Ga0495625_0001378 3300046660 Bacteria 29876
459 Ga0495625_0002387 3300046660 Bacteria 20399
460 Ga0495625_0006874 3300046660 Bacteria 10045
461 Ga0495625_0007589 3300046660 Bacteria 9417
462 Ga0495625_0013475 3300046660 Bacteria 6568
463 Ga0495625_0019381 3300046660 Bacteria 5279
464 Ga0495661_0070356 3300046665 Bacteria 2048
465 Ga0495658_0008123 3300046683 Bacteria 5197
466 Ga0495658_0027845 3300046683 Bacteria 3045
467 Ga0495658_0055156 3300046683 Bacteria 2263
468 Ga0495669_0009656 3300046684 Bacteria 4071
469 Ga0495649_0005207 3300046694 Bacteria 8327
470 Ga0495649_0012321 3300046694 Bacteria 4983
471 Ga0495660_0012961 3300046810 Bacteria 4833
472 Ga0495660_0028502 3300046810 Bacteria 3155
473 Ga0495660_0073756 3300046810 Bacteria 1804
474 Ga0495672_0000398 3300047320 Bacteria 52924
475 Ga0495687_000719 3300047443 Bacteria 36657
476 Ga0495687_001182 3300047443 Bacteria 25172
477 Ga0495687_006047 3300047443 Bacteria 7538
478 Ga0495687_032737 3300047443 Bacteria 2368
479 Ga0495677_0002811 3300047445 Bacteria 6790
480 Ga0495673_0000005 3300047469 Bacteria 943364
481 Ga0495681_0017829 3300047470 Bacteria 3931
482 Ga0495686_0001694 3300047472 Bacteria 22811
483 Ga0495686_0011656 3300047472 Bacteria 6189
484 Ga0495686_0024618 3300047472 Bacteria 3953
485 Ga0495686_0036736 3300047472 Bacteria 3143
486 Ga0495686_0040601 3300047472 Bacteria 2967
487 Ga0495593_0003185 3300047673 Bacteria 9855
488 Ga0495614_0003925 3300048089 Bacteria 6678
489 Ga0496100_0070902 3300048903 Bacteria 2325
490 Ga0496101_0063906 3300048904 Bacteria 2680
491 Ga0496102_0029736 3300048905 Bacteria 4889
492 Ga0496108_0066961 3300048911 Bacteria 3029
493 Ga0496109_0033424 3300048912 Bacteria 4627
494 Ga0496109_0038751 3300048912 Bacteria 4311
495 Ga0496110_0016350 3300048913 Bacteria 6195
496 Ga0496110_0045911 3300048913 Bacteria 3820
497 Ga0496110_0089314 3300048913 Bacteria 2754
498 Ga0496114_0012042 3300048917 Bacteria 6920
499 Ga0496114_0197243 3300048917 Bacteria 1762
500 Ga0496115_0015447 3300048918 Bacteria 5791
501 Ga0496116_0023363 3300048919 Bacteria 4606
502 Ga0496117_0019331 3300048920 Bacteria 5601
503 Ga0496121_0066366 3300048924 Bacteria 2930
504 Ga0496123_0016544 3300048926 Bacteria 5980
505 Ga0496123_0016684 3300048926 Bacteria 5947
506 Ga0496123_0057100 3300048926 Bacteria 2544
507 Ga0496124_0070178 3300048927 Bacteria 2907
508 Ga0496124_0093200 3300048927 Bacteria 2452
509 Ga0496125_0020270 3300048928 Bacteria 6243
510 Ga0496126_0000286 3300048929 Bacteria 106913
511 Ga0496126_0038132 3300048929 Bacteria 4473
512 Ga0496126_0082898 3300048929 Bacteria 2831
513 Ga0501310_000422 3300049130 Bacteria 3732
514 Ga0495678_000291 3300049459 Bacteria 55271
515 Ga0495678_011834 3300049459 Bacteria 4160
516 Ga0495678_012811 3300049459 Bacteria 3960
517 Ga0501033_0096855 3300049570 Bacteria 2156
518 Ga0501039_0001422 3300049575 Bacteria 17622
519 Ga0501042_0025892 3300049578 Bacteria 4123
