F470189
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 623 | 307 | 1246 | 272 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10509897|Ga0105238_105098971 |
| Length | 309 |
| Sequence | MRVLFLGDLVGRSGRSAVIEALPGLRERYRLDFVVVNGENAAGGFGITETILVELLDAGADVVTTGNHVFDQRETLVYIERYDRLLRPINYPQGTPGKGAGLFKAANGAQVLVINAMGRVFMADLDEPFRAVEKELEACGLKTCADAIIIDFHAEATSEKEAMGFFVDGRASAVIGTHTHVPTADEQILPRGTGYISDVGMCGDFNSVLGMDKDEPLNRFLTKIPSGRYAPALGEATLCAIAIDIDDTTGLARAIAPLRIGRRPGVQVSMEREMACGLGACLGCVVETRRGMIASCVQGPIFDLDEIVW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 162 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 163 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 164 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 165 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 166 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 167 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 168 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 169 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 171 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 174 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 180 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 181 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 184 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 185 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 187 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 188 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 194 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 195 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 196 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 246 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 247 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 248 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 291 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 292 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 293 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 296 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 297 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 298 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 299 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 300 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 301 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 302 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 303 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 304 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 305 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 306 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 307 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.75 |
| Metatranscriptomes | 0.32 |
| Isolates | 1.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.64 |
| Nodule | 0.48 |
| Rhizoplane | 9.79 |
| Rhizosphere | 87.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105238_10509897 | 3300009551 | Bacteria | 1204 |
