F470146
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 622 | 259 | 1244 | 471 |
Family's Representative Sequence
| Representative Sequence | 3300050491|nmdc:mga00v17_554_c1|nmdc:mga00v17_554_c1_556_1983 |
| Length | 460 |
| Sequence | MLEKTYPLYVANRPETPNTDLDVLDKYSGEVATRVAMADAATIERAIQAAVDAAPTMAALPAYKRQAILEHCVRRFRERAEELALALCIEAGKPIKDARGEVTRLIDTFRIAAEEAVRIEGQTVDLEISERGSGYRGIWKRVPIGPCSFITPFNFPLNLVAHKVAPAIAAGCPFVLKPAAKTPVGALIIAEVLAETDLPKGAFSVFACNNEDAAPLIEDDRIKLLSFTGGLVGWDFKARAGRKKVTLELGGNAACIVDGDQAGKLDHVVDRLAFGAYYQSGQSCISVQRILVHDTFVCGDPKDEATFIGPVIDEAAAKKIEGWIGAARDAGASVLAGGGRDGNMLQPALLEHVPRDAELQRQEAFAPVALLERFSDFDKALATVNDSDFGLQAGVFTDSLAHAMQAWDRLEVGGVIVGDVPSFRMDNMPYGGVKDSGLGREGVKFAIEDMSEVRLLVLKT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 69 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 71 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 72 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 77 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 87 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 90 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 130 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 131 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 132 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 133 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 134 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 135 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 136 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 137 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 138 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 139 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 140 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 141 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 142 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 143 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 144 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 145 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 146 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 147 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 148 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 149 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 150 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 151 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 152 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 153 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 154 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 183 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 184 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 185 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 187 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 188 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 189 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 190 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 191 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 192 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 193 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 194 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 195 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 196 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 197 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 198 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 226 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 227 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 228 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 229 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 230 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 232 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 234 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 235 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 236 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 237 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 238 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 239 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 240 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 241 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 242 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 243 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 244 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 245 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 246 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 247 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 248 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 249 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 250 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 251 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 252 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 253 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 254 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 255 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 256 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 257 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 258 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 259 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.37 |
| Metatranscriptomes | 1.45 |
| Isolates | 4.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.27 |
| Nodule | 0 |
| Rhizoplane | 2.89 |
| Rhizosphere | 69.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga00v17_554_c1 | 3300050491 | Bacteria | 20868 |
| 2 | JGI24741J21665_1000296 | 3300001915 | Bacteria | 15024 |
| 3 | JGI24741J21665_1001236 | 3300001915 | Bacteria | 7521 |
| 4 | JGI24741J21665_1004269 | 3300001915 | Bacteria | 3203 |
| 5 | JGI24741J21665_1006936 | 3300001915 | Bacteria | 2232 |
| 6 | JGI24740J21852_10001743 | 3300001979 | Bacteria | 10000 |
| 7 | JGI24737J22298_10010146 | 3300001990 | Bacteria | 3120 |
| 8 | JGI24735J21928_10014002 | 3300002067 | Bacteria | 2515 |
| 9 | JGI25156J39149_1004679 | 3300002705 | Bacteria | 4110 |
| 10 | JGI25156J39149_1004804 | 3300002705 | Bacteria | 4036 |
| 11 | JGI25162J39368_1000018 | 3300002737 | Bacteria | 277875 |
| 12 | JGI25162J39368_1000988 | 3300002737 | Bacteria | 17990 |
| 13 | JGI25162J39368_1001244 | 3300002737 | Bacteria | 14623 |
| 14 | JGI25157J39369_1000274 | 3300002741 | Bacteria | 37731 |
| 15 | JGI25157J39369_1000749 | 3300002741 | Bacteria | 17079 |
| 16 | JGI25157J39369_1000780 | 3300002741 | Bacteria | 16346 |
| 17 | JGI25157J39369_1002943 | 3300002741 | Bacteria | 3768 |
| 18 | JGI25163J39215_1000566 | 3300002771 | Bacteria | 10519 |
| 19 | JGI25164J39214_1000007 | 3300002772 | Bacteria | 312507 |
| 20 | JGI25164J39214_1000372 | 3300002772 | Bacteria | 26710 |
| 21 | JGI25164J39214_1000612 | 3300002772 | Bacteria | 15250 |
| 22 | JGI25164J39214_1000635 | 3300002772 | Bacteria | 14623 |
| 23 | JGI25165J46597_1000029 | 3300003214 | Bacteria | 312507 |
| 24 | JGI25165J46597_1001233 | 3300003214 | Bacteria | 15193 |
| 25 | JGI25165J46597_1001700 | 3300003214 | Bacteria | 9902 |
| 26 | JGI25165J46597_1002214 | 3300003214 | Bacteria | 6819 |
| 27 | JGI25153J46596_10026221 | 3300003215 | Bacteria | 2067 |
| 28 | rootH2_10016448 | 3300003320 | Bacteria | 31308 |
| 29 | Ga0006562J51391_1059408 | 3300003578 | Bacteria | 2500 |
| 30 | Ga0006562J51391_1086826 | 3300003578 | Bacteria | 4430 |
| 31 | Ga0055539_1001371 | 3300003752 | Bacteria | 4636 |
| 32 | Ga0055525_1000211 | 3300003759 | Bacteria | 65308 |
| 33 | Ga0055527_1000257 | 3300003760 | Bacteria | 32518 |
| 34 | Ga0055527_1000263 | 3300003760 | Bacteria | 31815 |
| 35 | Ga0055527_1002299 | 3300003760 | Bacteria | 3309 |
| 36 | Ga0055535_1000103 | 3300003761 | Bacteria | 91199 |
| 37 | Ga0055535_1000541 | 3300003761 | Bacteria | 32518 |
| 38 | Ga0055535_1000679 | 3300003761 | Bacteria | 26491 |
| 39 | Ga0055535_1003025 | 3300003761 | Bacteria | 5128 |
| 40 | Ga0055542_1000024 | 3300003762 | Bacteria | 277875 |
| 41 | Ga0055542_1000222 | 3300003762 | Bacteria | 68762 |
| 42 | Ga0055542_1000476 | 3300003762 | Bacteria | 37344 |
| 43 | Ga0055542_1000567 | 3300003762 | Bacteria | 32518 |