520 Ga0501076_0003274 3300049592 Bacteria 11341
521 Ga0501211_000098 3300049658 Bacteria 6418
522 Ga0501222_006910 3300049662 Bacteria 1519
523 Ga0501223_006978 3300049663 Bacteria 2320
524 Ga0501221_001202 3300049704 Bacteria 4286
525 Ga0501079_0015539 3300049741 Bacteria 5811
526 Ga0501080_0005820 3300049742 Bacteria 11037
527 Ga0501081_0000516 3300049743 Bacteria 21719
528 Ga0501083_0092830 3300049744 Bacteria 1993
529 Ga0501266_000571 3300049763 Bacteria 4884
530 Ga0501267_000375 3300049764 Bacteria 3395
531 Ga0501272_003063 3300049769 Bacteria 1681
532 Ga0501045_0011790 3300049824 Bacteria 6141
533 nmdc:mga03n38_17291_c1 3300050490 Bacteria 2821
534 nmdc:mga00v17_78600_c1 3300050491 Bacteria 2056
535 nmdc:mga0k408_19148_c1 3300050493 Bacteria 3823
536 nmdc:mga0k408_206_c1 3300050493 Bacteria 31456
537 nmdc:mga0k408_2372_c1 3300050493 Bacteria 8674
538 nmdc:mga0k408_31974_c1 3300050493 Bacteria 3007
539 nmdc:mga0k408_67551_c1 3300050493 Bacteria 2083
540 nmdc:mga0k408_7060_c1 3300050493 Bacteria 5999
541 nmdc:mga0k408_8217_c1 3300050493 Bacteria 5594
542 nmdc:mga0k408_866_c1 3300050493 Bacteria 16663
543 nmdc:mga0k408_98135_c1 3300050493 Bacteria 1726
544 nmdc:mga04h51_8087_c1 3300050495 Bacteria 2804
545 nmdc:mga07m45_1680_c1 3300050496 Bacteria 10182
546 nmdc:mga07m45_3456_c1 3300050496 Bacteria 7619
547 nmdc:mga07m45_52257_c1 3300050496 Bacteria 2306
548 nmdc:mga07m45_63535_c1 3300050496 Bacteria 2094
549 nmdc:mga08x19_34902_c1 3300050514 Bacteria 3181
550 Ga0500610_0000519 3300053079 Bacteria 11857
551 Ga0500610_0000524 3300053079 Bacteria 11812
552 Ga0500651_0000002 3300053093 Bacteria 476609
553 Ga0500651_0000015 3300053093 Bacteria 161416
554 Ga0500651_0005156 3300053093 Bacteria 7435
555 Ga0500571_000017 3300053110 Bacteria 64361
556 Ga0500593_000637 3300053117 Bacteria 13500
557 Ga0500593_000662 3300053117 Bacteria 13129
558 Ga0500594_0001863 3300053118 Bacteria 4571
559 Ga0500595_000044 3300053119 Bacteria 91895
560 Ga0500607_000025 3300053121 Bacteria 95473
561 Ga0500607_005461 3300053121 Bacteria 8314
562 Ga0500618_000258 3300053125 Bacteria 41850
563 Ga0500655_000069 3300053133 Bacteria 27666
564 Ga0500658_0000054 3300053134 Bacteria 60941
565 Ga0500658_0000248 3300053134 Bacteria 25326
566 Ga0500658_0017066 3300053134 Bacteria 2709
567 Ga0500658_0029041 3300053134 Bacteria 2149
568 Ga0500559_0000049 3300053136 Bacteria 93378
569 Ga0500559_0000670 3300053136 Bacteria 22910
570 Ga0500559_0009307 3300053136 Bacteria 4258
571 Ga0500564_012408 3300053138 Bacteria 3786
572 Ga0500568_0001431 3300053139 Bacteria 15473
573 Ga0500568_0007211 3300053139 Bacteria 5478
574 Ga0500586_000361 3300053145 Bacteria 9043
575 Ga0500616_0013029 3300053153 Bacteria 4843
576 Ga0500622_0003710 3300053156 Bacteria 10014
577 Ga0500627_0000836 3300053158 Bacteria 8244
578 Ga0500634_0000599 3300053161 Bacteria 12040
579 Ga0500636_0013941 3300053177 Bacteria 4725