| 2 | JGI24743J22301_10004620 | 3300001991 | Bacteria | 2254 |
| 3 | JGI24738J21930_10019885 | 3300002075 | Bacteria | 1398 |
| 4 | JGI24744J21845_10005120 | 3300002077 | Unclassified | 2713 |
| 5 | JGI24751J29686_10009424 | 3300002459 | Bacteria | 2006 |
| 6 | Ga0070676_10007398 | 3300005328 | Bacteria | 5893 |
| 7 | Ga0070683_100153210 | 3300005329 | Bacteria | 2185 |
| 8 | Ga0070690_100027821 | 3300005330 | Bacteria | 3498 |
| 9 | Ga0070670_100001190 | 3300005331 | Bacteria | 20633 |
| 10 | Ga0068869_100375778 | 3300005334 | Bacteria | 1164 |
| 11 | Ga0070666_10003012 | 3300005335 | Bacteria | 10216 |
| 12 | Ga0070680_100001970 | 3300005336 | Bacteria | 15109 |
| 13 | Ga0070682_100003034 | 3300005337 | Bacteria | 9309 |
| 14 | Ga0068868_100000904 | 3300005338 | Bacteria | 20173 |
| 15 | Ga0068868_100035881 | 3300005338 | Unclassified | 3835 |
| 16 | Ga0068868_100177986 | 3300005338 | Bacteria | 1763 |
| 17 | Ga0070660_100001178 | 3300005339 | Bacteria | 17696 |
| 18 | Ga0070660_100029003 | 3300005339 | Unclassified | 4144 |
| 19 | Ga0070689_100004127 | 3300005340 | Bacteria | 9782 |
| 20 | Ga0070689_100036702 | 3300005340 | Bacteria | 3748 |
| 21 | Ga0070689_100169742 | 3300005340 | Bacteria | 1767 |
| 22 | Ga0070691_10000155 | 3300005341 | Bacteria | 22187 |
| 23 | Ga0070691_10151131 | 3300005341 | Bacteria | 1190 |
| 24 | Ga0070687_100050098 | 3300005343 | Bacteria | 2155 |
| 25 | Ga0070692_10003545 | 3300005345 | Bacteria | 6348 |
| 26 | Ga0070692_10036402 | 3300005345 | Bacteria | 2497 |
| 27 | Ga0070668_100000692 | 3300005347 | Bacteria | 22968 |
| 28 | Ga0070675_100012884 | 3300005354 | Bacteria | 6563 |
| 29 | Ga0070675_100371356 | 3300005354 | Bacteria | 1272 |
| 30 | Ga0070671_100054784 | 3300005355 | Bacteria | 3316 |
| 31 | Ga0070671_100148692 | 3300005355 | Unclassified | 1978 |
| 32 | Ga0070673_100000626 | 3300005364 | Bacteria | 19353 |
| 33 | Ga0070688_100000139 | 3300005365 | Bacteria | 39353 |
| 34 | Ga0070688_100008062 | 3300005365 | Bacteria | 5704 |
| 35 | Ga0070688_100119802 | 3300005365 | Bacteria | 1761 |
| 36 | Ga0070688_100194001 | 3300005365 | Bacteria | 1417 |
| 37 | Ga0070659_100048145 | 3300005366 | Unclassified | 3348 |
| 38 | Ga0070667_100017103 | 3300005367 | Bacteria | 6008 |
| 39 | Ga0070709_10001924 | 3300005434 | Bacteria | 11284 |
| 40 | Ga0070709_10011161 | 3300005434 | Bacteria | 4997 |
| 41 | Ga0070709_10210638 | 3300005434 | Bacteria | 1381 |
| 42 | Ga0070714_100016853 | 3300005435 | Bacteria | 5909 |
| 43 | Ga0070714_100220502 | 3300005435 | Bacteria | 1743 |
| 44 | Ga0070713_100020215 | 3300005436 | Bacteria | 5100 |
| 45 | Ga0070713_100684072 | 3300005436 | Bacteria | 979 |
| 46 | Ga0070701_10001747 | 3300005438 | Bacteria | 8179 |
| 47 | Ga0070701_10033438 | 3300005438 | Bacteria | 2569 |
| 48 | Ga0070701_10048981 | 3300005438 | Bacteria | 2183 |