| 44 | Ga0055542_1000578 | 3300003762 | Bacteria | 31815 |
| 45 | Ga0055542_1000584 | 3300003762 | Bacteria | 31631 |
| 46 | Ga0055529_1000029 | 3300003763 | Bacteria | 277978 |
| 47 | Ga0055529_1000110 | 3300003763 | Bacteria | 120255 |
| 48 | Ga0055529_1000426 | 3300003763 | Bacteria | 43142 |
| 49 | Ga0055529_1000538 | 3300003763 | Bacteria | 32518 |
| 50 | Ga0065165_1000157 | 3300005262 | Bacteria | 118005 |
| 51 | Ga0065165_1008011 | 3300005262 | Bacteria | 5051 |
| 52 | Ga0070658_10001514 | 3300005327 | Bacteria | 19725 |
| 53 | Ga0070666_10000003 | 3300005335 | Bacteria | 463666 |
| 54 | Ga0070680_100000370 | 3300005336 | Bacteria | 30250 |
| 55 | Ga0070680_100000773 | 3300005336 | Bacteria | 22446 |
| 56 | Ga0070680_100040055 | 3300005336 | Bacteria | 3792 |
| 57 | Ga0070682_100003689 | 3300005337 | Bacteria | 8507 |
| 58 | Ga0070682_100052049 | 3300005337 | Bacteria | 2562 |
| 59 | Ga0070660_100018173 | 3300005339 | Bacteria | 5133 |
| 60 | Ga0070660_100026133 | 3300005339 | Bacteria | 4346 |
| 61 | Ga0070660_100034190 | 3300005339 | Bacteria | 3838 |
| 62 | Ga0070660_100072406 | 3300005339 | Bacteria | 2693 |
| 63 | Ga0070689_100001746 | 3300005340 | Bacteria | 13911 |
| 64 | Ga0070691_10004165 | 3300005341 | Bacteria | 6569 |
| 65 | Ga0070661_100003938 | 3300005344 | Bacteria | 10218 |
| 66 | Ga0070661_100072385 | 3300005344 | Bacteria | 2536 |
| 67 | Ga0070661_100130420 | 3300005344 | Bacteria | 1887 |
| 68 | Ga0070659_100069623 | 3300005366 | Bacteria | 2793 |
| 69 | Ga0070659_100130940 | 3300005366 | Bacteria | 2037 |
| 70 | Ga0070667_100000125 | 3300005367 | Bacteria | 97665 |
| 71 | Ga0070667_100035235 | 3300005367 | Bacteria | 4192 |
| 72 | Ga0070714_100099976 | 3300005435 | Bacteria | 2554 |
| 73 | Ga0070663_100000058 | 3300005455 | Bacteria | 48647 |
| 74 | Ga0070663_100001587 | 3300005455 | Bacteria | 12518 |
| 75 | Ga0070663_100031254 | 3300005455 | Bacteria | 3658 |
| 76 | Ga0070663_100074034 | 3300005455 | Bacteria | 2486 |
| 77 | Ga0070663_100097110 | 3300005455 | Bacteria | 2193 |
| 78 | Ga0070663_100130511 | 3300005455 | Bacteria | 1908 |
| 79 | Ga0070662_100021005 | 3300005457 | Bacteria | 4454 |
| 80 | Ga0070681_10000047 | 3300005458 | Bacteria | 83504 |
| 81 | Ga0070681_10006318 | 3300005458 | Bacteria | 11522 |
| 82 | Ga0070681_10007696 | 3300005458 | Bacteria | 10534 |
| 83 | Ga0070681_10011591 | 3300005458 | Bacteria | 8727 |
| 84 | Ga0070681_10024625 | 3300005458 | Bacteria | 6055 |
| 85 | Ga0070685_10016080 | 3300005466 | Bacteria | 3981 |
| 86 | Ga0070679_100000903 | 3300005530 | Bacteria | 25743 |
| 87 | Ga0070679_100002174 | 3300005530 | Bacteria | 17690 |
| 88 | Ga0070679_100064911 | 3300005530 | Bacteria | 3639 |
| 89 | Ga0068853_100001149 | 3300005539 | Bacteria | 18771 |
| 90 | Ga0068853_100017321 | 3300005539 | Bacteria | 5948 |
| 91 | Ga0068853_100029539 | 3300005539 | Bacteria | 4622 |
| 92 | Ga0068853_100041196 | 3300005539 | Bacteria | 3943 |
| 93 | Ga0068853_100052919 | 3300005539 | Bacteria | 3496 |
| 94 | Ga0070696_100005439 | 3300005546 | Bacteria | 8493 |
| 95 | Ga0070696_100007708 | 3300005546 | Bacteria | 7190 |
| 96 | Ga0070696_100062880 | 3300005546 | Bacteria | 2599 |
| 97 | Ga0070693_100002616 | 3300005547 | Bacteria | 8289 |
| 98 | Ga0070693_100011824 | 3300005547 | Bacteria | 4403 |
| 99 | Ga0070693_100019975 | 3300005547 | Bacteria | 3524 |
| 100 | Ga0070665_100009457 | 3300005548 | Bacteria | 9865 |
| 101 | Ga0070665_100011171 | 3300005548 | Bacteria | 9079 |
| 102 | Ga0070665_100062035 | 3300005548 | Bacteria | 3748 |
| 103 | Ga0068855_100004282 | 3300005563 | Bacteria | 17432 |
| 104 | Ga0068855_100017031 | 3300005563 | Bacteria | 8742 |
| 105 | Ga0068855_100040293 | 3300005563 | Bacteria | 5544 |
| 106 | Ga0068855_100144867 | 3300005563 | Bacteria | 2705 |
| 107 | Ga0068855_100168268 | 3300005563 | Bacteria | 2483 |
| 108 | Ga0068855_100254637 | 3300005563 | Bacteria | 1957 |
| 109 | Ga0070664_100018499 | 3300005564 | Bacteria | 5725 |
| 110 | Ga0070664_100024847 | 3300005564 | Bacteria | 4962 |
| 111 | Ga0070664_100090503 | 3300005564 | Bacteria | 2648 |
| 112 | Ga0068857_100009902 | 3300005577 | Bacteria | 8274 |
| 113 | Ga0068857_100155808 | 3300005577 | Bacteria | 2071 |
| 114 | Ga0068854_100001291 | 3300005578 | Bacteria | 15082 |
| 115 | Ga0068854_100002151 | 3300005578 | Bacteria | 12098 |
| 116 | Ga0068854_100004749 | 3300005578 | Bacteria | 8568 |
| 117 | Ga0068854_100010198 | 3300005578 | Bacteria | 6090 |
| 118 | Ga0068854_100040288 | 3300005578 | Bacteria | 3296 |
| 119 | Ga0068856_100010189 | 3300005614 | Bacteria | 9139 |
| 120 | Ga0068856_100054927 | 3300005614 | Bacteria | 3930 |
| 121 | Ga0068852_100005537 | 3300005616 | Bacteria | 9054 |
| 122 | Ga0068852_100064233 | 3300005616 | Bacteria | 3199 |
| 123 | Ga0068851_10018070 | 3300005834 | Bacteria | 3395 |
| 124 | Ga0068858_100125991 | 3300005842 | Bacteria | 2399 |
| 125 | Ga0081540_1002730 | 3300005983 | Bacteria | 14362 |
| 126 | Ga0075364_10001321 | 3300006051 | Bacteria | 13342 |
| 127 | Ga0075369_10013197 | 3300006186 | Bacteria | 3273 |
| 128 | Ga0097621_100070341 | 3300006237 | Bacteria | 2890 |
| 129 | Ga0105240_10000127 | 3300009093 | Bacteria | 156461 |
| 130 | Ga0105240_10005795 | 3300009093 | Bacteria | 18320 |
| 131 | Ga0105240_10045390 | 3300009093 | Bacteria | 5575 |
| 132 | Ga0105240_10118550 | 3300009093 | Bacteria | 3189 |
| 133 | Ga0105240_10152464 | 3300009093 | Bacteria | 2751 |
| 134 | Ga0105247_10018803 | 3300009101 | Bacteria | 4148 |
| 135 | Ga0105248_10004329 | 3300009177 | Bacteria | 15699 |
| 136 | Ga0105237_10000023 | 3300009545 | Bacteria | 226144 |
| 137 | Ga0105237_10000250 | 3300009545 | Bacteria | 76317 |
| 138 | Ga0105237_10037279 | 3300009545 | Bacteria | 4916 |
| 139 | Ga0105238_10000702 | 3300009551 | Bacteria | 35000 |
| 140 | Ga0105238_10007169 | 3300009551 | Bacteria | 11150 |
| 141 | Ga0105249_10000648 | 3300009553 | Bacteria | 31755 |
| 142 | Ga0105239_10000933 | 3300010375 | Bacteria | 41307 |
| 143 | Ga0105239_10025206 | 3300010375 | Bacteria | 6548 |
| 144 | Ga0105239_10030681 | 3300010375 | Bacteria | 5913 |
| 145 | Ga0105239_10259470 | 3300010375 | Bacteria | 1953 |
| 146 | Ga0157373_10014773 | 3300013100 | Bacteria | 5719 |
| 147 | Ga0157373_10084755 | 3300013100 | Bacteria | 2233 |
| 148 | Ga0157371_10013621 | 3300013102 | Bacteria | 6172 |
| 149 | Ga0157371_10032905 | 3300013102 | Bacteria | 3729 |
| 150 | Ga0157371_10046238 | 3300013102 | Bacteria | 3096 |
| 151 | Ga0157370_10004562 | 3300013104 | Bacteria | 15855 |
| 152 | Ga0157369_10000080 | 3300013105 | Bacteria | 133011 |
| 153 | Ga0157369_10001525 | 3300013105 | Bacteria | 28397 |
| 154 | Ga0157369_10026321 | 3300013105 | Bacteria | 6454 |
| 155 | Ga0157374_10152766 | 3300013296 | Bacteria | 2245 |
| 156 | Ga0163162_10007139 | 3300013306 | Bacteria | 10842 |
| 157 | Ga0157372_10001386 | 3300013307 | Bacteria | 26144 |
| 158 | Ga0157372_10004029 | 3300013307 | Bacteria | 15755 |
| 159 | Ga0157372_10018077 | 3300013307 | Bacteria | 7578 |
| 160 | Ga0157372_10035474 | 3300013307 | Bacteria | 5491 |
| 161 | Ga0157372_10051509 | 3300013307 | Bacteria | 4582 |
| 162 | Ga0157372_10208500 | 3300013307 | Bacteria | 2264 |
| 163 | Ga0182008_10016313 | 3300014497 | Bacteria | 3860 |
| 164 | Ga0182006_1000140 | 3300015261 | Bacteria | 77650 |
| 165 | Ga0182006_1000222 | 3300015261 | Bacteria | 55421 |
| 166 | Ga0183369_1012 | 3300015685 | Bacteria | 251554 |
| 167 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 168 | Ga0206356_10107366 | 3300020070 | Bacteria | 2314 |
| 169 | Ga0206356_11377764 | 3300020070 | Bacteria | 12585 |
| 170 | Ga0206352_10454266 | 3300020078 | Bacteria | 2670 |
| 171 | Ga0206354_10822484 | 3300020081 | Bacteria | 9584 |
| 172 | Ga0206353_10744446 | 3300020082 | Bacteria | 2516 |
| 173 | Ga0154015_1110366 | 3300020610 | Bacteria | 1725 |
| 174 | Ga0224712_10017407 | 3300022467 | Bacteria | 2383 |
| 175 | Ga0209760_100349 | 3300025207 | Bacteria | 13209 |
| 176 | Ga0209784_100026 | 3300025224 | Bacteria | 371540 |
| 177 | Ga0209674_100016 | 3300025226 | Bacteria | 696756 |
| 178 | Ga0209674_100108 | 3300025226 | Bacteria | 150893 |
| 179 | Ga0209674_100473 | 3300025226 | Bacteria | 17588 |