580 Ga0500625_022389 3300053729 Bacteria 2985
581 2548501838 2547132374 Bacteria 5530232
582 2587756170 2585428062 Bacteria 6842168
583 2587758192 2585428062 Bacteria 6842168
584 2599623835 2599185214 Bacteria 8209958
585 2599671546 2599185226 Bacteria 8233575
586 2599681441 2599185227 Bacteria 8246414
587 2599693156 2599185229 Bacteria 8216126
588 2643745946 2643221544 Bacteria 5886209
589 2643864049 2643221570 Bacteria 5103772
590 2643936919 2643221585 Bacteria 5812563
591 2643992359 2643221596 Bacteria 5006805
592 2644060026 2643221609 Bacteria 6756331
593 2644072630 2643221611 Bacteria 6820941
594 2644220840 2643221639 Bacteria 6649903
595 2644247780 2643221644 Bacteria 6865017
596 2644256551 2643221646 Bacteria 6433402
597 2644292294 2643221652 Bacteria 5140275
598 2644305647 2643221654 Bacteria 5273570
599 2644318084 2643221656 Bacteria 5809961
600 2644400394 2643221672 Bacteria 6322190
601 2644646436 2643221717 Bacteria 5676132
602 2722883036 2721755523 Bacteria 6430384
603 2738717832 2738541277 Bacteria 7458140
604 2739245654 2738543012 Bacteria 7115078
605 2739278518 2738543019 Bacteria 7459457
606 2816470442 2816332133 Bacteria 7249298
607 2830076674 2830075706 Bacteria 3855215
608 2831266440 2831265667 Bacteria 7184833
609 2838057438 2838054893 Bacteria 7451788
610 2839143834 2839138175 Bacteria 6549354
611 2842716519 2842711865 Bacteria 7155354
612 2857560118 2857558681 Bacteria 6617694
613 2857566695 2857564685 Bacteria 6290584
614 2885204576 2885198086 Bacteria 7212419
615 2885218229 2885211737 Bacteria 7212420
616 2904544978 2904541872 Bacteria 8915136
617 2928084448 2928084124 Bacteria 7159212
618 2929163350 2929160207 Bacteria 9075316
619 2945985688 2945984333 Bacteria 7358892
620 2990714580 2990710928 Bacteria 5002431
621 Ga0265319_1024086
622 JGI24740J21852_10007769
623 JGI25150J39212_1000845
624 JGI25159J45721_1002918
625 JGI25151J46595_10000507
626 rootH1_10001187
627 rootH1_10021293
628 rootH1_10034163
629 rootH2_10051907
630 rootH2_10236065
631 rootL2_10026577
632 rootL2_10057017
633 rootL2_10063119
634 rootL2_10069657
635 rootH1_10002908
636 rootH1_10048416
637 rootH1_10199011
638 Ga0055526_1000019
639 Ga0055526_1000283
640 Ga0055537_1000063
641 Ga0055524_1000025
642 Ga0055524_1000231
643 Ga0055534_1000208
644 Ga0055528_1000013
645 Ga0055530_10001969
646 Ga0055530_10003523
647 Ga0055530_10005653
648 Ga0055540_1000002
649 Ga0055540_1000007
650 Ga0055540_1000365
651 Ga0055531_10000330
652 Ga0055531_10000454
653 Ga0055531_10004266
654 Ga0055531_10005653
655 Ga0055543_1004851
656 Ga0065165_1000005
657 Ga0065165_1000600
658 Ga0065165_1022534
659 Ga0070676_10043747
660 Ga0070683_100009180
661 Ga0070683_100080553
662 Ga0070683_100132244
663 Ga0070690_100010947
664 Ga0070670_100023816
665 Ga0070670_100168566
666 Ga0070677_10046585
667 Ga0068869_100015798
668 Ga0070666_10013184
669 Ga0068868_100000459
670 Ga0068868_100012059