| 49 | Ga0070711_100033148 | 3300005439 | Bacteria | 3438 |
| 50 | Ga0070711_100090723 | 3300005439 | Bacteria | 2201 |
| 51 | Ga0070705_100000298 | 3300005440 | Bacteria | 29561 |
| 52 | Ga0070705_100063514 | 3300005440 | Bacteria | 2203 |
| 53 | Ga0070705_100342943 | 3300005440 | Bacteria | 1086 |
| 54 | Ga0070700_100000648 | 3300005441 | Bacteria | 17205 |
| 55 | Ga0070700_100003435 | 3300005441 | Bacteria | 8168 |
| 56 | Ga0070700_100252940 | 3300005441 | Bacteria | 1265 |
| 57 | Ga0070694_100004154 | 3300005444 | Bacteria | 8699 |
| 58 | Ga0070694_100032137 | 3300005444 | Unclassified | 3446 |
| 59 | Ga0070663_100003945 | 3300005455 | Bacteria | 8650 |
| 60 | Ga0070663_100041642 | 3300005455 | Bacteria | 3223 |
| 61 | Ga0070678_100049207 | 3300005456 | Unclassified | 3040 |
| 62 | Ga0070678_100089920 | 3300005456 | Bacteria | 2351 |
| 63 | Ga0070678_100112125 | 3300005456 | Bacteria | 2135 |
| 64 | Ga0070662_100001411 | 3300005457 | Bacteria | 14824 |
| 65 | Ga0070681_10242960 | 3300005458 | Bacteria | 1714 |
| 66 | Ga0070685_10002499 | 3300005466 | Bacteria | 9438 |
| 67 | Ga0070685_10012478 | 3300005466 | Bacteria | 4465 |
| 68 | Ga0070698_100460349 | 3300005471 | Bacteria | 1208 |
| 69 | Ga0070679_100029421 | 3300005530 | Bacteria | 5420 |
| 70 | Ga0070684_100003622 | 3300005535 | Bacteria | 11630 |
| 71 | Ga0070697_100030376 | 3300005536 | Bacteria | 4340 |
| 72 | Ga0070697_100455915 | 3300005536 | Bacteria | 1114 |
| 73 | Ga0068853_100116956 | 3300005539 | Bacteria | 2374 |
| 74 | Ga0068853_100128698 | 3300005539 | Bacteria | 2264 |
| 75 | Ga0070672_100004918 | 3300005543 | Bacteria | 8793 |
| 76 | Ga0070672_100118589 | 3300005543 | Bacteria | 2164 |
| 77 | Ga0070686_100000266 | 3300005544 | Bacteria | 35675 |
| 78 | Ga0070686_100005291 | 3300005544 | Bacteria | 7133 |
| 79 | Ga0070695_100047000 | 3300005545 | Bacteria | 2755 |
| 80 | Ga0070696_100000333 | 3300005546 | Bacteria | 28647 |
| 81 | Ga0070696_100113255 | 3300005546 | Bacteria | 1955 |
| 82 | Ga0070696_100141085 | 3300005546 | Bacteria | 1761 |
| 83 | Ga0070696_100187266 | 3300005546 | Bacteria | 1539 |
| 84 | Ga0070693_100021448 | 3300005547 | Bacteria | 3422 |
| 85 | Ga0070665_100009279 | 3300005548 | Bacteria | 9959 |
| 86 | Ga0070665_100199816 | 3300005548 | Bacteria | 2000 |
| 87 | Ga0070704_100201570 | 3300005549 | Bacteria | 1606 |
| 88 | Ga0070704_100266045 | 3300005549 | Bacteria | 1414 |
| 89 | Ga0068855_100007108 | 3300005563 | Bacteria | 13578 |
| 90 | Ga0070664_100021593 | 3300005564 | Bacteria | 5309 |
| 91 | Ga0070664_100154414 | 3300005564 | Bacteria | 2028 |
| 92 | Ga0068857_100121149 | 3300005577 | Bacteria | 2355 |
| 93 | Ga0068854_100000885 | 3300005578 | Bacteria | 18009 |
| 94 | Ga0068856_100034039 | 3300005614 | Bacteria | 4990 |
| 95 | Ga0070702_100000139 | 3300005615 | Bacteria | 22443 |
| 96 | Ga0070702_100126360 | 3300005615 | Bacteria | 1608 |
| 97 | Ga0068852_100142268 | 3300005616 | Bacteria | 2221 |