| 180 | Ga0209674_101452 | 3300025226 | Bacteria | 6259 |
| 181 | Ga0209674_101601 | 3300025226 | Bacteria | 5689 |
| 182 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 183 | Ga0209672_100009 | 3300025228 | Bacteria | 883623 |
| 184 | Ga0209672_100106 | 3300025228 | Bacteria | 100509 |
| 185 | Ga0209672_100268 | 3300025228 | Bacteria | 38409 |
| 186 | Ga0209672_100863 | 3300025228 | Bacteria | 13890 |
| 187 | Ga0209563_100079 | 3300025230 | Bacteria | 203017 |
| 188 | Ga0207427_100023 | 3300025231 | Bacteria | 439725 |
| 189 | Ga0207427_100105 | 3300025231 | Bacteria | 118241 |
| 190 | Ga0207427_100107 | 3300025231 | Bacteria | 116422 |
| 191 | Ga0207427_100261 | 3300025231 | Bacteria | 41118 |
| 192 | Ga0207427_104067 | 3300025231 | Bacteria | 2645 |
| 193 | Ga0209437_100039 | 3300025233 | Bacteria | 448321 |
| 194 | Ga0209437_100069 | 3300025233 | Bacteria | 307733 |
| 195 | Ga0209437_100129 | 3300025233 | Bacteria | 184661 |
| 196 | Ga0209437_100252 | 3300025233 | Bacteria | 84185 |
| 197 | Ga0209437_100563 | 3300025233 | Bacteria | 24403 |
| 198 | Ga0209258_100011 | 3300025242 | Bacteria | 867542 |
| 199 | Ga0209258_100046 | 3300025242 | Bacteria | 369794 |
| 200 | Ga0209258_100059 | 3300025242 | Bacteria | 324934 |
| 201 | Ga0209258_100155 | 3300025242 | Bacteria | 157847 |
| 202 | Ga0209258_100511 | 3300025242 | Bacteria | 37397 |
| 203 | Ga0209258_101052 | 3300025242 | Bacteria | 12139 |
| 204 | Ga0209646_1000392 | 3300025246 | Bacteria | 27054 |
| 205 | Ga0209026_1000036 | 3300025250 | Bacteria | 296607 |
| 206 | Ga0209026_1000051 | 3300025250 | Bacteria | 250792 |
| 207 | Ga0209026_1000194 | 3300025250 | Bacteria | 85950 |
| 208 | Ga0209026_1000234 | 3300025250 | Bacteria | 74634 |
| 209 | Ga0209026_1000635 | 3300025250 | Bacteria | 21860 |
| 210 | Ga0209026_1003202 | 3300025250 | Bacteria | 5536 |
| 211 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 212 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 213 | Ga0209148_1000013 | 3300025254 | Bacteria | 956684 |
| 214 | Ga0209148_1000084 | 3300025254 | Bacteria | 268147 |
| 215 | Ga0209148_1000220 | 3300025254 | Bacteria | 94901 |
| 216 | Ga0209148_1000533 | 3300025254 | Bacteria | 37397 |
| 217 | Ga0209148_1003283 | 3300025254 | Bacteria | 4577 |
| 218 | Ga0209759_1000300 | 3300025256 | Bacteria | 68198 |
| 219 | Ga0209759_1000442 | 3300025256 | Bacteria | 48456 |
| 220 | Ga0209759_1000901 | 3300025256 | Bacteria | 22183 |
| 221 | Ga0209759_1002380 | 3300025256 | Bacteria | 8348 |
| 222 | Ga0209759_1016040 | 3300025256 | Bacteria | 1909 |
| 223 | Ga0209129_1004409 | 3300025258 | Bacteria | 5502 |
| 224 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 225 | Ga0209233_1000224 | 3300025261 | Bacteria | 103605 |
| 226 | Ga0209233_1000227 | 3300025261 | Bacteria | 102833 |
| 227 | Ga0209233_1000300 | 3300025261 | Bacteria | 59294 |
| 228 | Ga0209233_1000364 | 3300025261 | Bacteria | 41118 |
| 229 | Ga0209233_1012560 | 3300025261 | Bacteria | 2452 |
| 230 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 231 | Ga0209455_1000012 | 3300025272 | Bacteria | 867234 |
| 232 | Ga0209455_1000020 | 3300025272 | Bacteria | 702259 |
| 233 | Ga0209455_1000077 | 3300025272 | Bacteria | 279165 |
| 234 | Ga0209455_1000922 | 3300025272 | Bacteria | 15165 |
| 235 | Ga0209455_1006643 | 3300025272 | Bacteria | 3390 |
| 236 | Ga0209758_1002866 | 3300025297 | Bacteria | 16735 |
| 237 | Ga0209758_1014061 | 3300025297 | Bacteria | 4297 |
| 238 | Ga0207426_1003878 | 3300025302 | Bacteria | 7705 |
| 239 | Ga0207680_10000006 | 3300025903 | Bacteria | 635950 |
| 240 | Ga0207647_10000099 | 3300025904 | Bacteria | 66290 |
| 241 | Ga0207647_10000716 | 3300025904 | Bacteria | 25997 |
| 242 | Ga0207647_10005371 | 3300025904 | Bacteria | 9418 |
| 243 | Ga0207647_10031625 | 3300025904 | Bacteria | 3404 |
| 244 | Ga0207705_10001564 | 3300025909 | Bacteria | 18182 |
| 245 | Ga0207705_10001744 | 3300025909 | Bacteria | 17217 |
| 246 | Ga0207705_10002617 | 3300025909 | Bacteria | 13797 |
| 247 | Ga0207705_10003215 | 3300025909 | Bacteria | 12441 |
| 248 | Ga0207705_10003650 | 3300025909 | Bacteria | 11716 |
| 249 | Ga0207707_10000083 | 3300025912 | Bacteria | 95462 |
| 250 | Ga0207707_10000093 | 3300025912 | Bacteria | 89975 |
| 251 | Ga0207707_10000214 | 3300025912 | Bacteria | 61954 |
| 252 | Ga0207707_10000273 | 3300025912 | Bacteria | 55671 |
| 253 | Ga0207707_10000516 | 3300025912 | Bacteria | 39572 |
| 254 | Ga0207707_10004435 | 3300025912 | Bacteria | 12370 |
| 255 | Ga0207707_10004941 | 3300025912 | Bacteria | 11719 |
| 256 | Ga0207695_10000907 | 3300025913 | Bacteria | 53347 |
| 257 | Ga0207695_10001809 | 3300025913 | Bacteria | 33712 |
| 258 | Ga0207695_10004302 | 3300025913 | Bacteria | 19518 |
| 259 | Ga0207695_10004792 | 3300025913 | Bacteria | 18304 |
| 260 | Ga0207695_10006439 | 3300025913 | Bacteria | 15246 |
| 261 | Ga0207695_10007245 | 3300025913 | Bacteria | 14168 |
| 262 | Ga0207695_10014060 | 3300025913 | Bacteria | 9504 |
| 263 | Ga0207695_10070435 | 3300025913 | Bacteria | 3575 |
| 264 | Ga0207695_10116716 | 3300025913 | Bacteria | 2643 |
| 265 | Ga0207695_10192414 | 3300025913 | Bacteria | 1957 |
| 266 | Ga0207671_10000020 | 3300025914 | Bacteria | 309636 |
| 267 | Ga0207671_10000033 | 3300025914 | Bacteria | 245869 |
| 268 | Ga0207671_10000116 | 3300025914 | Bacteria | 122775 |
| 269 | Ga0207671_10009215 | 3300025914 | Bacteria | 8277 |
| 270 | Ga0207693_10041506 | 3300025915 | Bacteria | 3622 |
| 271 | Ga0207663_10101291 | 3300025916 | Bacteria | 1935 |
| 272 | Ga0207660_10000690 | 3300025917 | Bacteria | 22578 |
| 273 | Ga0207660_10000954 | 3300025917 | Bacteria | 19144 |
| 274 | Ga0207660_10001280 | 3300025917 | Bacteria | 16882 |
| 275 | Ga0207660_10001400 | 3300025917 | Bacteria | 16210 |
| 276 | Ga0207660_10003995 | 3300025917 | Bacteria | 9613 |
| 277 | Ga0207657_10001271 | 3300025919 | Bacteria | 26893 |
| 278 | Ga0207657_10004595 | 3300025919 | Bacteria | 14588 |
| 279 | Ga0207657_10073111 | 3300025919 | Bacteria | 2899 |
| 280 | Ga0207657_10078493 | 3300025919 | Bacteria | 2780 |
| 281 | Ga0207649_10000779 | 3300025920 | Bacteria | 20674 |
| 282 | Ga0207649_10002975 | 3300025920 | Bacteria | 9336 |
| 283 | Ga0207652_10000038 | 3300025921 | Bacteria | 133467 |
| 284 | Ga0207652_10000125 | 3300025921 | Bacteria | 82619 |
| 285 | Ga0207652_10000257 | 3300025921 | Bacteria | 55336 |
| 286 | Ga0207694_10001036 | 3300025924 | Bacteria | 24194 |
| 287 | Ga0207664_10094704 | 3300025929 | Bacteria | 2455 |
| 288 | Ga0207644_10009468 | 3300025931 | Bacteria | 6397 |
| 289 | Ga0207690_10000689 | 3300025932 | Bacteria | 21712 |
| 290 | Ga0207690_10000793 | 3300025932 | Bacteria | 20362 |
| 291 | Ga0207690_10019317 | 3300025932 | Bacteria | 4194 |
| 292 | Ga0207670_10001642 | 3300025936 | Bacteria | 11672 |
| 293 | Ga0207704_10102029 | 3300025938 | Bacteria | 1915 |
| 294 | Ga0207711_10004901 | 3300025941 | Bacteria | 11362 |
| 295 | Ga0207661_10005487 | 3300025944 | Bacteria | 8946 |
| 296 | Ga0207661_10007193 | 3300025944 | Bacteria | 7908 |
| 297 | Ga0207661_10104260 | 3300025944 | Bacteria | 2387 |
| 298 | Ga0207679_10012988 | 3300025945 | Bacteria | 5449 |
| 299 | Ga0207667_10000130 | 3300025949 | Bacteria | 115321 |
| 300 | Ga0207667_10000169 | 3300025949 | Bacteria | 95977 |
| 301 | Ga0207667_10002427 | 3300025949 | Bacteria | 23337 |
| 302 | Ga0207667_10006312 | 3300025949 | Bacteria | 14377 |
| 303 | Ga0207667_10008956 | 3300025949 | Bacteria | 11838 |
| 304 | Ga0207667_10019459 | 3300025949 | Bacteria | 7579 |
| 305 | Ga0207667_10025291 | 3300025949 | Bacteria | 6501 |
| 306 | Ga0207667_10027857 | 3300025949 | Bacteria | 6143 |
| 307 | Ga0207667_10070830 | 3300025949 | Bacteria | 3628 |
| 308 | Ga0207712_10000972 | 3300025961 | Bacteria | 20638 |
| 309 | Ga0207640_10000144 | 3300025981 | Bacteria | 51999 |
| 310 | Ga0207640_10000939 | 3300025981 | Bacteria | 16269 |
| 311 | Ga0207640_10002085 | 3300025981 | Bacteria | 10766 |
| 312 | Ga0207640_10004146 | 3300025981 | Bacteria | 7833 |
| 313 | Ga0207640_10025104 | 3300025981 | Bacteria | 3603 |
| 314 | Ga0207640_10070526 | 3300025981 | Bacteria | 2351 |
| 315 | Ga0207640_10084219 | 3300025981 | Bacteria | 2183 |