671 Ga0070689_100028788
672 Ga0070661_100018235
673 Ga0070661_100140469
674 Ga0070669_100000003
675 Ga0070669_100003404
676 Ga0070675_100003600
677 Ga0070671_100002176
678 Ga0070671_100010892
679 Ga0070673_100090375
680 Ga0070659_100001364
681 Ga0070667_100003020
682 Ga0070714_100022255
683 Ga0070708_100163057
684 Ga0070663_100016762
685 Ga0070678_100009945
686 Ga0068867_100000104
687 Ga0068853_100021881
688 Ga0068853_100193960
689 Ga0070672_100017706
690 Ga0070665_100045053
691 Ga0068855_100002944
692 Ga0068855_100003346
693 Ga0068855_100017040
694 Ga0068855_100135831
695 Ga0070664_100011153
696 Ga0070664_100106188
697 Ga0068857_100029350
698 Ga0068857_100069422
699 Ga0068854_100107239
700 Ga0068852_100000029
701 Ga0068852_100065174
702 Ga0068852_100098610
703 Ga0068852_100115605
704 Ga0068859_100009449
705 Ga0068859_100011237
706 Ga0068864_100000508
707 Ga0068851_10031800
708 Ga0068863_100004264
709 Ga0068858_100003059
710 Ga0068858_100007399
711 Ga0068860_100002923
712 Ga0068860_100029800
713 Ga0068862_100188068
714 Ga0075368_10034903
715 Ga0075368_10049595
716 Ga0070716_100008307
717 Ga0075362_10003212
718 Ga0075367_10095764
719 Ga0075366_10000953
720 Ga0075366_10006014
721 Ga0075366_10006123
722 Ga0075366_10006670
723 Ga0075366_10010043
724 Ga0075366_10013544
725 Ga0075366_10080707
726 Ga0097621_100024443
727 Ga0097621_100084865
728 Ga0075370_10002530
729 Ga0075370_10006406
730 Ga0075370_10014495
731 Ga0075370_10020690
732 Ga0075370_10047533
733 Ga0068871_100002115
734 Ga0068871_100009407
735 Ga0097620_100009449
736 Ga0097620_100011237
737 Ga0099823_1000486
738 Ga0079104_1000009
739 Ga0079104_1000026
740 Ga0099826_10000005
741 Ga0105244_10014545
742 Ga0105250_10011713
743 Ga0105240_10000065
744 Ga0105240_10001689
745 Ga0105240_10002980
746 Ga0105240_10019655
747 Ga0105245_10031127
748 Ga0105247_10010043
749 Ga0105243_10028774
750 Ga0105243_10065810
751 Ga0105243_10095312
752 Ga0105241_10000041
753 Ga0105241_10015877
754 Ga0105242_10002719
755 Ga0105242_10004451
756 Ga0105248_10001095
757 Ga0105248_10007574
758 Ga0105248_10007741
759 Ga0105248_10017921
760 Ga0105248_10053312
761 Ga0105237_10038549
762 Ga0105237_10101519
763 Ga0105238_10000801
764 Ga0105238_10001399
765 Ga0105238_10022854
766 Ga0105238_10067384
767 Ga0105239_10003395
768 Ga0105239_10017636
769 Ga0105239_10094985
770 Ga0157370_10000009
771 Ga0157370_10004596
772 Ga0157369_10000022
773 Ga0157369_10005047
774 Ga0157369_10050421
775 Ga0157369_10056323
776 Ga0157374_10001997
777 Ga0157374_10007172
778 Ga0157374_10026227
779 Ga0157374_10059589
780 Ga0157374_10081211
781 Ga0157374_10086228
782 Ga0157378_10002642
783 Ga0157378_10021006
784 Ga0157378_10041080
785 Ga0157372_10000040
786 Ga0157372_10033363
787 Ga0157372_10109399
788 Ga0163163_10004179
789 Ga0163163_10004762
790 Ga0163163_10045881
791 Ga0163163_10198094
792 Ga0182008_10010462
793 Ga0157377_10000010
794 Ga0157379_10002001
795 Ga0157379_10017963