| 98 | Ga0068859_100039960 | 3300005617 | Unclassified | 4708 |
| 99 | Ga0068859_100041947 | 3300005617 | Bacteria | 4596 |
| 100 | Ga0068859_100122480 | 3300005617 | Bacteria | 2668 |
| 101 | Ga0068859_100288891 | 3300005617 | Bacteria | 1733 |
| 102 | Ga0068866_10005610 | 3300005718 | Bacteria | 5194 |
| 103 | Ga0068866_10017689 | 3300005718 | Bacteria | 3210 |
| 104 | Ga0068866_10020419 | 3300005718 | Bacteria | 3035 |
| 105 | Ga0068861_100002618 | 3300005719 | Bacteria | 11760 |
| 106 | Ga0068861_100108096 | 3300005719 | Bacteria | 2225 |
| 107 | Ga0068861_100170534 | 3300005719 | Bacteria | 1803 |
| 108 | Ga0068863_100000834 | 3300005841 | Bacteria | 30888 |
| 109 | Ga0068858_100003998 | 3300005842 | Bacteria | 14550 |
| 110 | Ga0068858_100149280 | 3300005842 | Bacteria | 2197 |
| 111 | Ga0068858_100415811 | 3300005842 | Bacteria | 1293 |
| 112 | Ga0068860_100002133 | 3300005843 | Bacteria | 20873 |
| 113 | Ga0068860_100206969 | 3300005843 | Bacteria | 1903 |
| 114 | Ga0068860_100553610 | 3300005843 | Bacteria | 1153 |
| 115 | Ga0068862_100030783 | 3300005844 | Bacteria | 4524 |
| 116 | Ga0068862_100164125 | 3300005844 | Bacteria | 1985 |
| 117 | Ga0068862_100349959 | 3300005844 | Bacteria | 1371 |
| 118 | Ga0081455_10002556 | 3300005937 | Bacteria | 21604 |
| 119 | Ga0081455_10003325 | 3300005937 | Bacteria | 18556 |
| 120 | Ga0081455_10019283 | 3300005937 | Bacteria | 6456 |
| 121 | Ga0070715_10000276 | 3300006163 | Bacteria | 12446 |
| 122 | Ga0070715_10005604 | 3300006163 | Bacteria | 4200 |
| 123 | Ga0070715_10128150 | 3300006163 | Bacteria | 1218 |
| 124 | Ga0070716_100004597 | 3300006173 | Bacteria | 6618 |
| 125 | Ga0070712_100000828 | 3300006175 | Bacteria | 18403 |
| 126 | Ga0070712_100005886 | 3300006175 | Bacteria | 7591 |
| 127 | Ga0075369_10051374 | 3300006186 | Bacteria | 1784 |
| 128 | Ga0097621_100010851 | 3300006237 | Bacteria | 6685 |
| 129 | Ga0068871_100014394 | 3300006358 | Bacteria | 5899 |
| 130 | Ga0068871_100117958 | 3300006358 | Bacteria | 2239 |
| 131 | Ga0068871_100217136 | 3300006358 | Bacteria | 1656 |
| 132 | Ga0075428_100011583 | 3300006844 | Bacteria | 9812 |
| 133 | Ga0075428_100070251 | 3300006844 | Unclassified | 3828 |
| 134 | Ga0075428_100086167 | 3300006844 | Bacteria | 3426 |
| 135 | Ga0075431_100006991 | 3300006847 | Bacteria | 11220 |
| 136 | Ga0075431_100055379 | 3300006847 | Unclassified | 4090 |
| 137 | Ga0075433_10256043 | 3300006852 | Bacteria | 1552 |
| 138 | Ga0075433_10366430 | 3300006852 | Bacteria | 1272 |
| 139 | Ga0075434_100003281 | 3300006871 | Bacteria | 14465 |
| 140 | Ga0075434_100041932 | 3300006871 | Bacteria | 4536 |
| 141 | Ga0075434_100143951 | 3300006871 | Bacteria | 2404 |
| 142 | Ga0075434_100171550 | 3300006871 | Bacteria | 2189 |
| 143 | Ga0075429_100107281 | 3300006880 | Bacteria | 2441 |
| 144 | Ga0068865_100056168 | 3300006881 | Bacteria | 2742 |
| 145 | Ga0068865_100115561 | 3300006881 | Bacteria | 1986 |
