F470146

General Info

Members Datasets Scaffolds Average Seq Length
622 259 1244 471

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_554_c1|nmdc:mga00v17_554_c1_556_1983
Length 460
Sequence MLEKTYPLYVANRPETPNTDLDVLDKYSGEVATRVAMADAATIERAIQAAVDAAPTMAALPAYKRQAILEHCVRRFRERAEELALALCIEAGKPIKDARGEVTRLIDTFRIAAEEAVRIEGQTVDLEISERGSGYRGIWKRVPIGPCSFITPFNFPLNLVAHKVAPAIAAGCPFVLKPAAKTPVGALIIAEVLAETDLPKGAFSVFACNNEDAAPLIEDDRIKLLSFTGGLVGWDFKARAGRKKVTLELGGNAACIVDGDQAGKLDHVVDRLAFGAYYQSGQSCISVQRILVHDTFVCGDPKDEATFIGPVIDEAAAKKIEGWIGAARDAGASVLAGGGRDGNMLQPALLEHVPRDAELQRQEAFAPVALLERFSDFDKALATVNDSDFGLQAGVFTDSLAHAMQAWDRLEVGGVIVGDVPSFRMDNMPYGGVKDSGLGREGVKFAIEDMSEVRLLVLKT

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
71 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
90 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
136 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
137 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
138 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
139 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
155 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
164 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
176 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
177 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
194 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
199 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
226 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
227 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
228 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
234 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
235 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
236 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
237 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
238 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
239 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
240 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
241 2734482264 Dyella sp. AD052 Isolate Unclassified
242 2738543009 Luteibacter sp. OK325 Isolate Unclassified
243 2739367700 Dyella sp. YR388 Isolate Unclassified
244 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
245 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
246 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
247 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
248 2884411467 Dyella sp. AD56 Isolate Rhizosphere
249 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
250 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
251 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
252 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
253 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
254 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
255 2919404418 Luteibacter sp. 3190 Isolate Unclassified
256 2928963466 Dyella japonica 1073 Isolate Unclassified
257 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
258 2941471342 Luteibacter sp. 621 Isolate Unclassified
259 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.37
Metatranscriptomes 1.45
Isolates 4.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.27
Nodule 0
Rhizoplane 2.89
Rhizosphere 69.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_554_c1 3300050491 Bacteria 20868
2 JGI24741J21665_1000296 3300001915 Bacteria 15024
3 JGI24741J21665_1001236 3300001915 Bacteria 7521
4 JGI24741J21665_1004269 3300001915 Bacteria 3203
5 JGI24741J21665_1006936 3300001915 Bacteria 2232
6 JGI24740J21852_10001743 3300001979 Bacteria 10000
7 JGI24737J22298_10010146 3300001990 Bacteria 3120
8 JGI24735J21928_10014002 3300002067 Bacteria 2515
9 JGI25156J39149_1004679 3300002705 Bacteria 4110
10 JGI25156J39149_1004804 3300002705 Bacteria 4036
11 JGI25162J39368_1000018 3300002737 Bacteria 277875
12 JGI25162J39368_1000988 3300002737 Bacteria 17990
13 JGI25162J39368_1001244 3300002737 Bacteria 14623
14 JGI25157J39369_1000274 3300002741 Bacteria 37731
15 JGI25157J39369_1000749 3300002741 Bacteria 17079
16 JGI25157J39369_1000780 3300002741 Bacteria 16346
17 JGI25157J39369_1002943 3300002741 Bacteria 3768
18 JGI25163J39215_1000566 3300002771 Bacteria 10519
19 JGI25164J39214_1000007 3300002772 Bacteria 312507
20 JGI25164J39214_1000372 3300002772 Bacteria 26710
21 JGI25164J39214_1000612 3300002772 Bacteria 15250
22 JGI25164J39214_1000635 3300002772 Bacteria 14623
23 JGI25165J46597_1000029 3300003214 Bacteria 312507
24 JGI25165J46597_1001233 3300003214 Bacteria 15193
25 JGI25165J46597_1001700 3300003214 Bacteria 9902
26 JGI25165J46597_1002214 3300003214 Bacteria 6819
27 JGI25153J46596_10026221 3300003215 Bacteria 2067
28 rootH2_10016448 3300003320 Bacteria 31308
29 Ga0006562J51391_1059408 3300003578 Bacteria 2500
30 Ga0006562J51391_1086826 3300003578 Bacteria 4430
31 Ga0055539_1001371 3300003752 Bacteria 4636
32 Ga0055525_1000211 3300003759 Bacteria 65308
33 Ga0055527_1000257 3300003760 Bacteria 32518
34 Ga0055527_1000263 3300003760 Bacteria 31815
35 Ga0055527_1002299 3300003760 Bacteria 3309
36 Ga0055535_1000103 3300003761 Bacteria 91199
37 Ga0055535_1000541 3300003761 Bacteria 32518
38 Ga0055535_1000679 3300003761 Bacteria 26491
39 Ga0055535_1003025 3300003761 Bacteria 5128
40 Ga0055542_1000024 3300003762 Bacteria 277875
41 Ga0055542_1000222 3300003762 Bacteria 68762
42 Ga0055542_1000476 3300003762 Bacteria 37344
43 Ga0055542_1000567 3300003762 Bacteria 32518
44 Ga0055542_1000578 3300003762 Bacteria 31815
45 Ga0055542_1000584 3300003762 Bacteria 31631
46 Ga0055529_1000029 3300003763 Bacteria 277978
47 Ga0055529_1000110 3300003763 Bacteria 120255
48 Ga0055529_1000426 3300003763 Bacteria 43142
49 Ga0055529_1000538 3300003763 Bacteria 32518
50 Ga0065165_1000157 3300005262 Bacteria 118005
51 Ga0065165_1008011 3300005262 Bacteria 5051
52 Ga0070658_10001514 3300005327 Bacteria 19725
53 Ga0070666_10000003 3300005335 Bacteria 463666
54 Ga0070680_100000370 3300005336 Bacteria 30250
55 Ga0070680_100000773 3300005336 Bacteria 22446
56 Ga0070680_100040055 3300005336 Bacteria 3792
57 Ga0070682_100003689 3300005337 Bacteria 8507
58 Ga0070682_100052049 3300005337 Bacteria 2562
59 Ga0070660_100018173 3300005339 Bacteria 5133