796 Ga0157379_10023321
797 Ga0183363_1015
798 Ga0163161_10013846
799 Ga0213876_10012608
800 Ga0207425_1000297
801 Ga0209129_1004819
802 Ga0209565_1000003
803 Ga0209673_1000003
804 Ga0209673_1002870
805 Ga0209130_1000046
806 Ga0209675_1000003
807 Ga0209675_1001875
808 Ga0209676_1000383
809 Ga0209025_1000104
810 Ga0209025_1009487
811 Ga0209025_1019246
812 Ga0209564_1000007
813 Ga0209564_1000012
814 Ga0209758_1000470
815 Ga0209050_1000457
816 Ga0209050_1000952
817 Ga0209050_1002564
818 Ga0209050_1003116
819 Ga0209050_1007715
820 Ga0209256_1000019
821 Ga0209256_1000040
822 Ga0209256_1000112
823 Ga0209256_1001512
824 Ga0209051_1000004
825 Ga0209051_1000024
826 Ga0209051_1000259
827 Ga0209051_1001071
828 Ga0209257_1000032
829 Ga0209257_1000038
830 Ga0209257_1000044
831 Ga0209257_1000079
832 Ga0209257_1000116
833 Ga0209257_1001479
834 Ga0209257_1012510
835 Ga0207656_10041693
836 Ga0207696_1018588
837 Ga0207682_10014949
838 Ga0207680_10003657
839 Ga0207645_10050339
840 Ga0207705_10092283
841 Ga0207654_10000071
842 Ga0207695_10000052
843 Ga0207695_10000108
844 Ga0207695_10000871
845 Ga0207695_10001287
846 Ga0207695_10007296
847 Ga0207695_10034453
848 Ga0207671_10041368
849 Ga0207649_10002578
850 Ga0207649_10032172
851 Ga0207649_10114977
852 Ga0207681_10000007
853 Ga0207681_10003171
854 Ga0207694_10000325
855 Ga0207694_10001907
856 Ga0207694_10029904
857 Ga0207650_10030324
858 Ga0207650_10035438
859 Ga0207659_10003304
860 Ga0207687_10005795
861 Ga0207687_10014384
862 Ga0207644_10003061
863 Ga0207644_10017370
864 Ga0207644_10021046
865 Ga0207690_10019544
866 Ga0207706_10018657
867 Ga0207686_10013295
868 Ga0207709_10000079
869 Ga0207709_10003711
870 Ga0207670_10019961
871 Ga0207669_10023996
872 Ga0207704_10039101
873 Ga0207665_10023938
874 Ga0207665_10071907
875 Ga0207691_10023893
876 Ga0207691_10106302
877 Ga0207711_10005291
878 Ga0207711_10005714
879 Ga0207711_10009838
880 Ga0207711_10086363
881 Ga0207689_10000130
882 Ga0207661_10025351
883 Ga0207661_10068305
884 Ga0207679_10003600
885 Ga0207679_10015513
886 Ga0207679_10037210
887 Ga0207667_10006870
888 Ga0207667_10110980
889 Ga0207658_10002873
890 Ga0207677_10002815
891 Ga0207677_10009409
892 Ga0207703_10012835
893 Ga0207639_10000180
894 Ga0207639_10078531
895 Ga0207678_10012387
896 Ga0207702_10013479
897 Ga0207702_10065861
898 Ga0207702_10251827
899 Ga0207641_10002565
900 Ga0207648_10000002
901 Ga0207676_10004582
902 Ga0207674_10000910
903 Ga0207674_10153284
904 Ga0207683_10056178
905 Ga0207683_10085729
906 Ga0207698_10000007
907 Ga0207698_10016734
908 Ga0207698_10021579
909 Ga0207698_10034846
910 Ga0207698_10066809
911 Ga0209281_1000023
912 Ga0209281_1000067
913 Ga0209389_1019082
914 Ga0209970_1000371
915 Ga0209282_1000003
916 Ga0209813_10005387
917 Ga0209974_10003224
918 Ga0209974_10007078
919 Ga0268265_10243245
920 Ga0268264_10003544
921 Ga0307517_10034295
922 Ga0307517_10076967
923 Ga0307515_10000013