| 146 | Ga0075436_100218020 | 3300006914 | Bacteria | 1354 |
| 147 | Ga0097620_100039958 | 3300006931 | Unclassified | 4708 |
| 148 | Ga0097620_100041946 | 3300006931 | Bacteria | 4596 |
| 149 | Ga0097620_100122480 | 3300006931 | Bacteria | 2668 |
| 150 | Ga0097620_100288884 | 3300006931 | Bacteria | 1733 |
| 151 | Ga0075435_100019751 | 3300007076 | Bacteria | 5153 |
| 152 | Ga0075435_100041656 | 3300007076 | Bacteria | 3672 |
| 153 | Ga0075435_100096879 | 3300007076 | Bacteria | 2441 |
| 154 | Ga0111539_10001059 | 3300009094 | Bacteria | 36230 |
| 155 | Ga0111539_10052477 | 3300009094 | Bacteria | 4854 |
| 156 | Ga0111539_10181577 | 3300009094 | Bacteria | 2457 |
| 157 | Ga0111539_10428883 | 3300009094 | Unclassified | 1540 |
| 158 | Ga0105245_10000795 | 3300009098 | Bacteria | 28669 |
| 159 | Ga0105245_10225479 | 3300009098 | Bacteria | 1810 |
| 160 | Ga0105247_10002860 | 3300009101 | Bacteria | 11507 |
| 161 | Ga0105247_10006261 | 3300009101 | Bacteria | 7378 |
| 162 | Ga0114129_10215849 | 3300009147 | Bacteria | 2591 |
| 163 | Ga0114129_10287804 | 3300009147 | Bacteria | 2194 |
| 164 | Ga0105243_10000766 | 3300009148 | Bacteria | 30817 |
| 165 | Ga0105243_10229036 | 3300009148 | Bacteria | 1647 |
| 166 | Ga0105241_10003139 | 3300009174 | Bacteria | 12289 |
| 167 | Ga0105241_10040659 | 3300009174 | Unclassified | 3511 |
| 168 | Ga0105241_10359087 | 3300009174 | Bacteria | 1267 |
| 169 | Ga0105242_10000793 | 3300009176 | Bacteria | 24471 |
| 170 | Ga0105242_10030834 | 3300009176 | Unclassified | 4283 |
| 171 | Ga0105248_10004639 | 3300009177 | Bacteria | 15200 |
| 172 | Ga0105248_10030555 | 3300009177 | Bacteria | 6017 |
| 173 | Ga0105248_10046620 | 3300009177 | Bacteria | 4858 |
| 174 | Ga0105237_10002479 | 3300009545 | Bacteria | 22904 |
| 175 | Ga0105237_10040217 | 3300009545 | Bacteria | 4716 |
| 176 | Ga0105237_10168181 | 3300009545 | Bacteria | 2192 |
| 177 | Ga0105238_10092838 | 3300009551 | Unclassified | 3006 |
| 178 | Ga0105249_10007009 | 3300009553 | Bacteria | 9835 |
| 179 | Ga0105249_10056676 | 3300009553 | Unclassified | 3588 |
| 180 | Ga0105249_10069542 | 3300009553 | Bacteria | 3249 |
| 181 | Ga0105249_10501314 | 3300009553 | Bacteria | 1259 |
| 182 | Ga0105239_10182836 | 3300010375 | Bacteria | 2345 |
| 183 | Ga0105246_10010014 | 3300011119 | Bacteria | 5847 |
| 184 | Ga0105246_10055644 | 3300011119 | Bacteria | 2731 |
| 185 | Ga0105246_10110680 | 3300011119 | Bacteria | 2017 |
| 186 | Ga0157371_10083949 | 3300013102 | Bacteria | 2255 |
| 187 | Ga0157369_10047944 | 3300013105 | Bacteria | 4637 |
| 188 | Ga0157378_10013602 | 3300013297 | Bacteria | 7116 |
| 189 | Ga0157378_10100131 | 3300013297 | Bacteria | 2645 |
| 190 | Ga0157378_10189161 | 3300013297 | Bacteria | 1941 |
| 191 | Ga0163162_10001264 | 3300013306 | Bacteria | 23644 |
| 192 | Ga0163162_10002935 | 3300013306 | Bacteria | 16269 |
| 193 | Ga0163162_10148700 | 3300013306 | Bacteria | 2459 |