| 316 | Ga0207658_10000050 | 3300025986 | Bacteria | 129714 |
| 317 | Ga0207658_10032798 | 3300025986 | Bacteria | 3700 |
| 318 | Ga0207658_10033246 | 3300025986 | Bacteria | 3678 |
| 319 | Ga0207639_10000601 | 3300026041 | Bacteria | 24806 |
| 320 | Ga0207639_10000690 | 3300026041 | Bacteria | 23246 |
| 321 | Ga0207639_10002797 | 3300026041 | Bacteria | 11719 |
| 322 | Ga0207639_10006067 | 3300026041 | Bacteria | 8202 |
| 323 | Ga0207639_10011089 | 3300026041 | Bacteria | 6251 |
| 324 | Ga0207639_10030268 | 3300026041 | Bacteria | 3969 |
| 325 | Ga0207678_10000916 | 3300026067 | Bacteria | 26995 |
| 326 | Ga0207678_10001375 | 3300026067 | Bacteria | 22403 |
| 327 | Ga0207678_10004494 | 3300026067 | Bacteria | 12538 |
| 328 | Ga0207678_10004831 | 3300026067 | Bacteria | 12098 |
| 329 | Ga0207678_10006700 | 3300026067 | Bacteria | 10215 |
| 330 | Ga0207678_10006710 | 3300026067 | Bacteria | 10210 |
| 331 | Ga0207678_10017667 | 3300026067 | Bacteria | 6262 |
| 332 | Ga0207678_10018220 | 3300026067 | Bacteria | 6167 |
| 333 | Ga0207678_10030490 | 3300026067 | Bacteria | 4707 |
| 334 | Ga0207678_10153390 | 3300026067 | Bacteria | 1967 |
| 335 | Ga0207702_10000384 | 3300026078 | Bacteria | 50456 |
| 336 | Ga0207702_10005697 | 3300026078 | Bacteria | 10861 |
| 337 | Ga0207702_10006665 | 3300026078 | Bacteria | 9930 |
| 338 | Ga0207702_10009006 | 3300026078 | Bacteria | 8404 |
| 339 | Ga0207702_10022182 | 3300026078 | Bacteria | 5262 |
| 340 | Ga0207702_10195859 | 3300026078 | Bacteria | 1870 |
| 341 | Ga0207641_10063680 | 3300026088 | Bacteria | 3150 |
| 342 | Ga0207674_10001362 | 3300026116 | Bacteria | 31632 |
| 343 | Ga0207674_10001719 | 3300026116 | Bacteria | 28008 |
| 344 | Ga0207674_10002346 | 3300026116 | Bacteria | 23934 |
| 345 | Ga0207674_10067093 | 3300026116 | Bacteria | 3612 |
| 346 | Ga0207674_10183884 | 3300026116 | Bacteria | 2040 |
| 347 | Ga0207698_10001087 | 3300026142 | Bacteria | 15802 |
| 348 | Ga0207698_10005570 | 3300026142 | Bacteria | 7787 |
| 349 | Ga0207698_10283241 | 3300026142 | Bacteria | 1534 |
| 350 | Ga0268266_10000021 | 3300028379 | Bacteria | 522453 |
| 351 | Ga0268266_10016237 | 3300028379 | Bacteria | 6365 |
| 352 | Ga0268265_10034462 | 3300028380 | Bacteria | 3691 |
| 353 | Ga0268264_10164805 | 3300028381 | Bacteria | 2000 |
| 354 | Ga0307412_10000773 | 3300031911 | Bacteria | 18455 |
| 355 | Ga0307510_10000577 | 3300033180 | Bacteria | 36999 |
| 356 | Ga0395899_0000460 | 3300037312 | Bacteria | 46114 |
| 357 | Ga0395899_0006509 | 3300037312 | Bacteria | 9050 |
| 358 | Ga0395899_0038376 | 3300037312 | Bacteria | 3587 |
| 359 | Ga0395900_0000051 | 3300037418 | Bacteria | 224228 |
| 360 | Ga0395900_0005345 | 3300037418 | Bacteria | 13457 |
| 361 | Ga0395900_0012146 | 3300037418 | Bacteria | 8800 |
| 362 | Ga0395900_0035069 | 3300037418 | Bacteria | 5167 |
| 363 | Ga0395898_0000034 | 3300037466 | Bacteria | 356745 |
| 364 | Ga0395898_0000363 | 3300037466 | Bacteria | 99698 |
| 365 | Ga0395901_0001129 | 3300038443 | Bacteria | 28299 |
| 366 | Ga0439436_0000011 | 3300041404 | Bacteria | 100668 |
| 367 | Ga0439465_0000292 | 3300041413 | Bacteria | 14130 |
| 368 | Ga0451793_0322512 | 3300041452 | Bacteria | 3437 |
| 369 | Ga0451793_1765168 | 3300041452 | Bacteria | 3064 |
| 370 | Ga0451802_1844544 | 3300041460 | Bacteria | 2647 |
| 371 | Ga0451807_1050170 | 3300041486 | Bacteria | 1917 |
| 372 | Ga0451853_0156874 | 3300041512 | Bacteria | 2950 |
| 373 | Ga0439448_0018831 | 3300042005 | Bacteria | 2120 |
| 374 | Ga0450908_000023 | 3300042184 | Bacteria | 36671 |
| 375 | Ga0466972_0027965 | 3300044658 | Bacteria | 2786 |
| 376 | Ga0466972_0028135 | 3300044658 | Bacteria | 2775 |
| 377 | Ga0466982_0000020 | 3300044672 | Bacteria | 99164 |
| 378 | Ga0466982_0000036 | 3300044672 | Bacteria | 43109 |
| 379 | Ga0466966_0045502 | 3300044684 | Bacteria | 2805 |
| 380 | Ga0466961_0003216 | 3300044693 | Bacteria | 10165 |
| 381 | Ga0466964_0007589 | 3300044706 | Bacteria | 4058 |
| 382 | Ga0466971_0006011 | 3300044719 | Bacteria | 5283 |
| 383 | Ga0466968_0001311 | 3300044735 | Bacteria | 8891 |
| 384 | Ga0466968_0005485 | 3300044735 | Bacteria | 4746 |
| 385 | Ga0466970_0001722 | 3300044765 | Bacteria | 10533 |
| 386 | Ga0466970_0015845 | 3300044765 | Bacteria | 3880 |
| 387 | Ga0466957_0001506 | 3300044842 | Bacteria | 12229 |
| 388 | Ga0466959_0001256 | 3300045049 | Bacteria | 15326 |
| 389 | Ga0466959_0014169 | 3300045049 | Bacteria | 5787 |
| 390 | Ga0466967_0130553 | 3300045976 | Bacteria | 2332 |
| 391 | Ga0495617_000921 | 3300046452 | Bacteria | 13691 |
| 392 | Ga0495590_0017038 | 3300046457 | Bacteria | 2620 |
| 393 | Ga0495638_0000069 | 3300046460 | Bacteria | 167503 |
| 394 | Ga0495638_0000078 | 3300046460 | Bacteria | 157545 |
| 395 | Ga0495638_0000166 | 3300046460 | Bacteria | 102926 |
| 396 | Ga0495638_0000516 | 3300046460 | Bacteria | 45213 |
| 397 | Ga0495638_0018029 | 3300046460 | Bacteria | 4697 |
| 398 | Ga0495650_0000220 | 3300046471 | Bacteria | 119197 |
| 399 | Ga0495650_0000452 | 3300046471 | Bacteria | 65082 |
| 400 | Ga0495650_0000686 | 3300046471 | Bacteria | 43752 |
| 401 | Ga0495584_0006849 | 3300046491 | Bacteria | 5956 |
| 402 | Ga0495585_0000080 | 3300046492 | Bacteria | 99617 |
| 403 | Ga0495585_0001139 | 3300046492 | Bacteria | 21767 |
| 404 | Ga0495607_0000144 | 3300046501 | Bacteria | 74813 |
| 405 | Ga0495607_0000954 | 3300046501 | Bacteria | 26747 |
| 406 | Ga0495607_0003306 | 3300046501 | Bacteria | 12380 |
| 407 | Ga0495583_0008258 | 3300046506 | Bacteria | 6384 |
| 408 | Ga0495606_0000050 | 3300046507 | Bacteria | 203375 |
| 409 | Ga0495606_0000227 | 3300046507 | Bacteria | 99782 |
| 410 | Ga0495606_0011999 | 3300046507 | Bacteria | 6997 |
| 411 | Ga0495610_0001128 | 3300046512 | Bacteria | 24366 |
| 412 | Ga0495616_0000036 | 3300046513 | Bacteria | 128264 |
| 413 | Ga0495616_0010735 | 3300046513 | Bacteria | 5283 |
| 414 | Ga0495631_0000017 | 3300046518 | Bacteria | 98047 |
| 415 | Ga0495631_0001740 | 3300046518 | Bacteria | 12930 |
| 416 | Ga0495632_0000004 | 3300046519 | Bacteria | 381372 |
| 417 | Ga0495632_0000786 | 3300046519 | Bacteria | 28264 |
| 418 | Ga0495632_0027855 | 3300046519 | Bacteria | 2954 |
| 419 | Ga0495648_0005309 | 3300046524 | Bacteria | 10747 |
| 420 | Ga0495648_0024157 | 3300046524 | Bacteria | 4148 |
| 421 | Ga0495609_0014457 | 3300046538 | Bacteria | 3708 |
| 422 | Ga0495668_0009877 | 3300046616 | Bacteria | 5821 |
| 423 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 424 | Ga0495611_0000022 | 3300046648 | Bacteria | 122452 |
| 425 | Ga0495625_0016987 | 3300046660 | Bacteria | 5706 |
| 426 | Ga0495661_0000657 | 3300046665 | Bacteria | 34630 |
| 427 | Ga0495670_0013676 | 3300046691 | Bacteria | 3991 |
| 428 | Ga0495649_0004268 | 3300046694 | Bacteria | 9375 |
| 429 | Ga0495589_0000053 | 3300046794 | Bacteria | 111458 |
| 430 | Ga0495660_0000233 | 3300046810 | Bacteria | 54493 |
| 431 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 432 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 433 | Ga0495673_0000048 | 3300047469 | Bacteria | 265950 |
| 434 | Ga0495673_0000644 | 3300047469 | Bacteria | 34268 |
| 435 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 436 | Ga0495686_0000295 | 3300047472 | Bacteria | 86824 |
| 437 | Ga0495686_0003885 | 3300047472 | Bacteria | 12612 |
| 438 | Ga0495686_0026907 | 3300047472 | Bacteria | 3760 |
| 439 | Ga0495686_0040185 | 3300047472 | Bacteria | 2984 |
| 440 | Ga0496100_0004368 | 3300048903 | Bacteria | 7487 |
| 441 | Ga0496101_0005402 | 3300048904 | Bacteria | 8141 |
| 442 | Ga0496101_0103684 | 3300048904 | Bacteria | 2132 |
| 443 | Ga0496104_0276585 | 3300048907 | Bacteria | 1592 |
| 444 | Ga0496105_0006103 | 3300048908 | Bacteria | 9222 |
| 445 | Ga0496106_0010355 | 3300048909 | Bacteria | 6891 |
| 446 | Ga0496106_0172547 | 3300048909 | Bacteria | 1714 |
| 447 | Ga0496108_0050537 | 3300048911 | Bacteria | 3480 |
| 448 | Ga0496113_0006783 | 3300048916 | Bacteria | 7297 |
| 449 | Ga0496115_0000039 | 3300048918 | Bacteria | 124044 |
| 450 | Ga0496115_0000180 | 3300048918 | Bacteria | 59336 |
| 451 | Ga0496115_0008559 | 3300048918 | Bacteria | 7575 |