924 Ga0307515_10000123
925 Ga0307515_10000821
926 Ga0307515_10007649
927 Ga0307515_10011224
928 Ga0307515_10052885
929 Ga0307515_10053868
930 Ga0307515_10054206
931 Ga0307515_10068407
932 Ga0307515_10143864
933 Ga0265338_10013956
934 Ga0265338_10114529
935 Ga0307512_10010148
936 Ga0307512_10022819
937 Ga0307512_10070486
938 Ga0265760_10015107
939 Ga0265330_10000828
940 Ga0265330_10011853
941 Ga0265332_10000006
942 Ga0265328_10008184
943 Ga0265325_10000664
944 Ga0265339_10000089
945 Ga0265331_10058357
946 Ga0265327_10001820
947 Ga0265316_10000668
948 Ga0265316_10000687
949 Ga0265316_10033744
950 Ga0307513_10003902
951 Ga0307513_10004611
952 Ga0307513_10013254
953 Ga0307513_10056384
954 Ga0307513_10091445
955 Ga0307513_10104709
956 Ga0307509_10000293
957 Ga0307509_10003313
958 Ga0307509_10021372
959 Ga0307509_10113167
960 Ga0307408_100000046
961 Ga0307408_100000298
962 Ga0307408_100032935
963 Ga0265313_10006038
964 Ga0265313_10020751
965 Ga0265313_10023895
966 Ga0307508_10000134
967 Ga0307508_10000524
968 Ga0307514_10022006
969 Ga0265314_10000081
970 Ga0265342_10003868
971 Ga0265342_10005184
972 Ga0307516_10000672
973 Ga0307516_10013080
974 Ga0307516_10029199
975 Ga0307413_10066872
976 Ga0307518_10117944
977 Ga0307406_10000234
978 Ga0307414_10058803
979 Ga0307411_10040292
980 Ga0307510_10000207
981 Ga0307510_10005691
982 Ga0307510_10054384
983 Ga0307510_10065288
984 Ga0373939_0000004
985 Ga0373960_0001935
986 Ga0395899_0021331
987 Ga0395905_0000117
988 Ga0395905_0001029
989 Ga0395905_0014246
990 Ga0395905_0058968
991 Ga0395901_0116165
992 Ga0436365_0860276
993 Ga0439461_0001755
994 Ga0439462_0000640
995 Ga0450888_000211
996 Ga0450891_000495
997 Ga0450903_004917
998 Ga0450889_000406
999 Ga0450918_000112
1000 Ga0450893_0004099
1001 Ga0451577_0002719
1002 Ga0451577_0012040
1003 Ga0451577_0023261
1004 Ga0451577_0085649
1005 Ga0466969_0019479
1006 Ga0466969_0067618
1007 Ga0453683_0058409
1008 Ga0466965_0011906
1009 Ga0466965_0067857
1010 Ga0466966_0073230
1011 Ga0466961_0010615
1012 Ga0466963_0005063
1013 Ga0453684_0017908
1014 Ga0453684_0115348
1015 Ga0453684_0194796
1016 Ga0453684_0272682
1017 Ga0466970_0093423
1018 Ga0466960_0021626
1019 Ga0451576_0004176
1020 Ga0451576_0006080
1021 Ga0451576_0069102
1022 Ga0451576_0132700
1023 Ga0466967_0000280
1024 Ga0495617_000033
1025 Ga0495627_011912
1026 Ga0495592_0000555
1027 Ga0495590_0000005
1028 Ga0495638_0000436
1029 Ga0495638_0006325
1030 Ga0495638_0046824
1031 Ga0495650_0000115
1032 Ga0495650_0000648
1033 Ga0495650_0000909
1034 Ga0495650_0001166
1035 Ga0495650_0001915
1036 Ga0495580_0126585
1037 Ga0495639_0072794
1038 Ga0495607_0008173
1039 Ga0495583_0000709
1040 Ga0495606_0000053
1041 Ga0495606_0007009
1042 Ga0495606_0016008
1043 Ga0495606_0025808
1044 Ga0495606_0039977
1045 Ga0495610_0000181
1046 Ga0495610_0003889
1047 Ga0495610_0012165
1048 Ga0495610_0014665
1049 Ga0495610_0047952
1050 Ga0495616_0028134