60 Ga0070660_100026133 3300005339 Bacteria 4346
61 Ga0070660_100034190 3300005339 Bacteria 3838
62 Ga0070660_100072406 3300005339 Bacteria 2693
63 Ga0070689_100001746 3300005340 Bacteria 13911
64 Ga0070691_10004165 3300005341 Bacteria 6569
65 Ga0070661_100003938 3300005344 Bacteria 10218
66 Ga0070661_100072385 3300005344 Bacteria 2536
67 Ga0070661_100130420 3300005344 Bacteria 1887
68 Ga0070659_100069623 3300005366 Bacteria 2793
69 Ga0070659_100130940 3300005366 Bacteria 2037
70 Ga0070667_100000125 3300005367 Bacteria 97665
71 Ga0070667_100035235 3300005367 Bacteria 4192
72 Ga0070714_100099976 3300005435 Bacteria 2554
73 Ga0070663_100000058 3300005455 Bacteria 48647
74 Ga0070663_100001587 3300005455 Bacteria 12518
75 Ga0070663_100031254 3300005455 Bacteria 3658
76 Ga0070663_100074034 3300005455 Bacteria 2486
77 Ga0070663_100097110 3300005455 Bacteria 2193
78 Ga0070663_100130511 3300005455 Bacteria 1908
79 Ga0070662_100021005 3300005457 Bacteria 4454
80 Ga0070681_10000047 3300005458 Bacteria 83504
81 Ga0070681_10006318 3300005458 Bacteria 11522
82 Ga0070681_10007696 3300005458 Bacteria 10534
83 Ga0070681_10011591 3300005458 Bacteria 8727
84 Ga0070681_10024625 3300005458 Bacteria 6055
85 Ga0070685_10016080 3300005466 Bacteria 3981
86 Ga0070679_100000903 3300005530 Bacteria 25743
87 Ga0070679_100002174 3300005530 Bacteria 17690
88 Ga0070679_100064911 3300005530 Bacteria 3639
89 Ga0068853_100001149 3300005539 Bacteria 18771
90 Ga0068853_100017321 3300005539 Bacteria 5948
91 Ga0068853_100029539 3300005539 Bacteria 4622
92 Ga0068853_100041196 3300005539 Bacteria 3943
93 Ga0068853_100052919 3300005539 Bacteria 3496
94 Ga0070696_100005439 3300005546 Bacteria 8493
95 Ga0070696_100007708 3300005546 Bacteria 7190
96 Ga0070696_100062880 3300005546 Bacteria 2599
97 Ga0070693_100002616 3300005547 Bacteria 8289
98 Ga0070693_100011824 3300005547 Bacteria 4403
99 Ga0070693_100019975 3300005547 Bacteria 3524
100 Ga0070665_100009457 3300005548 Bacteria 9865
101 Ga0070665_100011171 3300005548 Bacteria 9079
102 Ga0070665_100062035 3300005548 Bacteria 3748
103 Ga0068855_100004282 3300005563 Bacteria 17432
104 Ga0068855_100017031 3300005563 Bacteria 8742
105 Ga0068855_100040293 3300005563 Bacteria 5544
106 Ga0068855_100144867 3300005563 Bacteria 2705
107 Ga0068855_100168268 3300005563 Bacteria 2483
108 Ga0068855_100254637 3300005563 Bacteria 1957
109 Ga0070664_100018499 3300005564 Bacteria 5725
110 Ga0070664_100024847 3300005564 Bacteria 4962
111 Ga0070664_100090503 3300005564 Bacteria 2648
112 Ga0068857_100009902 3300005577 Bacteria 8274
113 Ga0068857_100155808 3300005577 Bacteria 2071
114 Ga0068854_100001291 3300005578 Bacteria 15082
115 Ga0068854_100002151 3300005578 Bacteria 12098
116 Ga0068854_100004749 3300005578 Bacteria 8568
117 Ga0068854_100010198 3300005578 Bacteria 6090
118 Ga0068854_100040288 3300005578 Bacteria 3296
119 Ga0068856_100010189 3300005614 Bacteria 9139
120 Ga0068856_100054927 3300005614 Bacteria 3930
121 Ga0068852_100005537 3300005616 Bacteria 9054
122 Ga0068852_100064233 3300005616 Bacteria 3199
123 Ga0068851_10018070 3300005834 Bacteria 3395
124 Ga0068858_100125991 3300005842 Bacteria 2399
125 Ga0081540_1002730 3300005983 Bacteria 14362
126 Ga0075364_10001321 3300006051 Bacteria 13342
127 Ga0075369_10013197 3300006186 Bacteria 3273
128 Ga0097621_100070341 3300006237 Bacteria 2890
129 Ga0105240_10000127 3300009093 Bacteria 156461
130 Ga0105240_10005795 3300009093 Bacteria 18320
131 Ga0105240_10045390 3300009093 Bacteria 5575
132 Ga0105240_10118550 3300009093 Bacteria 3189
133 Ga0105240_10152464 3300009093 Bacteria 2751
134 Ga0105247_10018803 3300009101 Bacteria 4148
135 Ga0105248_10004329 3300009177 Bacteria 15699
136 Ga0105237_10000023 3300009545 Bacteria 226144
137 Ga0105237_10000250 3300009545 Bacteria 76317
138 Ga0105237_10037279 3300009545 Bacteria 4916
139 Ga0105238_10000702 3300009551 Bacteria 35000
140 Ga0105238_10007169 3300009551 Bacteria 11150
141 Ga0105249_10000648 3300009553 Bacteria 31755
142 Ga0105239_10000933 3300010375 Bacteria 41307
143 Ga0105239_10025206 3300010375 Bacteria 6548
144 Ga0105239_10030681 3300010375 Bacteria 5913
145 Ga0105239_10259470 3300010375 Bacteria 1953
146 Ga0157373_10014773 3300013100 Bacteria 5719
147 Ga0157373_10084755 3300013100 Bacteria 2233
148 Ga0157371_10013621 3300013102 Bacteria 6172
149 Ga0157371_10032905 3300013102 Bacteria 3729
150 Ga0157371_10046238 3300013102 Bacteria 3096
151 Ga0157370_10004562 3300013104 Bacteria 15855
152 Ga0157369_10000080 3300013105 Bacteria 133011
153 Ga0157369_10001525 3300013105 Bacteria 28397
154 Ga0157369_10026321 3300013105 Bacteria 6454
155 Ga0157374_10152766 3300013296 Bacteria 2245
156 Ga0163162_10007139 3300013306 Bacteria 10842
157 Ga0157372_10001386 3300013307 Bacteria 26144
158 Ga0157372_10004029 3300013307 Bacteria 15755
159 Ga0157372_10018077 3300013307 Bacteria 7578
160 Ga0157372_10035474 3300013307 Bacteria 5491
161 Ga0157372_10051509 3300013307 Bacteria 4582
162 Ga0157372_10208500 3300013307 Bacteria 2264
163 Ga0182008_10016313 3300014497 Bacteria 3860
164 Ga0182006_1000140 3300015261 Bacteria 77650
165 Ga0182006_1000222 3300015261 Bacteria 55421
166 Ga0183369_1012 3300015685 Bacteria 251554
167 Ga0183368_1004 3300015687 Bacteria 1211761
168 Ga0206356_10107366 3300020070 Bacteria 2314
169 Ga0206356_11377764 3300020070 Bacteria 12585
170 Ga0206352_10454266 3300020078 Bacteria 2670
171 Ga0206354_10822484 3300020081 Bacteria 9584
172 Ga0206353_10744446 3300020082 Bacteria 2516
173 Ga0154015_1110366 3300020610 Bacteria 1725
174 Ga0224712_10017407 3300022467 Bacteria 2383
175 Ga0209760_100349 3300025207 Bacteria 13209
176 Ga0209784_100026 3300025224 Bacteria 371540
177 Ga0209674_100016 3300025226 Bacteria 696756
178 Ga0209674_100108 3300025226 Bacteria 150893
179 Ga0209674_100473 3300025226 Bacteria 17588
180 Ga0209674_101452 3300025226 Bacteria 6259
181 Ga0209674_101601 3300025226 Bacteria 5689
182 Ga0209672_100007 3300025228 Bacteria 959482
183 Ga0209672_100009 3300025228 Bacteria 883623
184 Ga0209672_100106 3300025228 Bacteria 100509
185 Ga0209672_100268 3300025228 Bacteria 38409
186 Ga0209672_100863 3300025228 Bacteria 13890
187 Ga0209563_100079 3300025230 Bacteria 203017