| 452 | Ga0496115_0022001 | 3300048918 | Bacteria | 4932 |
| 453 | Ga0496115_0034830 | 3300048918 | Bacteria | 3979 |
| 454 | Ga0496117_0005946 | 3300048920 | Bacteria | 12582 |
| 455 | Ga0496117_0021175 | 3300048920 | Bacteria | 5272 |
| 456 | Ga0496117_0024598 | 3300048920 | Bacteria | 4758 |
| 457 | Ga0496118_0000413 | 3300048921 | Bacteria | 71305 |
| 458 | Ga0496118_0000645 | 3300048921 | Bacteria | 57218 |
| 459 | Ga0496118_0000805 | 3300048921 | Bacteria | 50087 |
| 460 | Ga0496118_0008916 | 3300048921 | Bacteria | 10240 |
| 461 | Ga0496118_0011703 | 3300048921 | Bacteria | 8528 |
| 462 | Ga0496118_0012593 | 3300048921 | Bacteria | 8096 |
| 463 | Ga0496119_0000868 | 3300048922 | Bacteria | 39828 |
| 464 | Ga0496119_0008515 | 3300048922 | Bacteria | 8995 |
| 465 | Ga0496119_0026697 | 3300048922 | Bacteria | 3994 |
| 466 | Ga0496120_0001056 | 3300048923 | Bacteria | 36468 |
| 467 | Ga0496120_0001816 | 3300048923 | Bacteria | 23877 |
| 468 | Ga0496121_0000372 | 3300048924 | Bacteria | 92348 |
| 469 | Ga0496121_0001970 | 3300048924 | Bacteria | 32682 |
| 470 | Ga0496121_0004478 | 3300048924 | Bacteria | 18747 |
| 471 | Ga0496121_0013350 | 3300048924 | Bacteria | 8837 |
| 472 | Ga0496121_0022568 | 3300048924 | Bacteria | 6099 |
| 473 | Ga0496121_0024061 | 3300048924 | Bacteria | 5836 |
| 474 | Ga0496122_0003660 | 3300048925 | Bacteria | 19965 |
| 475 | Ga0496122_0027095 | 3300048925 | Bacteria | 4912 |
| 476 | Ga0496122_0075011 | 3300048925 | Bacteria | 2389 |
| 477 | Ga0496123_0002907 | 3300048926 | Bacteria | 20040 |
| 478 | Ga0496123_0016637 | 3300048926 | Bacteria | 5957 |
| 479 | Ga0496123_0026568 | 3300048926 | Bacteria | 4332 |
| 480 | Ga0496124_0000289 | 3300048927 | Bacteria | 95056 |
| 481 | Ga0496125_0000344 | 3300048928 | Bacteria | 88380 |
| 482 | Ga0496125_0010084 | 3300048928 | Bacteria | 9586 |
| 483 | Ga0496125_0022927 | 3300048928 | Bacteria | 5784 |
| 484 | Ga0496126_0009400 | 3300048929 | Bacteria | 10387 |
| 485 | Ga0496126_0017325 | 3300048929 | Bacteria | 7180 |
| 486 | Ga0496126_0023281 | 3300048929 | Bacteria | 6002 |
| 487 | Ga0496126_0026524 | 3300048929 | Bacteria | 5554 |
| 488 | Ga0496126_0036929 | 3300048929 | Bacteria | 4564 |
| 489 | Ga0495678_000276 | 3300049459 | Bacteria | 56670 |
| 490 | Ga0495682_0001190 | 3300049460 | Bacteria | 14806 |
| 491 | Ga0501031_0000386 | 3300049568 | Bacteria | 25889 |
| 492 | Ga0501031_0014850 | 3300049568 | Bacteria | 5061 |
| 493 | Ga0501032_0008566 | 3300049569 | Bacteria | 7457 |
| 494 | Ga0501033_0000238 | 3300049570 | Bacteria | 52874 |
| 495 | Ga0501033_0001455 | 3300049570 | Bacteria | 20987 |
| 496 | Ga0501033_0012400 | 3300049570 | Bacteria | 6505 |
| 497 | Ga0501033_0023636 | 3300049570 | Bacteria | 4635 |
| 498 | Ga0501033_0141135 | 3300049570 | Bacteria | 1741 |
| 499 | Ga0501034_0010160 | 3300049571 | Bacteria | 9821 |
| 500 | Ga0501034_0091388 | 3300049571 | Bacteria | 3041 |
| 501 | Ga0501036_0034507 | 3300049572 | Bacteria | 4279 |
| 502 | Ga0501037_0001617 | 3300049573 | Bacteria | 16362 |
| 503 | Ga0501037_0004498 | 3300049573 | Bacteria | 10135 |
| 504 | Ga0501037_0013086 | 3300049573 | Bacteria | 6117 |
| 505 | Ga0501037_0044700 | 3300049573 | Bacteria | 3252 |
| 506 | Ga0501037_0108977 | 3300049573 | Bacteria | 1996 |
| 507 | Ga0501037_0151966 | 3300049573 | Bacteria | 1654 |
| 508 | Ga0501038_0000102 | 3300049574 | Bacteria | 72409 |
| 509 | Ga0501038_0021857 | 3300049574 | Bacteria | 5737 |
| 510 | Ga0501038_0076890 | 3300049574 | Bacteria | 2819 |
| 511 | Ga0501038_0110282 | 3300049574 | Bacteria | 2280 |
| 512 | Ga0501038_0146823 | 3300049574 | Bacteria | 1925 |
| 513 | Ga0501038_0190116 | 3300049574 | Bacteria | 1652 |
| 514 | Ga0501039_0013117 | 3300049575 | Bacteria | 6336 |
| 515 | Ga0501039_0039581 | 3300049575 | Bacteria | 3640 |
| 516 | Ga0501039_0199689 | 3300049575 | Bacteria | 1572 |
| 517 | Ga0501042_0025452 | 3300049578 | Bacteria | 4157 |
| 518 | Ga0501043_0090751 | 3300049579 | Bacteria | 2402 |
| 519 | Ga0501043_0109102 | 3300049579 | Bacteria | 2173 |
| 520 | Ga0501043_0122673 | 3300049579 | Bacteria | 2038 |
| 521 | Ga0501046_0002342 | 3300049580 | Bacteria | 17858 |
| 522 | Ga0501046_0005065 | 3300049580 | Bacteria | 11814 |
| 523 | Ga0501046_0006985 | 3300049580 | Bacteria | 9944 |
| 524 | Ga0501047_0001387 | 3300049581 | Bacteria | 23760 |
| 525 | Ga0501047_0002444 | 3300049581 | Bacteria | 17736 |
| 526 | Ga0501047_0006853 | 3300049581 | Bacteria | 10706 |
| 527 | Ga0501047_0038457 | 3300049581 | Bacteria | 4629 |
| 528 | Ga0501047_0064041 | 3300049581 | Bacteria | 3547 |
| 529 | Ga0501047_0097471 | 3300049581 | Bacteria | 2818 |
| 530 | Ga0501047_0178231 | 3300049581 | Bacteria | 1992 |
| 531 | Ga0501047_0217607 | 3300049581 | Bacteria | 1767 |
| 532 | Ga0501047_0230405 | 3300049581 | Bacteria | 1706 |
| 533 | Ga0501048_0015772 | 3300049582 | Bacteria | 5576 |
| 534 | Ga0501048_0034651 | 3300049582 | Bacteria | 3640 |
| 535 | Ga0501048_0126060 | 3300049582 | Bacteria | 1810 |
| 536 | Ga0501069_0004418 | 3300049585 | Bacteria | 7261 |
| 537 | Ga0501069_0008197 | 3300049585 | Bacteria | 5487 |
| 538 | Ga0501069_0034028 | 3300049585 | Bacteria | 2807 |
| 539 | Ga0501069_0035806 | 3300049585 | Bacteria | 2735 |
| 540 | Ga0501070_0004912 | 3300049586 | Bacteria | 11416 |
| 541 | Ga0501070_0011269 | 3300049586 | Bacteria | 7552 |
| 542 | Ga0501070_0013787 | 3300049586 | Bacteria | 6807 |
| 543 | Ga0501070_0014708 | 3300049586 | Bacteria | 6583 |
| 544 | Ga0501070_0024306 | 3300049586 | Bacteria | 5081 |
| 545 | Ga0501070_0036419 | 3300049586 | Bacteria | 4108 |
| 546 | Ga0501070_0044037 | 3300049586 | Bacteria | 3714 |
| 547 | Ga0501070_0077685 | 3300049586 | Bacteria | 2747 |
| 548 | Ga0501071_0002502 | 3300049587 | Bacteria | 11180 |
| 549 | Ga0501071_0016751 | 3300049587 | Bacteria | 5041 |
| 550 | Ga0501072_0014581 | 3300049588 | Bacteria | 6023 |
| 551 | Ga0501073_0002707 | 3300049589 | Bacteria | 13269 |
| 552 | Ga0501073_0003684 | 3300049589 | Bacteria | 11502 |
| 553 | Ga0501073_0058417 | 3300049589 | Bacteria | 2695 |
| 554 | Ga0501073_0060276 | 3300049589 | Bacteria | 2648 |
| 555 | Ga0501074_0003853 | 3300049590 | Bacteria | 10679 |
| 556 | Ga0501074_0027420 | 3300049590 | Bacteria | 4130 |
| 557 | Ga0501074_0033587 | 3300049590 | Bacteria | 3718 |
| 558 | Ga0501074_0066901 | 3300049590 | Bacteria | 2584 |
| 559 | Ga0501077_0086504 | 3300049593 | Bacteria | 1987 |
| 560 | Ga0501079_0014047 | 3300049741 | Bacteria | 6105 |
| 561 | Ga0501080_0009969 | 3300049742 | Bacteria | 8683 |
| 562 | Ga0501080_0021387 | 3300049742 | Bacteria | 5988 |
| 563 | Ga0501080_0037362 | 3300049742 | Bacteria | 4535 |
| 564 | Ga0501080_0065677 | 3300049742 | Bacteria | 3375 |
| 565 | Ga0501080_0074806 | 3300049742 | Bacteria | 3151 |
| 566 | Ga0501083_0001689 | 3300049744 | Bacteria | 15046 |
| 567 | Ga0501035_0001523 | 3300049822 | Bacteria | 23664 |
| 568 | Ga0501035_0019597 | 3300049822 | Bacteria | 6215 |
| 569 | Ga0501035_0021435 | 3300049822 | Bacteria | 5940 |
| 570 | Ga0501035_0061562 | 3300049822 | Bacteria | 3340 |
| 571 | Ga0501035_0061783 | 3300049822 | Bacteria | 3333 |
| 572 | Ga0501035_0093654 | 3300049822 | Bacteria | 2643 |
| 573 | Ga0501044_0002052 | 3300049823 | Bacteria | 23242 |
| 574 | Ga0501044_0008967 | 3300049823 | Bacteria | 10937 |
| 575 | Ga0501044_0012187 | 3300049823 | Bacteria | 9308 |
| 576 | Ga0501044_0015321 | 3300049823 | Bacteria | 8257 |
| 577 | Ga0501044_0026174 | 3300049823 | Bacteria | 6177 |
| 578 | Ga0501044_0042412 | 3300049823 | Bacteria | 4732 |
| 579 | Ga0501044_0046404 | 3300049823 | Bacteria | 4498 |
| 580 | Ga0501044_0054069 | 3300049823 | Bacteria | 4129 |
| 581 | Ga0501044_0054456 | 3300049823 | Bacteria | 4111 |
| 582 | Ga0501044_0103064 | 3300049823 | Bacteria | 2868 |
| 583 | Ga0501044_0182554 | 3300049823 | Bacteria | 2064 |
| 584 | Ga0500610_0002210 | 3300053079 | Bacteria | 7039 |
| 585 | Ga0500643_000888 | 3300053087 | Bacteria | 18939 |
| 586 | Ga0500597_000045 | 3300053120 | Bacteria | 23880 |
| 587 | Ga0500568_0000665 | 3300053139 | Bacteria | 24861 |
| 588 | Ga0500645_000391 | 3300053730 | Bacteria | 30650 |
| 589 | Ga0501084_0043300 | 3300054114 | Bacteria | 3766 |