1051 Ga0495631_0000408
1052 Ga0495632_0017181
1053 Ga0495637_0000207
1054 Ga0495643_0000195
1055 Ga0495643_0000516
1056 Ga0495648_0000002
1057 Ga0495642_0005491
1058 Ga0495654_0000002
1059 Ga0495609_0001952
1060 Ga0495609_0009864
1061 Ga0495609_0012100
1062 Ga0495621_0001025
1063 Ga0495597_0000322
1064 Ga0495597_0000936
1065 Ga0495622_0000810
1066 Ga0495622_0071767
1067 Ga0495633_0000382
1068 Ga0495633_0006458
1069 Ga0495633_0011051
1070 Ga0495633_0020109
1071 Ga0495668_0000006
1072 Ga0495668_0000931
1073 Ga0495668_0001037
1074 Ga0495668_0004618
1075 Ga0495668_0005457
1076 Ga0495625_0000124
1077 Ga0495625_0001378
1078 Ga0495625_0002387
1079 Ga0495625_0006874
1080 Ga0495625_0007589
1081 Ga0495625_0013475
1082 Ga0495625_0019381
1083 Ga0495661_0070356
1084 Ga0495658_0008123
1085 Ga0495658_0027845
1086 Ga0495658_0055156
1087 Ga0495669_0009656
1088 Ga0495649_0005207
1089 Ga0495649_0012321
1090 Ga0495660_0012961
1091 Ga0495660_0028502
1092 Ga0495660_0073756
1093 Ga0495672_0000398
1094 Ga0495687_000719
1095 Ga0495687_001182
1096 Ga0495687_006047
1097 Ga0495687_032737
1098 Ga0495677_0002811
1099 Ga0495673_0000005
1100 Ga0495681_0017829
1101 Ga0495686_0001694
1102 Ga0495686_0011656
1103 Ga0495686_0024618
1104 Ga0495686_0036736
1105 Ga0495686_0040601
1106 Ga0495593_0003185
1107 Ga0495614_0003925
1108 Ga0496100_0070902
1109 Ga0496101_0063906
1110 Ga0496102_0029736
1111 Ga0496108_0066961
1112 Ga0496109_0033424
1113 Ga0496109_0038751
1114 Ga0496110_0016350
1115 Ga0496110_0045911
1116 Ga0496110_0089314
1117 Ga0496114_0012042
1118 Ga0496114_0197243
1119 Ga0496115_0015447
1120 Ga0496116_0023363
1121 Ga0496117_0019331
1122 Ga0496121_0066366
1123 Ga0496123_0016544
1124 Ga0496123_0016684
1125 Ga0496123_0057100
1126 Ga0496124_0070178
1127 Ga0496124_0093200
1128 Ga0496125_0020270
1129 Ga0496126_0000286
1130 Ga0496126_0038132
1131 Ga0496126_0082898
1132 Ga0501310_000422
1133 Ga0495678_000291
1134 Ga0495678_011834
1135 Ga0495678_012811
1136 Ga0501033_0096855
1137 Ga0501039_0001422
1138 Ga0501042_0025892
1139 Ga0501076_0003274
1140 Ga0501211_000098
1141 Ga0501222_006910
1142 Ga0501223_006978
1143 Ga0501221_001202
1144 Ga0501079_0015539
1145 Ga0501080_0005820
1146 Ga0501081_0000516
1147 Ga0501083_0092830
1148 Ga0501266_000571
1149 Ga0501267_000375
1150 Ga0501272_003063
1151 Ga0501045_0011790
1152 nmdc:mga03n38_17291_c1
1153 nmdc:mga00v17_78600_c1
1154 nmdc:mga0k408_19148_c1
1155 nmdc:mga0k408_206_c1
1156 nmdc:mga0k408_2372_c1
1157 nmdc:mga0k408_31974_c1
1158 nmdc:mga0k408_67551_c1
1159 nmdc:mga0k408_7060_c1
1160 nmdc:mga0k408_8217_c1
1161 nmdc:mga0k408_866_c1
1162 nmdc:mga0k408_98135_c1
1163 nmdc:mga04h51_8087_c1
1164 nmdc:mga07m45_1680_c1
1165 nmdc:mga07m45_3456_c1
1166 nmdc:mga07m45_52257_c1
1167 nmdc:mga07m45_63535_c1
1168 nmdc:mga08x19_34902_c1
1169 Ga0500610_0000519
1170 Ga0500610_0000524
1171 Ga0500651_0000002
1172 Ga0500651_0000015
1173 Ga0500651_0005156
1174 Ga0500571_000017