| 194 | Ga0163162_10241485 | 3300013306 | Bacteria | 1937 |
| 195 | Ga0157375_10014913 | 3300013308 | Bacteria | 6948 |
| 196 | Ga0157375_10023817 | 3300013308 | Bacteria | 5657 |
| 197 | Ga0157375_10151038 | 3300013308 | Bacteria | 2458 |
| 198 | Ga0163163_10003201 | 3300014325 | Bacteria | 13874 |
| 199 | Ga0163163_10128921 | 3300014325 | Bacteria | 2569 |
| 200 | Ga0163163_10262066 | 3300014325 | Bacteria | 1780 |
| 201 | Ga0157380_10001853 | 3300014326 | Bacteria | 13986 |
| 202 | Ga0157380_10011619 | 3300014326 | Bacteria | 6364 |
| 203 | Ga0157380_10051410 | 3300014326 | Bacteria | 3259 |
| 204 | Ga0157380_10354977 | 3300014326 | Bacteria | 1373 |
| 205 | Ga0157377_10000274 | 3300014745 | Bacteria | 25093 |
| 206 | Ga0157377_10001978 | 3300014745 | Bacteria | 8968 |
| 207 | Ga0157377_10179369 | 3300014745 | Bacteria | 1331 |
| 208 | Ga0157379_10008173 | 3300014968 | Bacteria | 9086 |
| 209 | Ga0157379_10016482 | 3300014968 | Bacteria | 6499 |
| 210 | Ga0157379_10247599 | 3300014968 | Bacteria | 1617 |
| 211 | Ga0157376_10000272 | 3300014969 | Bacteria | 35217 |
| 212 | Ga0157376_10006162 | 3300014969 | Bacteria | 8446 |
| 213 | Ga0157376_10023018 | 3300014969 | Bacteria | 4868 |
| 214 | Ga0157376_10027829 | 3300014969 | Bacteria | 4486 |
| 215 | Ga0157376_10526969 | 3300014969 | Unclassified | 1165 |
| 216 | Ga0163161_10002256 | 3300017792 | Bacteria | 13831 |
| 217 | Ga0163161_10008969 | 3300017792 | Bacteria | 6917 |
| 218 | Ga0163161_10154784 | 3300017792 | Bacteria | 1744 |
| 219 | Ga0207697_10063053 | 3300025315 | Bacteria | 1544 |
| 220 | Ga0207692_10037573 | 3300025898 | Bacteria | 2369 |
| 221 | Ga0207642_10038793 | 3300025899 | Bacteria | 2064 |
| 222 | Ga0207642_10143347 | 3300025899 | Bacteria | 1262 |
| 223 | Ga0207710_10012112 | 3300025900 | Bacteria | 3624 |
| 224 | Ga0207710_10036307 | 3300025900 | Bacteria | 2172 |
| 225 | Ga0207688_10013246 | 3300025901 | Bacteria | 4481 |
| 226 | Ga0207680_10124970 | 3300025903 | Bacteria | 1687 |
| 227 | Ga0207680_10164964 | 3300025903 | Bacteria | 1488 |
| 228 | Ga0207647_10001875 | 3300025904 | Bacteria | 16096 |
| 229 | Ga0207647_10109192 | 3300025904 | Bacteria | 1636 |
| 230 | Ga0207685_10005607 | 3300025905 | Bacteria | 3334 |
| 231 | Ga0207685_10181619 | 3300025905 | Bacteria | 976 |
| 232 | Ga0207699_10001015 | 3300025906 | Bacteria | 13296 |
| 233 | Ga0207699_10015803 | 3300025906 | Unclassified | 3932 |
| 234 | Ga0207699_10053049 | 3300025906 | Bacteria | 2403 |
| 235 | Ga0207645_10004533 | 3300025907 | Bacteria | 10262 |
| 236 | Ga0207684_10291259 | 3300025910 | Bacteria | 1408 |
| 237 | Ga0207654_10002679 | 3300025911 | Bacteria | 9043 |
| 238 | Ga0207654_10041668 | 3300025911 | Unclassified | 2594 |
| 239 | Ga0207654_10243472 | 3300025911 | Bacteria | 1203 |
| 240 | Ga0207707_10190317 | 3300025912 | Bacteria | 1790 |
| 241 | Ga0207671_10452200 | 3300025914 | Bacteria | 1023 |