| 590 | Ga0501084_0049115 | 3300054114 | Bacteria | 3532 |
| 591 | Ga0500661_004961 | 3300055283 | Bacteria | 2494 |
| 592 | Ga0501082_0001868 | 3300060353 | Bacteria | 18525 |
| 593 | Ga0501082_0038278 | 3300060353 | Bacteria | 4137 |
| 594 | Ga0466962_0004865 | 3300061719 | Bacteria | 6465 |
| 595 | Ga0466962_0005997 | 3300061719 | Bacteria | 5840 |
| 596 | Ga0466962_0031299 | 3300061719 | Bacteria | 2547 |
| 597 | 2538832712 | 2537561836 | Bacteria | 3910579 |
| 598 | 2595446884 | 2593339238 | Bacteria | 4182970 |
| 599 | 2595449647 | 2593339239 | Bacteria | 4124669 |
| 600 | 2643830193 | 2643221562 | Bacteria | 4048635 |
| 601 | 2643894762 | 2643221577 | Bacteria | 3710843 |
| 602 | 2644476920 | 2643221685 | Bacteria | 3673288 |
| 603 | 2687582996 | 2687453130 | Bacteria | 4227172 |
| 604 | 2735833572 | 2734482264 | Unclassified | 5014763 |
| 605 | 2739229700 | 2738543009 | Bacteria | 4944499 |
| 606 | 2739730927 | 2739367700 | Bacteria | 4747630 |
| 607 | 2819564038 | 2818991440 | Bacteria | 4774720 |
| 608 | 2842917589 | 2842914999 | Bacteria | 4419378 |
| 609 | 2842919959 | 2842918807 | Bacteria | 4289178 |
| 610 | 2884341564 | 2884338543 | Bacteria | 4610696 |
| 611 | 2884412377 | 2884411467 | Bacteria | 5246714 |
| 612 | 2895398455 | 2895395659 | Bacteria | 3983269 |
| 613 | 2895504054 | 2895498888 | Bacteria | 5283788 |
| 614 | 2895515408 | 2895511927 | Bacteria | 6802080 |
| 615 | 2895525081 | 2895522137 | Bacteria | 3284416 |
| 616 | 2895527817 | 2895525241 | Bacteria | 3388457 |
| 617 | 2904464674 | 2904463128 | Bacteria | 4775606 |
| 618 | 2919406170 | 2919404418 | Bacteria | 4232372 |
| 619 | 2928964004 | 2928963466 | Bacteria | 5165703 |
| 620 | 2939614728 | 2939611941 | Bacteria | 3892017 |
| 621 | 2941473007 | 2941471342 | Bacteria | 5018624 |
| 622 | 2953995254 | 2953994433 | Bacteria | 4303959 |
| 623 | nmdc:mga00v17_554_c1 | |||
| 624 | JGI24741J21665_1000296 | |||
| 625 | JGI24741J21665_1001236 | |||
| 626 | JGI24741J21665_1004269 | |||
| 627 | JGI24741J21665_1006936 | |||
| 628 | JGI24740J21852_10001743 | |||
| 629 | JGI24737J22298_10010146 | |||
| 630 | JGI24735J21928_10014002 | |||
| 631 | JGI25156J39149_1004679 | |||
| 632 | JGI25156J39149_1004804 | |||
| 633 | JGI25162J39368_1000018 | |||
| 634 | JGI25162J39368_1000988 | |||
| 635 | JGI25162J39368_1001244 | |||
| 636 | JGI25157J39369_1000274 | |||
| 637 | JGI25157J39369_1000749 | |||
| 638 | JGI25157J39369_1000780 | |||
| 639 | JGI25157J39369_1002943 | |||
| 640 | JGI25163J39215_1000566 | |||
| 641 | JGI25164J39214_1000007 | |||
| 642 | JGI25164J39214_1000372 | |||
| 643 | JGI25164J39214_1000612 | |||
| 644 | JGI25164J39214_1000635 | |||
| 645 | JGI25165J46597_1000029 | |||
| 646 | JGI25165J46597_1001233 | |||
| 647 | JGI25165J46597_1001700 | |||
| 648 | JGI25165J46597_1002214 | |||
| 649 | JGI25153J46596_10026221 | |||
| 650 | rootH2_10016448 | |||
| 651 | Ga0006562J51391_1059408 | |||
| 652 | Ga0006562J51391_1086826 | |||
| 653 | Ga0055539_1001371 | |||
| 654 | Ga0055525_1000211 | |||
| 655 | Ga0055527_1000257 | |||
| 656 | Ga0055527_1000263 | |||
| 657 | Ga0055527_1002299 | |||
| 658 | Ga0055535_1000103 | |||
| 659 | Ga0055535_1000541 | |||
| 660 | Ga0055535_1000679 | |||
| 661 | Ga0055535_1003025 | |||
| 662 | Ga0055542_1000024 | |||
| 663 | Ga0055542_1000222 | |||
| 664 | Ga0055542_1000476 | |||
| 665 | Ga0055542_1000567 | |||
| 666 | Ga0055542_1000578 | |||
| 667 | Ga0055542_1000584 | |||
| 668 | Ga0055529_1000029 | |||
| 669 | Ga0055529_1000110 | |||
| 670 | Ga0055529_1000426 | |||
| 671 | Ga0055529_1000538 | |||
| 672 | Ga0065165_1000157 | |||
| 673 | Ga0065165_1008011 | |||
| 674 | Ga0070658_10001514 | |||
| 675 | Ga0070666_10000003 | |||
| 676 | Ga0070680_100000370 | |||
| 677 | Ga0070680_100000773 | |||
| 678 | Ga0070680_100040055 | |||
| 679 | Ga0070682_100003689 | |||
| 680 | Ga0070682_100052049 | |||
| 681 | Ga0070660_100018173 | |||
| 682 | Ga0070660_100026133 | |||
| 683 | Ga0070660_100034190 | |||
| 684 | Ga0070660_100072406 | |||
| 685 | Ga0070689_100001746 | |||
| 686 | Ga0070691_10004165 | |||
| 687 | Ga0070661_100003938 | |||
| 688 | Ga0070661_100072385 | |||
| 689 | Ga0070661_100130420 | |||
| 690 | Ga0070659_100069623 | |||
| 691 | Ga0070659_100130940 | |||
| 692 | Ga0070667_100000125 | |||
| 693 | Ga0070667_100035235 | |||
| 694 | Ga0070714_100099976 | |||
| 695 | Ga0070663_100000058 | |||
| 696 | Ga0070663_100001587 | |||
| 697 | Ga0070663_100031254 | |||
| 698 | Ga0070663_100074034 | |||
| 699 | Ga0070663_100097110 | |||
| 700 | Ga0070663_100130511 | |||
| 701 | Ga0070662_100021005 | |||
| 702 | Ga0070681_10000047 | |||
| 703 | Ga0070681_10006318 | |||
| 704 | Ga0070681_10007696 | |||
| 705 | Ga0070681_10011591 | |||
| 706 | Ga0070681_10024625 | |||
| 707 | Ga0070685_10016080 | |||
| 708 | Ga0070679_100000903 | |||
| 709 | Ga0070679_100002174 | |||
| 710 | Ga0070679_100064911 | |||
| 711 | Ga0068853_100001149 | |||
| 712 | Ga0068853_100017321 | |||
| 713 | Ga0068853_100029539 | |||
| 714 | Ga0068853_100041196 | |||
| 715 | Ga0068853_100052919 | |||
| 716 | Ga0070696_100005439 | |||
| 717 | Ga0070696_100007708 | |||
| 718 | Ga0070696_100062880 | |||
| 719 | Ga0070693_100002616 | |||
| 720 | Ga0070693_100011824 | |||
| 721 | Ga0070693_100019975 | |||
| 722 | Ga0070665_100009457 | |||
| 723 | Ga0070665_100011171 | |||
| 724 | Ga0070665_100062035 | |||
| 725 | Ga0068855_100004282 | |||
| 726 | Ga0068855_100017031 | |||
| 727 | Ga0068855_100040293 | |||
| 728 | Ga0068855_100144867 | |||
| 729 | Ga0068855_100168268 | |||
| 730 | Ga0068855_100254637 | |||
| 731 | Ga0070664_100018499 | |||
| 732 | Ga0070664_100024847 | |||
| 733 | Ga0070664_100090503 | |||
| 734 | Ga0068857_100009902 | |||
| 735 | Ga0068857_100155808 | |||
| 736 | Ga0068854_100001291 | |||
| 737 | Ga0068854_100002151 | |||
| 738 | Ga0068854_100004749 | |||
| 739 | Ga0068854_100010198 | |||
| 740 | Ga0068854_100040288 | |||
| 741 | Ga0068856_100010189 | |||
| 742 | Ga0068856_100054927 | |||
| 743 | Ga0068852_100005537 | |||
| 744 | Ga0068852_100064233 | |||
| 745 | Ga0068851_10018070 | |||
| 746 | Ga0068858_100125991 | |||
| 747 | Ga0081540_1002730 | |||
| 748 | Ga0075364_10001321 | |||
| 749 | Ga0075369_10013197 | |||
| 750 | Ga0097621_100070341 | |||
| 751 | Ga0105240_10000127 | |||
| 752 | Ga0105240_10005795 | |||
| 753 | Ga0105240_10045390 | |||
| 754 | Ga0105240_10118550 | |||
| 755 | Ga0105240_10152464 | |||
| 756 | Ga0105247_10018803 | |||
| 757 | Ga0105248_10004329 | |||
| 758 | Ga0105237_10000023 | |||
| 759 | Ga0105237_10000250 | |||
| 760 | Ga0105237_10037279 | |||
| 761 | Ga0105238_10000702 | |||
| 762 | Ga0105238_10007169 | |||
| 763 | Ga0105249_10000648 | |||
| 764 | Ga0105239_10000933 | |||
| 765 | Ga0105239_10025206 | |||
| 766 | Ga0105239_10030681 | |||
| 767 | Ga0105239_10259470 | |||
| 768 | Ga0157373_10014773 | |||
| 769 | Ga0157373_10084755 | |||
| 770 | Ga0157371_10013621 | |||
| 771 | Ga0157371_10032905 | |||
| 772 | Ga0157371_10046238 | |||
| 773 | Ga0157370_10004562 | |||
| 774 | Ga0157369_10000080 | |||
| 775 | Ga0157369_10001525 | |||
| 776 | Ga0157369_10026321 | |||
| 777 | Ga0157374_10152766 | |||
| 778 | Ga0163162_10007139 | |||
| 779 | Ga0157372_10001386 | |||
| 780 | Ga0157372_10004029 | |||
| 781 | Ga0157372_10018077 | |||
| 782 | Ga0157372_10035474 | |||
| 783 | Ga0157372_10051509 | |||
| 784 | Ga0157372_10208500 | |||
| 785 | Ga0182008_10016313 | |||
| 786 | Ga0182006_1000140 | |||
| 787 | Ga0182006_1000222 | |||
| 788 | Ga0183369_1012 | |||
| 789 | Ga0183368_1004 | |||
| 790 | Ga0206356_10107366 | |||
| 791 | Ga0206356_11377764 | |||
| 792 | Ga0206352_10454266 | |||
| 793 | Ga0206354_10822484 | |||
| 794 | Ga0206353_10744446 | |||
| 795 | Ga0154015_1110366 | |||
| 796 | Ga0224712_10017407 | |||
| 797 | Ga0209760_100349 | |||
| 798 | Ga0209784_100026 | |||
| 799 | Ga0209674_100016 | |||
| 800 | Ga0209674_100108 | |||
| 801 | Ga0209674_100473 | |||
| 802 | Ga0209674_101452 | |||
| 803 | Ga0209674_101601 | |||
| 804 | Ga0209672_100007 | |||
| 805 | Ga0209672_100009 | |||
| 806 | Ga0209672_100106 | |||
| 807 | Ga0209672_100268 | |||
| 808 | Ga0209672_100863 | |||
| 809 | Ga0209563_100079 | |||
| 810 | Ga0207427_100023 | |||