188 Ga0207427_100023 3300025231 Bacteria 439725
189 Ga0207427_100105 3300025231 Bacteria 118241
190 Ga0207427_100107 3300025231 Bacteria 116422
191 Ga0207427_100261 3300025231 Bacteria 41118
192 Ga0207427_104067 3300025231 Bacteria 2645
193 Ga0209437_100039 3300025233 Bacteria 448321
194 Ga0209437_100069 3300025233 Bacteria 307733
195 Ga0209437_100129 3300025233 Bacteria 184661
196 Ga0209437_100252 3300025233 Bacteria 84185
197 Ga0209437_100563 3300025233 Bacteria 24403
198 Ga0209258_100011 3300025242 Bacteria 867542
199 Ga0209258_100046 3300025242 Bacteria 369794
200 Ga0209258_100059 3300025242 Bacteria 324934
201 Ga0209258_100155 3300025242 Bacteria 157847
202 Ga0209258_100511 3300025242 Bacteria 37397
203 Ga0209258_101052 3300025242 Bacteria 12139
204 Ga0209646_1000392 3300025246 Bacteria 27054
205 Ga0209026_1000036 3300025250 Bacteria 296607
206 Ga0209026_1000051 3300025250 Bacteria 250792
207 Ga0209026_1000194 3300025250 Bacteria 85950
208 Ga0209026_1000234 3300025250 Bacteria 74634
209 Ga0209026_1000635 3300025250 Bacteria 21860
210 Ga0209026_1003202 3300025250 Bacteria 5536
211 Ga0209148_1000002 3300025254 Bacteria 2399500
212 Ga0209148_1000010 3300025254 Bacteria 1265567
213 Ga0209148_1000013 3300025254 Bacteria 956684
214 Ga0209148_1000084 3300025254 Bacteria 268147
215 Ga0209148_1000220 3300025254 Bacteria 94901
216 Ga0209148_1000533 3300025254 Bacteria 37397
217 Ga0209148_1003283 3300025254 Bacteria 4577
218 Ga0209759_1000300 3300025256 Bacteria 68198
219 Ga0209759_1000442 3300025256 Bacteria 48456
220 Ga0209759_1000901 3300025256 Bacteria 22183
221 Ga0209759_1002380 3300025256 Bacteria 8348
222 Ga0209759_1016040 3300025256 Bacteria 1909
223 Ga0209129_1004409 3300025258 Bacteria 5502
224 Ga0209233_1000009 3300025261 Bacteria 1265567
225 Ga0209233_1000224 3300025261 Bacteria 103605
226 Ga0209233_1000227 3300025261 Bacteria 102833
227 Ga0209233_1000300 3300025261 Bacteria 59294
228 Ga0209233_1000364 3300025261 Bacteria 41118
229 Ga0209233_1012560 3300025261 Bacteria 2452
230 Ga0209455_1000010 3300025272 Bacteria 959482
231 Ga0209455_1000012 3300025272 Bacteria 867234
232 Ga0209455_1000020 3300025272 Bacteria 702259
233 Ga0209455_1000077 3300025272 Bacteria 279165
234 Ga0209455_1000922 3300025272 Bacteria 15165
235 Ga0209455_1006643 3300025272 Bacteria 3390
236 Ga0209758_1002866 3300025297 Bacteria 16735
237 Ga0209758_1014061 3300025297 Bacteria 4297
238 Ga0207426_1003878 3300025302 Bacteria 7705
239 Ga0207680_10000006 3300025903 Bacteria 635950
240 Ga0207647_10000099 3300025904 Bacteria 66290
241 Ga0207647_10000716 3300025904 Bacteria 25997
242 Ga0207647_10005371 3300025904 Bacteria 9418
243 Ga0207647_10031625 3300025904 Bacteria 3404
244 Ga0207705_10001564 3300025909 Bacteria 18182
245 Ga0207705_10001744 3300025909 Bacteria 17217
246 Ga0207705_10002617 3300025909 Bacteria 13797
247 Ga0207705_10003215 3300025909 Bacteria 12441
248 Ga0207705_10003650 3300025909 Bacteria 11716
249 Ga0207707_10000083 3300025912 Bacteria 95462
250 Ga0207707_10000093 3300025912 Bacteria 89975
251 Ga0207707_10000214 3300025912 Bacteria 61954
252 Ga0207707_10000273 3300025912 Bacteria 55671
253 Ga0207707_10000516 3300025912 Bacteria 39572
254 Ga0207707_10004435 3300025912 Bacteria 12370
255 Ga0207707_10004941 3300025912 Bacteria 11719
256 Ga0207695_10000907 3300025913 Bacteria 53347
257 Ga0207695_10001809 3300025913 Bacteria 33712
258 Ga0207695_10004302 3300025913 Bacteria 19518
259 Ga0207695_10004792 3300025913 Bacteria 18304
260 Ga0207695_10006439 3300025913 Bacteria 15246
261 Ga0207695_10007245 3300025913 Bacteria 14168
262 Ga0207695_10014060 3300025913 Bacteria 9504
263 Ga0207695_10070435 3300025913 Bacteria 3575
264 Ga0207695_10116716 3300025913 Bacteria 2643
265 Ga0207695_10192414 3300025913 Bacteria 1957
266 Ga0207671_10000020 3300025914 Bacteria 309636
267 Ga0207671_10000033 3300025914 Bacteria 245869
268 Ga0207671_10000116 3300025914 Bacteria 122775
269 Ga0207671_10009215 3300025914 Bacteria 8277
270 Ga0207693_10041506 3300025915 Bacteria 3622
271 Ga0207663_10101291 3300025916 Bacteria 1935
272 Ga0207660_10000690 3300025917 Bacteria 22578
273 Ga0207660_10000954 3300025917 Bacteria 19144
274 Ga0207660_10001280 3300025917 Bacteria 16882
275 Ga0207660_10001400 3300025917 Bacteria 16210
276 Ga0207660_10003995 3300025917 Bacteria 9613
277 Ga0207657_10001271 3300025919 Bacteria 26893
278 Ga0207657_10004595 3300025919 Bacteria 14588
279 Ga0207657_10073111 3300025919 Bacteria 2899
280 Ga0207657_10078493 3300025919 Bacteria 2780
281 Ga0207649_10000779 3300025920 Bacteria 20674
282 Ga0207649_10002975 3300025920 Bacteria 9336
283 Ga0207652_10000038 3300025921 Bacteria 133467
284 Ga0207652_10000125 3300025921 Bacteria 82619
285 Ga0207652_10000257 3300025921 Bacteria 55336
286 Ga0207694_10001036 3300025924 Bacteria 24194
287 Ga0207664_10094704 3300025929 Bacteria 2455
288 Ga0207644_10009468 3300025931 Bacteria 6397
289 Ga0207690_10000689 3300025932 Bacteria 21712
290 Ga0207690_10000793 3300025932 Bacteria 20362
291 Ga0207690_10019317 3300025932 Bacteria 4194
292 Ga0207670_10001642 3300025936 Bacteria 11672
293 Ga0207704_10102029 3300025938 Bacteria 1915
294 Ga0207711_10004901 3300025941 Bacteria 11362
295 Ga0207661_10005487 3300025944 Bacteria 8946
296 Ga0207661_10007193 3300025944 Bacteria 7908
297 Ga0207661_10104260 3300025944 Bacteria 2387
298 Ga0207679_10012988 3300025945 Bacteria 5449
299 Ga0207667_10000130 3300025949 Bacteria 115321
300 Ga0207667_10000169 3300025949 Bacteria 95977
301 Ga0207667_10002427 3300025949 Bacteria 23337
302 Ga0207667_10006312 3300025949 Bacteria 14377
303 Ga0207667_10008956 3300025949 Bacteria 11838
304 Ga0207667_10019459 3300025949 Bacteria 7579
305 Ga0207667_10025291 3300025949 Bacteria 6501
306 Ga0207667_10027857 3300025949 Bacteria 6143
307 Ga0207667_10070830 3300025949 Bacteria 3628
308 Ga0207712_10000972 3300025961 Bacteria 20638
309 Ga0207640_10000144 3300025981 Bacteria 51999
310 Ga0207640_10000939 3300025981 Bacteria 16269
311 Ga0207640_10002085 3300025981 Bacteria 10766
312 Ga0207640_10004146 3300025981 Bacteria 7833
313 Ga0207640_10025104 3300025981 Bacteria 3603
314 Ga0207640_10070526 3300025981 Bacteria 2351