| 242 | Ga0207693_10000607 | 3300025915 | Bacteria | 32076 |
| 243 | Ga0207693_10001496 | 3300025915 | Bacteria | 20625 |
| 244 | Ga0207693_10037181 | 3300025915 | Bacteria | 3837 |
| 245 | Ga0207663_10026018 | 3300025916 | Bacteria | 3391 |
| 246 | Ga0207663_10052628 | 3300025916 | Bacteria | 2540 |
| 247 | Ga0207662_10063512 | 3300025918 | Bacteria | 2220 |
| 248 | Ga0207657_10000086 | 3300025919 | Bacteria | 88712 |
| 249 | Ga0207657_10028294 | 3300025919 | Bacteria | 5115 |
| 250 | Ga0207649_10014932 | 3300025920 | Bacteria | 4358 |
| 251 | Ga0207659_10046524 | 3300025926 | Bacteria | 3064 |
| 252 | Ga0207659_10301308 | 3300025926 | Bacteria | 1316 |
| 253 | Ga0207700_10586133 | 3300025928 | Bacteria | 992 |
| 254 | Ga0207664_10021367 | 3300025929 | Bacteria | 4811 |
| 255 | Ga0207644_10510796 | 3300025931 | Bacteria | 992 |
| 256 | Ga0207706_10000234 | 3300025933 | Bacteria | 60759 |
| 257 | Ga0207686_10048613 | 3300025934 | Bacteria | 2628 |
| 258 | Ga0207709_10005243 | 3300025935 | Bacteria | 7374 |
| 259 | Ga0207709_10080993 | 3300025935 | Bacteria | 2092 |
| 260 | Ga0207670_10006243 | 3300025936 | Bacteria | 6600 |
| 261 | Ga0207670_10242111 | 3300025936 | Bacteria | 1390 |
| 262 | Ga0207670_10281134 | 3300025936 | Bacteria | 1297 |
| 263 | Ga0207669_10021994 | 3300025937 | Bacteria | 3379 |
| 264 | Ga0207669_10076727 | 3300025937 | Bacteria | 2122 |
| 265 | Ga0207704_10071758 | 3300025938 | Bacteria | 2198 |
| 266 | Ga0207665_10000120 | 3300025939 | Bacteria | 51773 |
| 267 | Ga0207691_10000538 | 3300025940 | Bacteria | 37878 |
| 268 | Ga0207691_10003814 | 3300025940 | Bacteria | 14633 |
| 269 | Ga0207691_10279201 | 3300025940 | Bacteria | 1437 |
| 270 | Ga0207711_10022999 | 3300025941 | Bacteria | 5217 |
| 271 | Ga0207711_10033799 | 3300025941 | Bacteria | 4329 |
| 272 | Ga0207711_10315215 | 3300025941 | Bacteria | 1444 |
| 273 | Ga0207689_10171134 | 3300025942 | Bacteria | 1790 |
| 274 | Ga0207689_10281033 | 3300025942 | Bacteria | 1378 |
| 275 | Ga0207661_10071414 | 3300025944 | Bacteria | 2837 |
| 276 | Ga0207679_10054450 | 3300025945 | Bacteria | 2945 |
| 277 | Ga0207679_10345641 | 3300025945 | Bacteria | 1295 |
| 278 | Ga0207667_10412255 | 3300025949 | Bacteria | 1375 |
| 279 | Ga0207651_10105171 | 3300025960 | Bacteria | 2105 |
| 280 | Ga0207712_10012365 | 3300025961 | Bacteria | 5453 |
| 281 | Ga0207712_10024591 | 3300025961 | Bacteria | 3991 |
| 282 | Ga0207668_10016635 | 3300025972 | Bacteria | 4594 |
| 283 | Ga0207640_10337269 | 3300025981 | Bacteria | 1206 |
| 284 | Ga0207658_10129054 | 3300025986 | Bacteria | 2028 |
| 285 | Ga0207677_10370260 | 3300026023 | Bacteria | 1206 |
| 286 | Ga0207703_10067186 | 3300026035 | Bacteria | 2950 |
| 287 | Ga0207703_10570444 | 3300026035 | Bacteria | 1068 |
| 288 | Ga0207639_10116536 | 3300026041 | Bacteria | 2187 |
| 289 | Ga0207678_10000048 | 3300026067 | Bacteria | 90920 |
| 290 | Ga0207678_10010558 | 3300026067 | Bacteria | 8113 |