| 811 | Ga0207427_100105 | |||
| 812 | Ga0207427_100107 | |||
| 813 | Ga0207427_100261 | |||
| 814 | Ga0207427_104067 | |||
| 815 | Ga0209437_100039 | |||
| 816 | Ga0209437_100069 | |||
| 817 | Ga0209437_100129 | |||
| 818 | Ga0209437_100252 | |||
| 819 | Ga0209437_100563 | |||
| 820 | Ga0209258_100011 | |||
| 821 | Ga0209258_100046 | |||
| 822 | Ga0209258_100059 | |||
| 823 | Ga0209258_100155 | |||
| 824 | Ga0209258_100511 | |||
| 825 | Ga0209258_101052 | |||
| 826 | Ga0209646_1000392 | |||
| 827 | Ga0209026_1000036 | |||
| 828 | Ga0209026_1000051 | |||
| 829 | Ga0209026_1000194 | |||
| 830 | Ga0209026_1000234 | |||
| 831 | Ga0209026_1000635 | |||
| 832 | Ga0209026_1003202 | |||
| 833 | Ga0209148_1000002 | |||
| 834 | Ga0209148_1000010 | |||
| 835 | Ga0209148_1000013 | |||
| 836 | Ga0209148_1000084 | |||
| 837 | Ga0209148_1000220 | |||
| 838 | Ga0209148_1000533 | |||
| 839 | Ga0209148_1003283 | |||
| 840 | Ga0209759_1000300 | |||
| 841 | Ga0209759_1000442 | |||
| 842 | Ga0209759_1000901 | |||
| 843 | Ga0209759_1002380 | |||
| 844 | Ga0209759_1016040 | |||
| 845 | Ga0209129_1004409 | |||
| 846 | Ga0209233_1000009 | |||
| 847 | Ga0209233_1000224 | |||
| 848 | Ga0209233_1000227 | |||
| 849 | Ga0209233_1000300 | |||
| 850 | Ga0209233_1000364 | |||
| 851 | Ga0209233_1012560 | |||
| 852 | Ga0209455_1000010 | |||
| 853 | Ga0209455_1000012 | |||
| 854 | Ga0209455_1000020 | |||
| 855 | Ga0209455_1000077 | |||
| 856 | Ga0209455_1000922 | |||
| 857 | Ga0209455_1006643 | |||
| 858 | Ga0209758_1002866 | |||
| 859 | Ga0209758_1014061 | |||
| 860 | Ga0207426_1003878 | |||
| 861 | Ga0207680_10000006 | |||
| 862 | Ga0207647_10000099 | |||
| 863 | Ga0207647_10000716 | |||
| 864 | Ga0207647_10005371 | |||
| 865 | Ga0207647_10031625 | |||
| 866 | Ga0207705_10001564 | |||
| 867 | Ga0207705_10001744 | |||
| 868 | Ga0207705_10002617 | |||
| 869 | Ga0207705_10003215 | |||
| 870 | Ga0207705_10003650 | |||
| 871 | Ga0207707_10000083 | |||
| 872 | Ga0207707_10000093 | |||
| 873 | Ga0207707_10000214 | |||
| 874 | Ga0207707_10000273 | |||
| 875 | Ga0207707_10000516 | |||
| 876 | Ga0207707_10004435 | |||
| 877 | Ga0207707_10004941 | |||
| 878 | Ga0207695_10000907 | |||
| 879 | Ga0207695_10001809 | |||
| 880 | Ga0207695_10004302 | |||
| 881 | Ga0207695_10004792 | |||
| 882 | Ga0207695_10006439 | |||
| 883 | Ga0207695_10007245 | |||
| 884 | Ga0207695_10014060 | |||
| 885 | Ga0207695_10070435 | |||
| 886 | Ga0207695_10116716 | |||
| 887 | Ga0207695_10192414 | |||
| 888 | Ga0207671_10000020 | |||
| 889 | Ga0207671_10000033 | |||
| 890 | Ga0207671_10000116 | |||
| 891 | Ga0207671_10009215 | |||
| 892 | Ga0207693_10041506 | |||
| 893 | Ga0207663_10101291 | |||
| 894 | Ga0207660_10000690 | |||
| 895 | Ga0207660_10000954 | |||
| 896 | Ga0207660_10001280 | |||
| 897 | Ga0207660_10001400 | |||
| 898 | Ga0207660_10003995 | |||
| 899 | Ga0207657_10001271 | |||
| 900 | Ga0207657_10004595 | |||
| 901 | Ga0207657_10073111 | |||
| 902 | Ga0207657_10078493 | |||
| 903 | Ga0207649_10000779 | |||
| 904 | Ga0207649_10002975 | |||
| 905 | Ga0207652_10000038 | |||
| 906 | Ga0207652_10000125 | |||
| 907 | Ga0207652_10000257 | |||
| 908 | Ga0207694_10001036 | |||
| 909 | Ga0207664_10094704 | |||
| 910 | Ga0207644_10009468 | |||
| 911 | Ga0207690_10000689 | |||
| 912 | Ga0207690_10000793 | |||
| 913 | Ga0207690_10019317 | |||
| 914 | Ga0207670_10001642 | |||
| 915 | Ga0207704_10102029 | |||
| 916 | Ga0207711_10004901 | |||
| 917 | Ga0207661_10005487 | |||
| 918 | Ga0207661_10007193 | |||
| 919 | Ga0207661_10104260 | |||
| 920 | Ga0207679_10012988 | |||
| 921 | Ga0207667_10000130 | |||
| 922 | Ga0207667_10000169 | |||
| 923 | Ga0207667_10002427 | |||
| 924 | Ga0207667_10006312 | |||
| 925 | Ga0207667_10008956 | |||
| 926 | Ga0207667_10019459 | |||
| 927 | Ga0207667_10025291 | |||
| 928 | Ga0207667_10027857 | |||
| 929 | Ga0207667_10070830 | |||
| 930 | Ga0207712_10000972 | |||
| 931 | Ga0207640_10000144 | |||
| 932 | Ga0207640_10000939 | |||
| 933 | Ga0207640_10002085 | |||
| 934 | Ga0207640_10004146 | |||
| 935 | Ga0207640_10025104 | |||
| 936 | Ga0207640_10070526 | |||
| 937 | Ga0207640_10084219 | |||
| 938 | Ga0207658_10000050 | |||
| 939 | Ga0207658_10032798 | |||
| 940 | Ga0207658_10033246 | |||
| 941 | Ga0207639_10000601 | |||
| 942 | Ga0207639_10000690 | |||
| 943 | Ga0207639_10002797 | |||
| 944 | Ga0207639_10006067 | |||
| 945 | Ga0207639_10011089 | |||
| 946 | Ga0207639_10030268 | |||
| 947 | Ga0207678_10000916 | |||
| 948 | Ga0207678_10001375 | |||
| 949 | Ga0207678_10004494 | |||
| 950 | Ga0207678_10004831 | |||
| 951 | Ga0207678_10006700 | |||
| 952 | Ga0207678_10006710 | |||
| 953 | Ga0207678_10017667 | |||
| 954 | Ga0207678_10018220 | |||
| 955 | Ga0207678_10030490 | |||
| 956 | Ga0207678_10153390 | |||
| 957 | Ga0207702_10000384 | |||
| 958 | Ga0207702_10005697 | |||
| 959 | Ga0207702_10006665 | |||
| 960 | Ga0207702_10009006 | |||
| 961 | Ga0207702_10022182 | |||
| 962 | Ga0207702_10195859 | |||
| 963 | Ga0207641_10063680 | |||
| 964 | Ga0207674_10001362 | |||
| 965 | Ga0207674_10001719 | |||
| 966 | Ga0207674_10002346 | |||
| 967 | Ga0207674_10067093 | |||
| 968 | Ga0207674_10183884 | |||
| 969 | Ga0207698_10001087 | |||
| 970 | Ga0207698_10005570 | |||
| 971 | Ga0207698_10283241 | |||
| 972 | Ga0268266_10000021 | |||
| 973 | Ga0268266_10016237 | |||
| 974 | Ga0268265_10034462 | |||
| 975 | Ga0268264_10164805 | |||
| 976 | Ga0307412_10000773 | |||
| 977 | Ga0307510_10000577 | |||
| 978 | Ga0395899_0000460 | |||
| 979 | Ga0395899_0006509 | |||
| 980 | Ga0395899_0038376 | |||
| 981 | Ga0395900_0000051 | |||
| 982 | Ga0395900_0005345 | |||
| 983 | Ga0395900_0012146 | |||
| 984 | Ga0395900_0035069 | |||
| 985 | Ga0395898_0000034 | |||
| 986 | Ga0395898_0000363 | |||
| 987 | Ga0395901_0001129 | |||
| 988 | Ga0439436_0000011 | |||
| 989 | Ga0439465_0000292 | |||
| 990 | Ga0451793_0322512 | |||
| 991 | Ga0451793_1765168 | |||
| 992 | Ga0451802_1844544 | |||
| 993 | Ga0451807_1050170 | |||
| 994 | Ga0451853_0156874 | |||
| 995 | Ga0439448_0018831 | |||
| 996 | Ga0450908_000023 | |||
| 997 | Ga0466972_0027965 | |||
| 998 | Ga0466972_0028135 | |||
| 999 | Ga0466982_0000020 | |||
| 1000 | Ga0466982_0000036 | |||
| 1001 | Ga0466966_0045502 | |||
| 1002 | Ga0466961_0003216 | |||
| 1003 | Ga0466964_0007589 | |||
| 1004 | Ga0466971_0006011 | |||
| 1005 | Ga0466968_0001311 | |||
| 1006 | Ga0466968_0005485 | |||
| 1007 | Ga0466970_0001722 | |||
| 1008 | Ga0466970_0015845 | |||
| 1009 | Ga0466957_0001506 | |||
| 1010 | Ga0466959_0001256 | |||
| 1011 | Ga0466959_0014169 | |||
| 1012 | Ga0466967_0130553 | |||
| 1013 | Ga0495617_000921 | |||
| 1014 | Ga0495590_0017038 | |||
| 1015 | Ga0495638_0000069 | |||
| 1016 | Ga0495638_0000078 | |||
| 1017 | Ga0495638_0000166 | |||
| 1018 | Ga0495638_0000516 | |||
| 1019 | Ga0495638_0018029 | |||
| 1020 | Ga0495650_0000220 | |||
| 1021 | Ga0495650_0000452 | |||
| 1022 | Ga0495650_0000686 | |||
| 1023 | Ga0495584_0006849 | |||
| 1024 | Ga0495585_0000080 | |||
| 1025 | Ga0495585_0001139 | |||
| 1026 | Ga0495607_0000144 | |||
| 1027 | Ga0495607_0000954 | |||
| 1028 | Ga0495607_0003306 | |||
| 1029 | Ga0495583_0008258 | |||
| 1030 | Ga0495606_0000050 | |||
| 1031 | Ga0495606_0000227 | |||
| 1032 | Ga0495606_0011999 | |||
| 1033 | Ga0495610_0001128 | |||
| 1034 | Ga0495616_0000036 | |||
| 1035 | Ga0495616_0010735 | |||
| 1036 | Ga0495631_0000017 | |||
| 1037 | Ga0495631_0001740 | |||
| 1038 | Ga0495632_0000004 | |||
| 1039 | Ga0495632_0000786 | |||
| 1040 | Ga0495632_0027855 | |||
| 1041 | Ga0495648_0005309 | |||
| 1042 | Ga0495648_0024157 | |||
| 1043 | Ga0495609_0014457 | |||
| 1044 | Ga0495668_0009877 | |||
| 1045 | Ga0495611_0000001 | |||
| 1046 | Ga0495611_0000022 | |||
| 1047 | Ga0495625_0016987 | |||
| 1048 | Ga0495661_0000657 | |||
| 1049 | Ga0495670_0013676 | |||
| 1050 | Ga0495649_0004268 | |||
| 1051 | Ga0495589_0000053 | |||
| 1052 | Ga0495660_0000233 | |||
| 1053 | Ga0495679_000004 | |||
| 1054 | Ga0495673_0000004 | |||
| 1055 | Ga0495673_0000048 | |||
| 1056 | Ga0495673_0000644 | |||
| 1057 | Ga0495686_0000017 | |||
| 1058 | Ga0495686_0000295 | |||
| 1059 | Ga0495686_0003885 | |||
| 1060 | Ga0495686_0026907 | |||