315 Ga0207640_10084219 3300025981 Bacteria 2183
316 Ga0207658_10000050 3300025986 Bacteria 129714
317 Ga0207658_10032798 3300025986 Bacteria 3700
318 Ga0207658_10033246 3300025986 Bacteria 3678
319 Ga0207639_10000601 3300026041 Bacteria 24806
320 Ga0207639_10000690 3300026041 Bacteria 23246
321 Ga0207639_10002797 3300026041 Bacteria 11719
322 Ga0207639_10006067 3300026041 Bacteria 8202
323 Ga0207639_10011089 3300026041 Bacteria 6251
324 Ga0207639_10030268 3300026041 Bacteria 3969
325 Ga0207678_10000916 3300026067 Bacteria 26995
326 Ga0207678_10001375 3300026067 Bacteria 22403
327 Ga0207678_10004494 3300026067 Bacteria 12538
328 Ga0207678_10004831 3300026067 Bacteria 12098
329 Ga0207678_10006700 3300026067 Bacteria 10215
330 Ga0207678_10006710 3300026067 Bacteria 10210
331 Ga0207678_10017667 3300026067 Bacteria 6262
332 Ga0207678_10018220 3300026067 Bacteria 6167
333 Ga0207678_10030490 3300026067 Bacteria 4707
334 Ga0207678_10153390 3300026067 Bacteria 1967
335 Ga0207702_10000384 3300026078 Bacteria 50456
336 Ga0207702_10005697 3300026078 Bacteria 10861
337 Ga0207702_10006665 3300026078 Bacteria 9930
338 Ga0207702_10009006 3300026078 Bacteria 8404
339 Ga0207702_10022182 3300026078 Bacteria 5262
340 Ga0207702_10195859 3300026078 Bacteria 1870
341 Ga0207641_10063680 3300026088 Bacteria 3150
342 Ga0207674_10001362 3300026116 Bacteria 31632
343 Ga0207674_10001719 3300026116 Bacteria 28008
344 Ga0207674_10002346 3300026116 Bacteria 23934
345 Ga0207674_10067093 3300026116 Bacteria 3612
346 Ga0207674_10183884 3300026116 Bacteria 2040
347 Ga0207698_10001087 3300026142 Bacteria 15802
348 Ga0207698_10005570 3300026142 Bacteria 7787
349 Ga0207698_10283241 3300026142 Bacteria 1534
350 Ga0268266_10000021 3300028379 Bacteria 522453
351 Ga0268266_10016237 3300028379 Bacteria 6365
352 Ga0268265_10034462 3300028380 Bacteria 3691
353 Ga0268264_10164805 3300028381 Bacteria 2000
354 Ga0307412_10000773 3300031911 Bacteria 18455
355 Ga0307510_10000577 3300033180 Bacteria 36999
356 Ga0395899_0000460 3300037312 Bacteria 46114
357 Ga0395899_0006509 3300037312 Bacteria 9050
358 Ga0395899_0038376 3300037312 Bacteria 3587
359 Ga0395900_0000051 3300037418 Bacteria 224228
360 Ga0395900_0005345 3300037418 Bacteria 13457
361 Ga0395900_0012146 3300037418 Bacteria 8800
362 Ga0395900_0035069 3300037418 Bacteria 5167
363 Ga0395898_0000034 3300037466 Bacteria 356745
364 Ga0395898_0000363 3300037466 Bacteria 99698
365 Ga0395901_0001129 3300038443 Bacteria 28299
366 Ga0439436_0000011 3300041404 Bacteria 100668
367 Ga0439465_0000292 3300041413 Bacteria 14130
368 Ga0451793_0322512 3300041452 Bacteria 3437
369 Ga0451793_1765168 3300041452 Bacteria 3064
370 Ga0451802_1844544 3300041460 Bacteria 2647
371 Ga0451807_1050170 3300041486 Bacteria 1917
372 Ga0451853_0156874 3300041512 Bacteria 2950
373 Ga0439448_0018831 3300042005 Bacteria 2120
374 Ga0450908_000023 3300042184 Bacteria 36671
375 Ga0466972_0027965 3300044658 Bacteria 2786
376 Ga0466972_0028135 3300044658 Bacteria 2775
377 Ga0466982_0000020 3300044672 Bacteria 99164
378 Ga0466982_0000036 3300044672 Bacteria 43109
379 Ga0466966_0045502 3300044684 Bacteria 2805
380 Ga0466961_0003216 3300044693 Bacteria 10165
381 Ga0466964_0007589 3300044706 Bacteria 4058
382 Ga0466971_0006011 3300044719 Bacteria 5283
383 Ga0466968_0001311 3300044735 Bacteria 8891
384 Ga0466968_0005485 3300044735 Bacteria 4746
385 Ga0466970_0001722 3300044765 Bacteria 10533
386 Ga0466970_0015845 3300044765 Bacteria 3880
387 Ga0466957_0001506 3300044842 Bacteria 12229
388 Ga0466959_0001256 3300045049 Bacteria 15326
389 Ga0466959_0014169 3300045049 Bacteria 5787
390 Ga0466967_0130553 3300045976 Bacteria 2332
391 Ga0495617_000921 3300046452 Bacteria 13691
392 Ga0495590_0017038 3300046457 Bacteria 2620
393 Ga0495638_0000069 3300046460 Bacteria 167503
394 Ga0495638_0000078 3300046460 Bacteria 157545
395 Ga0495638_0000166 3300046460 Bacteria 102926
396 Ga0495638_0000516 3300046460 Bacteria 45213
397 Ga0495638_0018029 3300046460 Bacteria 4697
398 Ga0495650_0000220 3300046471 Bacteria 119197
399 Ga0495650_0000452 3300046471 Bacteria 65082
400 Ga0495650_0000686 3300046471 Bacteria 43752
401 Ga0495584_0006849 3300046491 Bacteria 5956
402 Ga0495585_0000080 3300046492 Bacteria 99617
403 Ga0495585_0001139 3300046492 Bacteria 21767
404 Ga0495607_0000144 3300046501 Bacteria 74813
405 Ga0495607_0000954 3300046501 Bacteria 26747
406 Ga0495607_0003306 3300046501 Bacteria 12380
407 Ga0495583_0008258 3300046506 Bacteria 6384
408 Ga0495606_0000050 3300046507 Bacteria 203375
409 Ga0495606_0000227 3300046507 Bacteria 99782
410 Ga0495606_0011999 3300046507 Bacteria 6997
411 Ga0495610_0001128 3300046512 Bacteria 24366
412 Ga0495616_0000036 3300046513 Bacteria 128264
413 Ga0495616_0010735 3300046513 Bacteria 5283
414 Ga0495631_0000017 3300046518 Bacteria 98047
415 Ga0495631_0001740 3300046518 Bacteria 12930
416 Ga0495632_0000004 3300046519 Bacteria 381372
417 Ga0495632_0000786 3300046519 Bacteria 28264
418 Ga0495632_0027855 3300046519 Bacteria 2954
419 Ga0495648_0005309 3300046524 Bacteria 10747
420 Ga0495648_0024157 3300046524 Bacteria 4148
421 Ga0495609_0014457 3300046538 Bacteria 3708
422 Ga0495668_0009877 3300046616 Bacteria 5821
423 Ga0495611_0000001 3300046648 Bacteria 2628469
424 Ga0495611_0000022 3300046648 Bacteria 122452
425 Ga0495625_0016987 3300046660 Bacteria 5706
426 Ga0495661_0000657 3300046665 Bacteria 34630
427 Ga0495670_0013676 3300046691 Bacteria 3991
428 Ga0495649_0004268 3300046694 Bacteria 9375
429 Ga0495589_0000053 3300046794 Bacteria 111458
430 Ga0495660_0000233 3300046810 Bacteria 54493
431 Ga0495679_000004 3300047446 Bacteria 748056
432 Ga0495673_0000004 3300047469 Bacteria 1354526
433 Ga0495673_0000048 3300047469 Bacteria 265950
434 Ga0495673_0000644 3300047469 Bacteria 34268
435 Ga0495686_0000017 3300047472 Bacteria 435554
436 Ga0495686_0000295 3300047472 Bacteria 86824
437 Ga0495686_0003885 3300047472 Bacteria 12612
438 Ga0495686_0026907 3300047472 Bacteria 3760
439 Ga0495686_0040185 3300047472 Bacteria 2984
440 Ga0496100_0004368 3300048903 Bacteria 7487
441 Ga0496101_0005402 3300048904 Bacteria 8141
442 Ga0496101_0103684 3300048904 Bacteria 2132
443 Ga0496104_0276585 3300048907 Bacteria 1592