1175 Ga0500593_000637
1176 Ga0500593_000662
1177 Ga0500594_0001863
1178 Ga0500595_000044
1179 Ga0500607_000025
1180 Ga0500607_005461
1181 Ga0500618_000258
1182 Ga0500655_000069
1183 Ga0500658_0000054
1184 Ga0500658_0000248
1185 Ga0500658_0017066
1186 Ga0500658_0029041
1187 Ga0500559_0000049
1188 Ga0500559_0000670
1189 Ga0500559_0009307
1190 Ga0500564_012408
1191 Ga0500568_0001431
1192 Ga0500568_0007211
1193 Ga0500586_000361
1194 Ga0500616_0013029
1195 Ga0500622_0003710
1196 Ga0500627_0000836
1197 Ga0500634_0000599
1198 Ga0500636_0013941
1199 Ga0500625_022389
1200 2548501838
1201 2587756170
1202 2587758192
1203 2599623835
1204 2599671546
1205 2599681441
1206 2599693156
1207 2643745946
1208 2643864049
1209 2643936919
1210 2643992359
1211 2644060026
1212 2644072630
1213 2644220840
1214 2644247780
1215 2644256551
1216 2644292294
1217 2644305647
1218 2644318084
1219 2644400394
1220 2644646436
1221 2722883036
1222 2738717832
1223 2739245654
1224 2739278518
1225 2816470442
1226 2830076674
1227 2831266440
1228 2838057438
1229 2839143834
1230 2842716519
1231 2857560118
1232 2857566695
1233 2885204576
1234 2885218229
1235 2904544978
1236 2928084448
1237 2929163350
1238 2945985688
1239 2990714580

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07394

DUF1501

Protein of unknown function (DUF1501)

357

525

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g4g-assembly3.cif.gz_C full length ectodomain of ectonucleotide phosphodiesterase/pyrophosphatase-3 (npp3) including the smb domains but with a partially disordered active site structure 0.7496 296 375
4gtz-assembly1.cif.gz_A crystal structure of mouse enpp1 in complex with cmp 0.7406 295 380
4gtz-assembly2.cif.gz_B crystal structure of mouse enpp1 in complex with cmp 0.7258 317 380
6c01-assembly2.cif.gz_B human ectonucleotide pyrophosphatase / phosphodiesterase 3 (enpp3, npp3, cd203c) 0.722 295 379
6f2y-assembly2.cif.gz_B crystal structure of ectonucleotide phosphodiesterase/pyrophosphatase-3 (npp3) in complex with ap4a 0.7127 295 379
ID Description Score Start End Superfamily
af_Q6PGY9_139_533_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6518 299 380 3.40.720.10
2zktA01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5716 50 401 3.40.720.10
af_P75785_205_504_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5567 50 459 3.40.720.10
af_Q19963_189_388_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5474 51 399 3.40.720.10
af_Q19963_189_388_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5407 51 399 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A257H587-F1-model_v4 Tat pathway signal protein 0.9665 117 487
AF-A0A257H587-F1-model_v4 Tat pathway signal protein 0.9639 117 487
AF-A0A1V6EPF6-F1-model_v4 Tat pathway signal protein 0.962 99 487
AF-A0A3C0KHH6-F1-model_v4 Tat pathway signal protein 0.9595 255 436
AF-A0A1V6EPF6-F1-model_v4 Tat pathway signal protein 0.9571 99 487

Map