| 1061 | Ga0495686_0040185 | |||
| 1062 | Ga0496100_0004368 | |||
| 1063 | Ga0496101_0005402 | |||
| 1064 | Ga0496101_0103684 | |||
| 1065 | Ga0496104_0276585 | |||
| 1066 | Ga0496105_0006103 | |||
| 1067 | Ga0496106_0010355 | |||
| 1068 | Ga0496106_0172547 | |||
| 1069 | Ga0496108_0050537 | |||
| 1070 | Ga0496113_0006783 | |||
| 1071 | Ga0496115_0000039 | |||
| 1072 | Ga0496115_0000180 | |||
| 1073 | Ga0496115_0008559 | |||
| 1074 | Ga0496115_0022001 | |||
| 1075 | Ga0496115_0034830 | |||
| 1076 | Ga0496117_0005946 | |||
| 1077 | Ga0496117_0021175 | |||
| 1078 | Ga0496117_0024598 | |||
| 1079 | Ga0496118_0000413 | |||
| 1080 | Ga0496118_0000645 | |||
| 1081 | Ga0496118_0000805 | |||
| 1082 | Ga0496118_0008916 | |||
| 1083 | Ga0496118_0011703 | |||
| 1084 | Ga0496118_0012593 | |||
| 1085 | Ga0496119_0000868 | |||
| 1086 | Ga0496119_0008515 | |||
| 1087 | Ga0496119_0026697 | |||
| 1088 | Ga0496120_0001056 | |||
| 1089 | Ga0496120_0001816 | |||
| 1090 | Ga0496121_0000372 | |||
| 1091 | Ga0496121_0001970 | |||
| 1092 | Ga0496121_0004478 | |||
| 1093 | Ga0496121_0013350 | |||
| 1094 | Ga0496121_0022568 | |||
| 1095 | Ga0496121_0024061 | |||
| 1096 | Ga0496122_0003660 | |||
| 1097 | Ga0496122_0027095 | |||
| 1098 | Ga0496122_0075011 | |||
| 1099 | Ga0496123_0002907 | |||
| 1100 | Ga0496123_0016637 | |||
| 1101 | Ga0496123_0026568 | |||
| 1102 | Ga0496124_0000289 | |||
| 1103 | Ga0496125_0000344 | |||
| 1104 | Ga0496125_0010084 | |||
| 1105 | Ga0496125_0022927 | |||
| 1106 | Ga0496126_0009400 | |||
| 1107 | Ga0496126_0017325 | |||
| 1108 | Ga0496126_0023281 | |||
| 1109 | Ga0496126_0026524 | |||
| 1110 | Ga0496126_0036929 | |||
| 1111 | Ga0495678_000276 | |||
| 1112 | Ga0495682_0001190 | |||
| 1113 | Ga0501031_0000386 | |||
| 1114 | Ga0501031_0014850 | |||
| 1115 | Ga0501032_0008566 | |||
| 1116 | Ga0501033_0000238 | |||
| 1117 | Ga0501033_0001455 | |||
| 1118 | Ga0501033_0012400 | |||
| 1119 | Ga0501033_0023636 | |||
| 1120 | Ga0501033_0141135 | |||
| 1121 | Ga0501034_0010160 | |||
| 1122 | Ga0501034_0091388 | |||
| 1123 | Ga0501036_0034507 | |||
| 1124 | Ga0501037_0001617 | |||
| 1125 | Ga0501037_0004498 | |||
| 1126 | Ga0501037_0013086 | |||
| 1127 | Ga0501037_0044700 | |||
| 1128 | Ga0501037_0108977 | |||
| 1129 | Ga0501037_0151966 | |||
| 1130 | Ga0501038_0000102 | |||
| 1131 | Ga0501038_0021857 | |||
| 1132 | Ga0501038_0076890 | |||
| 1133 | Ga0501038_0110282 | |||
| 1134 | Ga0501038_0146823 | |||
| 1135 | Ga0501038_0190116 | |||
| 1136 | Ga0501039_0013117 | |||
| 1137 | Ga0501039_0039581 | |||
| 1138 | Ga0501039_0199689 | |||
| 1139 | Ga0501042_0025452 | |||
| 1140 | Ga0501043_0090751 | |||
| 1141 | Ga0501043_0109102 | |||
| 1142 | Ga0501043_0122673 | |||
| 1143 | Ga0501046_0002342 | |||
| 1144 | Ga0501046_0005065 | |||
| 1145 | Ga0501046_0006985 | |||
| 1146 | Ga0501047_0001387 | |||
| 1147 | Ga0501047_0002444 | |||
| 1148 | Ga0501047_0006853 | |||
| 1149 | Ga0501047_0038457 | |||
| 1150 | Ga0501047_0064041 | |||
| 1151 | Ga0501047_0097471 | |||
| 1152 | Ga0501047_0178231 | |||
| 1153 | Ga0501047_0217607 | |||
| 1154 | Ga0501047_0230405 | |||
| 1155 | Ga0501048_0015772 | |||
| 1156 | Ga0501048_0034651 | |||
| 1157 | Ga0501048_0126060 | |||
| 1158 | Ga0501069_0004418 | |||
| 1159 | Ga0501069_0008197 | |||
| 1160 | Ga0501069_0034028 | |||
| 1161 | Ga0501069_0035806 | |||
| 1162 | Ga0501070_0004912 | |||
| 1163 | Ga0501070_0011269 | |||
| 1164 | Ga0501070_0013787 | |||
| 1165 | Ga0501070_0014708 | |||
| 1166 | Ga0501070_0024306 | |||
| 1167 | Ga0501070_0036419 | |||
| 1168 | Ga0501070_0044037 | |||
| 1169 | Ga0501070_0077685 | |||
| 1170 | Ga0501071_0002502 | |||
| 1171 | Ga0501071_0016751 | |||
| 1172 | Ga0501072_0014581 | |||
| 1173 | Ga0501073_0002707 | |||
| 1174 | Ga0501073_0003684 | |||
| 1175 | Ga0501073_0058417 | |||
| 1176 | Ga0501073_0060276 | |||
| 1177 | Ga0501074_0003853 | |||
| 1178 | Ga0501074_0027420 | |||
| 1179 | Ga0501074_0033587 | |||
| 1180 | Ga0501074_0066901 | |||
| 1181 | Ga0501077_0086504 | |||
| 1182 | Ga0501079_0014047 | |||
| 1183 | Ga0501080_0009969 | |||
| 1184 | Ga0501080_0021387 | |||
| 1185 | Ga0501080_0037362 | |||
| 1186 | Ga0501080_0065677 | |||
| 1187 | Ga0501080_0074806 | |||
| 1188 | Ga0501083_0001689 | |||
| 1189 | Ga0501035_0001523 | |||
| 1190 | Ga0501035_0019597 | |||
| 1191 | Ga0501035_0021435 | |||
| 1192 | Ga0501035_0061562 | |||
| 1193 | Ga0501035_0061783 | |||
| 1194 | Ga0501035_0093654 | |||
| 1195 | Ga0501044_0002052 | |||
| 1196 | Ga0501044_0008967 | |||
| 1197 | Ga0501044_0012187 | |||
| 1198 | Ga0501044_0015321 | |||
| 1199 | Ga0501044_0026174 | |||
| 1200 | Ga0501044_0042412 | |||
| 1201 | Ga0501044_0046404 | |||
| 1202 | Ga0501044_0054069 | |||
| 1203 | Ga0501044_0054456 | |||
| 1204 | Ga0501044_0103064 | |||
| 1205 | Ga0501044_0182554 | |||
| 1206 | Ga0500610_0002210 | |||
| 1207 | Ga0500643_000888 | |||
| 1208 | Ga0500597_000045 | |||
| 1209 | Ga0500568_0000665 | |||
| 1210 | Ga0500645_000391 | |||
| 1211 | Ga0501084_0043300 | |||
| 1212 | Ga0501084_0049115 | |||
| 1213 | Ga0500661_004961 | |||
| 1214 | Ga0501082_0001868 | |||
| 1215 | Ga0501082_0038278 | |||
| 1216 | Ga0466962_0004865 | |||
| 1217 | Ga0466962_0005997 | |||
| 1218 | Ga0466962_0031299 | |||
| 1219 | 2538832712 | |||
| 1220 | 2595446884 | |||
| 1221 | 2595449647 | |||
| 1222 | 2643830193 | |||
| 1223 | 2643894762 | |||
| 1224 | 2644476920 | |||
| 1225 | 2687582996 | |||
| 1226 | 2735833572 | |||
| 1227 | 2739229700 | |||
| 1228 | 2739730927 | |||
| 1229 | 2819564038 | |||
| 1230 | 2842917589 | |||
| 1231 | 2842919959 | |||
| 1232 | 2884341564 | |||
| 1233 | 2884412377 | |||
| 1234 | 2895398455 | |||
| 1235 | 2895504054 | |||
| 1236 | 2895515408 | |||
| 1237 | 2895525081 | |||
| 1238 | 2895527817 | |||
| 1239 | 2904464674 | |||
| 1240 | 2919406170 | |||
| 1241 | 2928964004 | |||
| 1242 | 2939614728 | |||
| 1243 | 2941473007 | |||
| 1244 | 2953995254 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5j6b-assembly1.cif.gz_D | crystal structure of aldehyde dehydrogenase from burkholderia thailandensis in covelent complex with nadph | 0.9447 | 6 | 451 |
| 1uxv-assembly1.cif.gz_A | structural basis for allosteric regulation and substrate specificity of the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase (gapn) from thermoproteus tenax | 0.944 | 32 | 449 |
| 1ky8-assembly1.cif.gz_A | crystal structure of the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase | 0.9436 | 28 | 449 |
| 5kf0-assembly1.cif.gz_A | crystal structure of an aldedhyde dehydrogenase from burkholderia vietnamiensis | 0.9423 | 6 | 451 |
| 1uxn-assembly1.cif.gz_A | structural basis for allosteric regulation and substrate specificity of the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase (gapn) from thermoproteus tenax | 0.942 | 32 | 449 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5j6bB02 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 | 0.9759 | 226 | 415 | 3.40.309.10 |
| 5j6bB02 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 | 0.9708 | 226 | 415 | 3.40.309.10 |
| 5mz5B02 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 | 0.9639 | 226 | 415 | 3.40.309.10 |
| 5mz5B02 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 | 0.959 | 226 | 415 | 3.40.309.10 |
| 3k2wA02 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 | 0.9495 | 226 | 414 | 3.40.309.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C5K7N5-F1-model_v4 | NADP-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.9) (Glyceraldehyde-3-phosphate dehydrogenase [NADP(+)]) (Non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase) (Triosephosphate dehydrogenase) | 0.9539 | 122 | 419 |
GO:0008911
|
| AF-A0A7C5YA24-F1-model_v4 | Aldehyde dehydrogenase | 0.9492 | 31 | 356 |
GO:0008911
|
| AF-A0A0K2RK11-F1-model_v4 | Putative aldehyde-dehydrogenase-like protein y4uC | 0.9433 | 150 | 427 |
GO:0008911
|
| AF-A0A658JNM1-F1-model_v4 | deleted | 0.9415 | 32 | 298 |
|
| AF-A0A7J6T3T6-F1-model_v4 | NADP-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.9) (Glyceraldehyde-3-phosphate dehydrogenase [NADP(+)]) (Non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase) (Triosephosphate dehydrogenase) | 0.941 | 7 | 450 |
GO:0008911
|