444 Ga0496105_0006103 3300048908 Bacteria 9222
445 Ga0496106_0010355 3300048909 Bacteria 6891
446 Ga0496106_0172547 3300048909 Bacteria 1714
447 Ga0496108_0050537 3300048911 Bacteria 3480
448 Ga0496113_0006783 3300048916 Bacteria 7297
449 Ga0496115_0000039 3300048918 Bacteria 124044
450 Ga0496115_0000180 3300048918 Bacteria 59336
451 Ga0496115_0008559 3300048918 Bacteria 7575
452 Ga0496115_0022001 3300048918 Bacteria 4932
453 Ga0496115_0034830 3300048918 Bacteria 3979
454 Ga0496117_0005946 3300048920 Bacteria 12582
455 Ga0496117_0021175 3300048920 Bacteria 5272
456 Ga0496117_0024598 3300048920 Bacteria 4758
457 Ga0496118_0000413 3300048921 Bacteria 71305
458 Ga0496118_0000645 3300048921 Bacteria 57218
459 Ga0496118_0000805 3300048921 Bacteria 50087
460 Ga0496118_0008916 3300048921 Bacteria 10240
461 Ga0496118_0011703 3300048921 Bacteria 8528
462 Ga0496118_0012593 3300048921 Bacteria 8096
463 Ga0496119_0000868 3300048922 Bacteria 39828
464 Ga0496119_0008515 3300048922 Bacteria 8995
465 Ga0496119_0026697 3300048922 Bacteria 3994
466 Ga0496120_0001056 3300048923 Bacteria 36468
467 Ga0496120_0001816 3300048923 Bacteria 23877
468 Ga0496121_0000372 3300048924 Bacteria 92348
469 Ga0496121_0001970 3300048924 Bacteria 32682
470 Ga0496121_0004478 3300048924 Bacteria 18747
471 Ga0496121_0013350 3300048924 Bacteria 8837
472 Ga0496121_0022568 3300048924 Bacteria 6099
473 Ga0496121_0024061 3300048924 Bacteria 5836
474 Ga0496122_0003660 3300048925 Bacteria 19965
475 Ga0496122_0027095 3300048925 Bacteria 4912
476 Ga0496122_0075011 3300048925 Bacteria 2389
477 Ga0496123_0002907 3300048926 Bacteria 20040
478 Ga0496123_0016637 3300048926 Bacteria 5957
479 Ga0496123_0026568 3300048926 Bacteria 4332
480 Ga0496124_0000289 3300048927 Bacteria 95056
481 Ga0496125_0000344 3300048928 Bacteria 88380
482 Ga0496125_0010084 3300048928 Bacteria 9586
483 Ga0496125_0022927 3300048928 Bacteria 5784
484 Ga0496126_0009400 3300048929 Bacteria 10387
485 Ga0496126_0017325 3300048929 Bacteria 7180
486 Ga0496126_0023281 3300048929 Bacteria 6002
487 Ga0496126_0026524 3300048929 Bacteria 5554
488 Ga0496126_0036929 3300048929 Bacteria 4564
489 Ga0495678_000276 3300049459 Bacteria 56670
490 Ga0495682_0001190 3300049460 Bacteria 14806
491 Ga0501031_0000386 3300049568 Bacteria 25889
492 Ga0501031_0014850 3300049568 Bacteria 5061
493 Ga0501032_0008566 3300049569 Bacteria 7457
494 Ga0501033_0000238 3300049570 Bacteria 52874
495 Ga0501033_0001455 3300049570 Bacteria 20987
496 Ga0501033_0012400 3300049570 Bacteria 6505
497 Ga0501033_0023636 3300049570 Bacteria 4635
498 Ga0501033_0141135 3300049570 Bacteria 1741
499 Ga0501034_0010160 3300049571 Bacteria 9821
500 Ga0501034_0091388 3300049571 Bacteria 3041
501 Ga0501036_0034507 3300049572 Bacteria 4279
502 Ga0501037_0001617 3300049573 Bacteria 16362
503 Ga0501037_0004498 3300049573 Bacteria 10135
504 Ga0501037_0013086 3300049573 Bacteria 6117
505 Ga0501037_0044700 3300049573 Bacteria 3252
506 Ga0501037_0108977 3300049573 Bacteria 1996
507 Ga0501037_0151966 3300049573 Bacteria 1654
508 Ga0501038_0000102 3300049574 Bacteria 72409
509 Ga0501038_0021857 3300049574 Bacteria 5737
510 Ga0501038_0076890 3300049574 Bacteria 2819
511 Ga0501038_0110282 3300049574 Bacteria 2280
512 Ga0501038_0146823 3300049574 Bacteria 1925
513 Ga0501038_0190116 3300049574 Bacteria 1652
514 Ga0501039_0013117 3300049575 Bacteria 6336
515 Ga0501039_0039581 3300049575 Bacteria 3640
516 Ga0501039_0199689 3300049575 Bacteria 1572
517 Ga0501042_0025452 3300049578 Bacteria 4157
518 Ga0501043_0090751 3300049579 Bacteria 2402
519 Ga0501043_0109102 3300049579 Bacteria 2173
520 Ga0501043_0122673 3300049579 Bacteria 2038
521 Ga0501046_0002342 3300049580 Bacteria 17858
522 Ga0501046_0005065 3300049580 Bacteria 11814
523 Ga0501046_0006985 3300049580 Bacteria 9944
524 Ga0501047_0001387 3300049581 Bacteria 23760
525 Ga0501047_0002444 3300049581 Bacteria 17736
526 Ga0501047_0006853 3300049581 Bacteria 10706
527 Ga0501047_0038457 3300049581 Bacteria 4629
528 Ga0501047_0064041 3300049581 Bacteria 3547
529 Ga0501047_0097471 3300049581 Bacteria 2818
530 Ga0501047_0178231 3300049581 Bacteria 1992
531 Ga0501047_0217607 3300049581 Bacteria 1767
532 Ga0501047_0230405 3300049581 Bacteria 1706
533 Ga0501048_0015772 3300049582 Bacteria 5576
534 Ga0501048_0034651 3300049582 Bacteria 3640
535 Ga0501048_0126060 3300049582 Bacteria 1810
536 Ga0501069_0004418 3300049585 Bacteria 7261
537 Ga0501069_0008197 3300049585 Bacteria 5487
538 Ga0501069_0034028 3300049585 Bacteria 2807
539 Ga0501069_0035806 3300049585 Bacteria 2735
540 Ga0501070_0004912 3300049586 Bacteria 11416
541 Ga0501070_0011269 3300049586 Bacteria 7552
542 Ga0501070_0013787 3300049586 Bacteria 6807
543 Ga0501070_0014708 3300049586 Bacteria 6583
544 Ga0501070_0024306 3300049586 Bacteria 5081
545 Ga0501070_0036419 3300049586 Bacteria 4108
546 Ga0501070_0044037 3300049586 Bacteria 3714
547 Ga0501070_0077685 3300049586 Bacteria 2747
548 Ga0501071_0002502 3300049587 Bacteria 11180
549 Ga0501071_0016751 3300049587 Bacteria 5041
550 Ga0501072_0014581 3300049588 Bacteria 6023
551 Ga0501073_0002707 3300049589 Bacteria 13269
552 Ga0501073_0003684 3300049589 Bacteria 11502
553 Ga0501073_0058417 3300049589 Bacteria 2695
554 Ga0501073_0060276 3300049589 Bacteria 2648
555 Ga0501074_0003853 3300049590 Bacteria 10679
556 Ga0501074_0027420 3300049590 Bacteria 4130
557 Ga0501074_0033587 3300049590 Bacteria 3718
558 Ga0501074_0066901 3300049590 Bacteria 2584
559 Ga0501077_0086504 3300049593 Bacteria 1987
560 Ga0501079_0014047 3300049741 Bacteria 6105
561 Ga0501080_0009969 3300049742 Bacteria 8683
562 Ga0501080_0021387 3300049742 Bacteria 5988
563 Ga0501080_0037362 3300049742 Bacteria 4535
564 Ga0501080_0065677 3300049742 Bacteria 3375
565 Ga0501080_0074806 3300049742 Bacteria 3151
566 Ga0501083_0001689 3300049744 Bacteria 15046
567 Ga0501035_0001523 3300049822 Bacteria 23664
568 Ga0501035_0019597 3300049822 Bacteria 6215
569 Ga0501035_0021435 3300049822 Bacteria 5940
570 Ga0501035_0061562 3300049822 Bacteria 3340
571 Ga0501035_0061783 3300049822 Bacteria 3333
572 Ga0501035_0093654 3300049822 Bacteria 2643
573 Ga0501044_0002052 3300049823 Bacteria 23242
574 Ga0501044_0008967 3300049823 Bacteria 10937
575 Ga0501044_0012187 3300049823 Bacteria 9308
576 Ga0501044_0015321 3300049823 Bacteria 8257
577 Ga0501044_0026174 3300049823 Bacteria 6177
578 Ga0501044_0042412 3300049823 Bacteria 4732
579 Ga0501044_0046404 3300049823 Bacteria 4498
580 Ga0501044_0054069 3300049823 Bacteria 4129
581 Ga0501044_0054456 3300049823 Bacteria 4111
582 Ga0501044_0103064 3300049823 Bacteria 2868
583 Ga0501044_0182554 3300049823 Bacteria 2064
584 Ga0500610_0002210 3300053079 Bacteria 7039
585 Ga0500643_000888 3300053087 Bacteria 18939
586 Ga0500597_000045 3300053120 Bacteria 23880
587 Ga0500568_0000665 3300053139 Bacteria 24861
588 Ga0500645_000391 3300053730 Bacteria 30650
589 Ga0501084_0043300 3300054114 Bacteria 3766
590 Ga0501084_0049115 3300054114 Bacteria 3532
591 Ga0500661_004961 3300055283 Bacteria 2494
592 Ga0501082_0001868 3300060353 Bacteria 18525
593 Ga0501082_0038278 3300060353 Bacteria 4137
594 Ga0466962_0004865 3300061719 Bacteria 6465
595 Ga0466962_0005997 3300061719 Bacteria 5840
596 Ga0466962_0031299 3300061719 Bacteria 2547
597 2538832712 2537561836 Bacteria 3910579
598 2595446884 2593339238 Bacteria 4182970
599 2595449647 2593339239 Bacteria 4124669
600 2643830193 2643221562 Bacteria 4048635
601 2643894762 2643221577 Bacteria 3710843
602 2644476920 2643221685 Bacteria 3673288
603 2687582996 2687453130 Bacteria 4227172
604 2735833572 2734482264 Unclassified 5014763
605 2739229700 2738543009 Bacteria 4944499
606 2739730927 2739367700 Bacteria 4747630
607 2819564038 2818991440 Bacteria 4774720
608 2842917589 2842914999 Bacteria 4419378
609 2842919959 2842918807 Bacteria 4289178
610 2884341564 2884338543 Bacteria 4610696
611 2884412377 2884411467 Bacteria 5246714
612 2895398455 2895395659 Bacteria 3983269
613 2895504054 2895498888 Bacteria 5283788
614 2895515408 2895511927 Bacteria 6802080
615 2895525081 2895522137 Bacteria 3284416
616 2895527817 2895525241 Bacteria 3388457
617 2904464674 2904463128 Bacteria 4775606
618 2919406170 2919404418 Bacteria 4232372
619 2928964004 2928963466 Bacteria 5165703
620 2939614728 2939611941 Bacteria 3892017
621 2941473007 2941471342 Bacteria 5018624
622 2953995254 2953994433 Bacteria 4303959
623 nmdc:mga00v17_554_c1
624 JGI24741J21665_1000296
625 JGI24741J21665_1001236
626 JGI24741J21665_1004269
627 JGI24741J21665_1006936
628 JGI24740J21852_10001743
629 JGI24737J22298_10010146
630 JGI24735J21928_10014002
631 JGI25156J39149_1004679
632 JGI25156J39149_1004804
633 JGI25162J39368_1000018
634 JGI25162J39368_1000988
635 JGI25162J39368_1001244
636 JGI25157J39369_1000274
637 JGI25157J39369_1000749
638 JGI25157J39369_1000780
639 JGI25157J39369_1002943
640 JGI25163J39215_1000566
641 JGI25164J39214_1000007
642 JGI25164J39214_1000372
643 JGI25164J39214_1000612
644 JGI25164J39214_1000635
645 JGI25165J46597_1000029
646 JGI25165J46597_1001233
647 JGI25165J46597_1001700
648 JGI25165J46597_1002214
649 JGI25153J46596_10026221
650 rootH2_10016448
651 Ga0006562J51391_1059408
652 Ga0006562J51391_1086826
653 Ga0055539_1001371
654 Ga0055525_1000211
655 Ga0055527_1000257
656 Ga0055527_1000263
657 Ga0055527_1002299
658 Ga0055535_1000103
659 Ga0055535_1000541
660 Ga0055535_1000679
661 Ga0055535_1003025
662 Ga0055542_1000024
663 Ga0055542_1000222
664 Ga0055542_1000476
665 Ga0055542_1000567
666 Ga0055542_1000578
667 Ga0055542_1000584
668 Ga0055529_1000029
669 Ga0055529_1000110
670 Ga0055529_1000426
671 Ga0055529_1000538
672 Ga0065165_1000157
673 Ga0065165_1008011
674 Ga0070658_10001514
675 Ga0070666_10000003
676 Ga0070680_100000370
677 Ga0070680_100000773
678 Ga0070680_100040055
679 Ga0070682_100003689
680 Ga0070682_100052049
681 Ga0070660_100018173
682 Ga0070660_100026133
683 Ga0070660_100034190
684 Ga0070660_100072406
685 Ga0070689_100001746
686 Ga0070691_10004165
687 Ga0070661_100003938
688 Ga0070661_100072385
689 Ga0070661_100130420
690 Ga0070659_100069623
691 Ga0070659_100130940
692 Ga0070667_100000125
693 Ga0070667_100035235
694 Ga0070714_100099976
695 Ga0070663_100000058
696 Ga0070663_100001587
697 Ga0070663_100031254
698 Ga0070663_100074034
699 Ga0070663_100097110
700 Ga0070663_100130511
701 Ga0070662_100021005
702 Ga0070681_10000047
703 Ga0070681_10006318
704 Ga0070681_10007696
705 Ga0070681_10011591
706 Ga0070681_10024625
707 Ga0070685_10016080
708 Ga0070679_100000903
709 Ga0070679_100002174
710 Ga0070679_100064911
711 Ga0068853_100001149
712 Ga0068853_100017321
713 Ga0068853_100029539
714 Ga0068853_100041196
715 Ga0068853_100052919
716 Ga0070696_100005439
717 Ga0070696_100007708
718 Ga0070696_100062880
719 Ga0070693_100002616
720 Ga0070693_100011824
721 Ga0070693_100019975
722 Ga0070665_100009457
723 Ga0070665_100011171
724 Ga0070665_100062035
725 Ga0068855_100004282
726 Ga0068855_100017031
727 Ga0068855_100040293
728 Ga0068855_100144867
729 Ga0068855_100168268
730 Ga0068855_100254637
731 Ga0070664_100018499
732 Ga0070664_100024847
733 Ga0070664_100090503
734 Ga0068857_100009902
735 Ga0068857_100155808
736 Ga0068854_100001291
737 Ga0068854_100002151
738 Ga0068854_100004749
739 Ga0068854_100010198
740 Ga0068854_100040288
741 Ga0068856_100010189
742 Ga0068856_100054927
743 Ga0068852_100005537
744 Ga0068852_100064233
745 Ga0068851_10018070
746 Ga0068858_100125991
747 Ga0081540_1002730
748 Ga0075364_10001321
749 Ga0075369_10013197
750 Ga0097621_100070341
751 Ga0105240_10000127
752 Ga0105240_10005795
753 Ga0105240_10045390
754 Ga0105240_10118550
755 Ga0105240_10152464
756 Ga0105247_10018803
757 Ga0105248_10004329
758 Ga0105237_10000023
759 Ga0105237_10000250
760 Ga0105237_10037279
761 Ga0105238_10000702
762 Ga0105238_10007169
763 Ga0105249_10000648
764 Ga0105239_10000933
765 Ga0105239_10025206
766 Ga0105239_10030681
767 Ga0105239_10259470
768 Ga0157373_10014773
769 Ga0157373_10084755
770 Ga0157371_10013621
771 Ga0157371_10032905
772 Ga0157371_10046238
773 Ga0157370_10004562
774 Ga0157369_10000080
775 Ga0157369_10001525
776 Ga0157369_10026321
777 Ga0157374_10152766
778 Ga0163162_10007139
779 Ga0157372_10001386
780 Ga0157372_10004029
781 Ga0157372_10018077
782 Ga0157372_10035474
783 Ga0157372_10051509
784 Ga0157372_10208500
785 Ga0182008_10016313
786 Ga0182006_1000140
787 Ga0182006_1000222
788 Ga0183369_1012
789 Ga0183368_1004
790 Ga0206356_10107366
791 Ga0206356_11377764
792 Ga0206352_10454266
793 Ga0206354_10822484
794 Ga0206353_10744446
795 Ga0154015_1110366
796 Ga0224712_10017407
797 Ga0209760_100349
798 Ga0209784_100026
799 Ga0209674_100016
800 Ga0209674_100108
801 Ga0209674_100473
802 Ga0209674_101452
803 Ga0209674_101601
804 Ga0209672_100007
805 Ga0209672_100009
806 Ga0209672_100106
807 Ga0209672_100268
808 Ga0209672_100863
809 Ga0209563_100079
810 Ga0207427_100023
811 Ga0207427_100105
812 Ga0207427_100107
813 Ga0207427_100261
814 Ga0207427_104067
815 Ga0209437_100039
816 Ga0209437_100069
817 Ga0209437_100129
818 Ga0209437_100252
819 Ga0209437_100563
820 Ga0209258_100011
821 Ga0209258_100046
822 Ga0209258_100059
823 Ga0209258_100155
824 Ga0209258_100511
825 Ga0209258_101052
826 Ga0209646_1000392
827 Ga0209026_1000036
828 Ga0209026_1000051
829 Ga0209026_1000194
830 Ga0209026_1000234
831 Ga0209026_1000635
832 Ga0209026_1003202
833 Ga0209148_1000002
834 Ga0209148_1000010
835 Ga0209148_1000013
836 Ga0209148_1000084
837 Ga0209148_1000220
838 Ga0209148_1000533
839 Ga0209148_1003283
840 Ga0209759_1000300
841 Ga0209759_1000442
842 Ga0209759_1000901
843 Ga0209759_1002380
844 Ga0209759_1016040
845 Ga0209129_1004409
846 Ga0209233_1000009
847 Ga0209233_1000224
848 Ga0209233_1000227
849 Ga0209233_1000300
850 Ga0209233_1000364
851 Ga0209233_1012560
852 Ga0209455_1000010
853 Ga0209455_1000012
854 Ga0209455_1000020
855 Ga0209455_1000077
856 Ga0209455_1000922
857 Ga0209455_1006643
858 Ga0209758_1002866
859 Ga0209758_1014061
860 Ga0207426_1003878
861 Ga0207680_10000006
862 Ga0207647_10000099
863 Ga0207647_10000716
864 Ga0207647_10005371
865 Ga0207647_10031625
866 Ga0207705_10001564
867 Ga0207705_10001744
868 Ga0207705_10002617
869 Ga0207705_10003215
870 Ga0207705_10003650
871 Ga0207707_10000083
872 Ga0207707_10000093
873 Ga0207707_10000214
874 Ga0207707_10000273
875 Ga0207707_10000516
876 Ga0207707_10004435
877 Ga0207707_10004941
878 Ga0207695_10000907
879 Ga0207695_10001809
880 Ga0207695_10004302
881 Ga0207695_10004792
882 Ga0207695_10006439
883 Ga0207695_10007245
884 Ga0207695_10014060
885 Ga0207695_10070435
886 Ga0207695_10116716
887 Ga0207695_10192414
888 Ga0207671_10000020
889 Ga0207671_10000033
890 Ga0207671_10000116
891 Ga0207671_10009215
892 Ga0207693_10041506
893 Ga0207663_10101291
894 Ga0207660_10000690
895 Ga0207660_10000954
896 Ga0207660_10001280
897 Ga0207660_10001400
898 Ga0207660_10003995
899 Ga0207657_10001271
900 Ga0207657_10004595
901 Ga0207657_10073111
902 Ga0207657_10078493
903 Ga0207649_10000779
904 Ga0207649_10002975
905 Ga0207652_10000038
906 Ga0207652_10000125
907 Ga0207652_10000257
908 Ga0207694_10001036
909 Ga0207664_10094704
910 Ga0207644_10009468
911 Ga0207690_10000689
912 Ga0207690_10000793
913 Ga0207690_10019317
914 Ga0207670_10001642
915 Ga0207704_10102029
916 Ga0207711_10004901
917 Ga0207661_10005487
918 Ga0207661_10007193
919 Ga0207661_10104260
920 Ga0207679_10012988
921 Ga0207667_10000130
922 Ga0207667_10000169
923 Ga0207667_10002427
924 Ga0207667_10006312
925 Ga0207667_10008956
926 Ga0207667_10019459
927 Ga0207667_10025291
928 Ga0207667_10027857
929 Ga0207667_10070830
930 Ga0207712_10000972
931 Ga0207640_10000144
932 Ga0207640_10000939
933 Ga0207640_10002085
934 Ga0207640_10004146
935 Ga0207640_10025104
936 Ga0207640_10070526
937 Ga0207640_10084219
938 Ga0207658_10000050
939 Ga0207658_10032798
940 Ga0207658_10033246
941 Ga0207639_10000601
942 Ga0207639_10000690
943 Ga0207639_10002797
944 Ga0207639_10006067
945 Ga0207639_10011089
946 Ga0207639_10030268
947 Ga0207678_10000916
948 Ga0207678_10001375
949 Ga0207678_10004494
950 Ga0207678_10004831
951 Ga0207678_10006700
952 Ga0207678_10006710
953 Ga0207678_10017667
954 Ga0207678_10018220
955 Ga0207678_10030490
956 Ga0207678_10153390
957 Ga0207702_10000384
958 Ga0207702_10005697
959 Ga0207702_10006665
960 Ga0207702_10009006
961 Ga0207702_10022182
962 Ga0207702_10195859
963 Ga0207641_10063680
964 Ga0207674_10001362
965 Ga0207674_10001719
966 Ga0207674_10002346
967 Ga0207674_10067093
968 Ga0207674_10183884
969 Ga0207698_10001087
970 Ga0207698_10005570
971 Ga0207698_10283241
972 Ga0268266_10000021
973 Ga0268266_10016237
974 Ga0268265_10034462
975 Ga0268264_10164805
976 Ga0307412_10000773
977 Ga0307510_10000577
978 Ga0395899_0000460
979 Ga0395899_0006509
980 Ga0395899_0038376
981 Ga0395900_0000051
982 Ga0395900_0005345
983 Ga0395900_0012146
984 Ga0395900_0035069
985 Ga0395898_0000034
986 Ga0395898_0000363
987 Ga0395901_0001129
988 Ga0439436_0000011
989 Ga0439465_0000292
990 Ga0451793_0322512
991 Ga0451793_1765168
992 Ga0451802_1844544
993 Ga0451807_1050170
994 Ga0451853_0156874
995 Ga0439448_0018831
996 Ga0450908_000023
997 Ga0466972_0027965
998 Ga0466972_0028135
999 Ga0466982_0000020
1000 Ga0466982_0000036
1001 Ga0466966_0045502
1002 Ga0466961_0003216
1003 Ga0466964_0007589
1004 Ga0466971_0006011
1005 Ga0466968_0001311
1006 Ga0466968_0005485
1007 Ga0466970_0001722
1008 Ga0466970_0015845
1009 Ga0466957_0001506
1010 Ga0466959_0001256
1011 Ga0466959_0014169
1012 Ga0466967_0130553
1013 Ga0495617_000921
1014 Ga0495590_0017038
1015 Ga0495638_0000069
1016 Ga0495638_0000078
1017 Ga0495638_0000166
1018 Ga0495638_0000516
1019 Ga0495638_0018029
1020 Ga0495650_0000220
1021 Ga0495650_0000452
1022 Ga0495650_0000686
1023 Ga0495584_0006849
1024 Ga0495585_0000080
1025 Ga0495585_0001139
1026 Ga0495607_0000144
1027 Ga0495607_0000954
1028 Ga0495607_0003306
1029 Ga0495583_0008258
1030 Ga0495606_0000050
1031 Ga0495606_0000227
1032 Ga0495606_0011999
1033 Ga0495610_0001128
1034 Ga0495616_0000036
1035 Ga0495616_0010735
1036 Ga0495631_0000017
1037 Ga0495631_0001740
1038 Ga0495632_0000004
1039 Ga0495632_0000786
1040 Ga0495632_0027855
1041 Ga0495648_0005309
1042 Ga0495648_0024157
1043 Ga0495609_0014457
1044 Ga0495668_0009877
1045 Ga0495611_0000001
1046 Ga0495611_0000022
1047 Ga0495625_0016987
1048 Ga0495661_0000657
1049 Ga0495670_0013676
1050 Ga0495649_0004268
1051 Ga0495589_0000053
1052 Ga0495660_0000233
1053 Ga0495679_000004
1054 Ga0495673_0000004
1055 Ga0495673_0000048
1056 Ga0495673_0000644
1057 Ga0495686_0000017
1058 Ga0495686_0000295
1059 Ga0495686_0003885
1060 Ga0495686_0026907
1061 Ga0495686_0040185
1062 Ga0496100_0004368
1063 Ga0496101_0005402
1064 Ga0496101_0103684
1065 Ga0496104_0276585
1066 Ga0496105_0006103
1067 Ga0496106_0010355
1068 Ga0496106_0172547
1069 Ga0496108_0050537
1070 Ga0496113_0006783
1071 Ga0496115_0000039
1072 Ga0496115_0000180
1073 Ga0496115_0008559
1074 Ga0496115_0022001
1075 Ga0496115_0034830
1076 Ga0496117_0005946
1077 Ga0496117_0021175
1078 Ga0496117_0024598
1079 Ga0496118_0000413
1080 Ga0496118_0000645
1081 Ga0496118_0000805
1082 Ga0496118_0008916
1083 Ga0496118_0011703
1084 Ga0496118_0012593
1085 Ga0496119_0000868
1086 Ga0496119_0008515
1087 Ga0496119_0026697
1088 Ga0496120_0001056
1089 Ga0496120_0001816
1090 Ga0496121_0000372
1091 Ga0496121_0001970
1092 Ga0496121_0004478
1093 Ga0496121_0013350
1094 Ga0496121_0022568
1095 Ga0496121_0024061
1096 Ga0496122_0003660
1097 Ga0496122_0027095
1098 Ga0496122_0075011
1099 Ga0496123_0002907
1100 Ga0496123_0016637
1101 Ga0496123_0026568
1102 Ga0496124_0000289
1103 Ga0496125_0000344
1104 Ga0496125_0010084
1105 Ga0496125_0022927
1106 Ga0496126_0009400
1107 Ga0496126_0017325
1108 Ga0496126_0023281
1109 Ga0496126_0026524
1110 Ga0496126_0036929
1111 Ga0495678_000276
1112 Ga0495682_0001190
1113 Ga0501031_0000386
1114 Ga0501031_0014850
1115 Ga0501032_0008566
1116 Ga0501033_0000238
1117 Ga0501033_0001455
1118 Ga0501033_0012400
1119 Ga0501033_0023636
1120 Ga0501033_0141135
1121 Ga0501034_0010160
1122 Ga0501034_0091388
1123 Ga0501036_0034507
1124 Ga0501037_0001617
1125 Ga0501037_0004498
1126 Ga0501037_0013086
1127 Ga0501037_0044700
1128 Ga0501037_0108977
1129 Ga0501037_0151966
1130 Ga0501038_0000102
1131 Ga0501038_0021857
1132 Ga0501038_0076890
1133 Ga0501038_0110282
1134 Ga0501038_0146823
1135 Ga0501038_0190116
1136 Ga0501039_0013117
1137 Ga0501039_0039581
1138 Ga0501039_0199689
1139 Ga0501042_0025452
1140 Ga0501043_0090751
1141 Ga0501043_0109102
1142 Ga0501043_0122673
1143 Ga0501046_0002342
1144 Ga0501046_0005065
1145 Ga0501046_0006985
1146 Ga0501047_0001387
1147 Ga0501047_0002444
1148 Ga0501047_0006853
1149 Ga0501047_0038457
1150 Ga0501047_0064041
1151 Ga0501047_0097471
1152 Ga0501047_0178231
1153 Ga0501047_0217607
1154 Ga0501047_0230405
1155 Ga0501048_0015772
1156 Ga0501048_0034651
1157 Ga0501048_0126060
1158 Ga0501069_0004418
1159 Ga0501069_0008197
1160 Ga0501069_0034028
1161 Ga0501069_0035806
1162 Ga0501070_0004912
1163 Ga0501070_0011269
1164 Ga0501070_0013787
1165 Ga0501070_0014708
1166 Ga0501070_0024306
1167 Ga0501070_0036419
1168 Ga0501070_0044037
1169 Ga0501070_0077685
1170 Ga0501071_0002502
1171 Ga0501071_0016751
1172 Ga0501072_0014581
1173 Ga0501073_0002707
1174 Ga0501073_0003684
1175 Ga0501073_0058417
1176 Ga0501073_0060276
1177 Ga0501074_0003853
1178 Ga0501074_0027420
1179 Ga0501074_0033587
1180 Ga0501074_0066901
1181 Ga0501077_0086504
1182 Ga0501079_0014047
1183 Ga0501080_0009969
1184 Ga0501080_0021387
1185 Ga0501080_0037362
1186 Ga0501080_0065677
1187 Ga0501080_0074806
1188 Ga0501083_0001689
1189 Ga0501035_0001523
1190 Ga0501035_0019597
1191 Ga0501035_0021435
1192 Ga0501035_0061562
1193 Ga0501035_0061783
1194 Ga0501035_0093654
1195 Ga0501044_0002052
1196 Ga0501044_0008967
1197 Ga0501044_0012187
1198 Ga0501044_0015321
1199 Ga0501044_0026174
1200 Ga0501044_0042412
1201 Ga0501044_0046404
1202 Ga0501044_0054069
1203 Ga0501044_0054456
1204 Ga0501044_0103064
1205 Ga0501044_0182554
1206 Ga0500610_0002210
1207 Ga0500643_000888
1208 Ga0500597_000045
1209 Ga0500568_0000665
1210 Ga0500645_000391
1211 Ga0501084_0043300
1212 Ga0501084_0049115
1213 Ga0500661_004961
1214 Ga0501082_0001868
1215 Ga0501082_0038278
1216 Ga0466962_0004865
1217 Ga0466962_0005997
1218 Ga0466962_0031299
1219 2538832712
1220 2595446884
1221 2595449647
1222 2643830193
1223 2643894762
1224 2644476920
1225 2687582996
1226 2735833572
1227 2739229700
1228 2739730927
1229 2819564038
1230 2842917589
1231 2842919959
1232 2884341564
1233 2884412377
1234 2895398455
1235 2895504054
1236 2895515408
1237 2895525081
1238 2895527817
1239 2904464674
1240 2919406170
1241 2928964004
1242 2939614728
1243 2941473007
1244 2953995254

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

13

456

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j6b-assembly1.cif.gz_D crystal structure of aldehyde dehydrogenase from burkholderia thailandensis in covelent complex with nadph 0.9447 6 451
1uxv-assembly1.cif.gz_A structural basis for allosteric regulation and substrate specificity of the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase (gapn) from thermoproteus tenax 0.944 32 449
1ky8-assembly1.cif.gz_A crystal structure of the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase 0.9436 28 449
5kf0-assembly1.cif.gz_A crystal structure of an aldedhyde dehydrogenase from burkholderia vietnamiensis 0.9423 6 451
1uxn-assembly1.cif.gz_A structural basis for allosteric regulation and substrate specificity of the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase (gapn) from thermoproteus tenax 0.942 32 449
ID Description Score Start End Superfamily
5j6bB02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9759 226 415 3.40.309.10
5j6bB02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9708 226 415 3.40.309.10
5mz5B02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9639 226 415 3.40.309.10
5mz5B02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.959 226 415 3.40.309.10
3k2wA02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9495 226 414 3.40.309.10
ID Description Score Start End GO Terms
AF-C5K7N5-F1-model_v4 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.9) (Glyceraldehyde-3-phosphate dehydrogenase [NADP(+)]) (Non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase) (Triosephosphate dehydrogenase) 0.9539 122 419 GO:0008911
AF-A0A7C5YA24-F1-model_v4 Aldehyde dehydrogenase 0.9492 31 356 GO:0008911
AF-A0A0K2RK11-F1-model_v4 Putative aldehyde-dehydrogenase-like protein y4uC 0.9433 150 427 GO:0008911
AF-A0A658JNM1-F1-model_v4 deleted 0.9415 32 298
AF-A0A7J6T3T6-F1-model_v4 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.9) (Glyceraldehyde-3-phosphate dehydrogenase [NADP(+)]) (Non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase) (Triosephosphate dehydrogenase) 0.941 7 450 GO:0008911

Map