| 291 | Ga0207678_10048274 | 3300026067 | Bacteria | 3680 |
| 292 | Ga0207708_10000443 | 3300026075 | Bacteria | 32270 |
| 293 | Ga0207708_10001294 | 3300026075 | Bacteria | 18819 |
| 294 | Ga0207708_10022951 | 3300026075 | Bacteria | 4713 |
| 295 | Ga0207708_10111050 | 3300026075 | Bacteria | 2128 |
| 296 | Ga0207702_10100263 | 3300026078 | Bacteria | 2554 |
| 297 | Ga0207648_10000681 | 3300026089 | Bacteria | 38041 |
| 298 | Ga0207648_10071283 | 3300026089 | Bacteria | 3028 |
| 299 | Ga0207648_10083711 | 3300026089 | Bacteria | 2782 |
| 300 | Ga0207648_10194894 | 3300026089 | Bacteria | 1796 |
| 301 | Ga0207676_10107867 | 3300026095 | Bacteria | 2323 |
| 302 | Ga0207676_10463699 | 3300026095 | Bacteria | 1197 |
| 303 | Ga0207674_10003550 | 3300026116 | Bacteria | 19032 |
| 304 | Ga0207675_100000155 | 3300026118 | Bacteria | 60380 |
| 305 | Ga0207675_100003526 | 3300026118 | Bacteria | 15259 |
| 306 | Ga0207675_100013005 | 3300026118 | Bacteria | 7769 |
| 307 | Ga0207675_100072839 | 3300026118 | Bacteria | 3213 |
| 308 | Ga0207683_10001544 | 3300026121 | Bacteria | 20756 |
| 309 | Ga0207683_10001926 | 3300026121 | Bacteria | 18374 |
| 310 | Ga0207683_10132007 | 3300026121 | Bacteria | 2247 |
| 311 | Ga0207683_10152917 | 3300026121 | Bacteria | 2083 |
| 312 | Ga0207428_10010697 | 3300027907 | Bacteria | 8183 |
| 313 | Ga0207428_10034083 | 3300027907 | Bacteria | 4176 |
| 314 | Ga0268266_10021468 | 3300028379 | Bacteria | 5500 |
| 315 | Ga0268266_10408782 | 3300028379 | Bacteria | 1284 |
| 316 | Ga0268265_10058582 | 3300028380 | Bacteria | 2942 |
| 317 | Ga0268265_10102582 | 3300028380 | Bacteria | 2314 |
| 318 | Ga0268265_10331304 | 3300028380 | Bacteria | 1383 |
| 319 | Ga0268265_10437715 | 3300028380 | Bacteria | 1218 |
| 320 | Ga0268264_10004457 | 3300028381 | Bacteria | 11942 |
| 321 | Ga0268264_10188929 | 3300028381 | Bacteria | 1876 |
| 322 | Ga0316575_10037680 | 3300031665 | Bacteria | 1905 |
| 323 | Ga0316575_10044653 | 3300031665 | Bacteria | 1758 |
| 324 | Ga0316579_10000697 | 3300031691 | Bacteria | 11453 |
| 325 | Ga0316576_10116085 | 3300031727 | Bacteria | 2008 |
| 326 | Ga0316578_10033720 | 3300031728 | Bacteria | 2935 |
| 327 | Ga0316577_10024803 | 3300031733 | Bacteria | 3334 |
| 328 | Ga0316583_10004109 | 3300032133 | Bacteria | 5171 |
| 329 | Ga0316585_10009688 | 3300032137 | Bacteria | 2817 |
| 330 | Ga0316580_10023464 | 3300032139 | Bacteria | 1905 |
| 331 | Ga0316593_10005717 | 3300032168 | Bacteria | 3307 |
| 332 | Ga0307510_10061970 | 3300033180 | Bacteria | 3827 |
| 333 | Ga0316596_1016823 | 3300033541 | Bacteria | 1834 |
| 334 | Ga0373944_0052719 | 3300035089 | Bacteria | 1286 |
| 335 | Ga0373939_0057411 | 3300035114 | Bacteria | 1228 |
| 336 | Ga0373945_0019259 | 3300035116 | Bacteria | 2329 |
| 337 | Ga0373960_0032485 | 3300035121 | Bacteria | 1466 |
| 338 | Ga0373943_0028799 | 3300035170 | Bacteria | 2620 |
| 339 | Ga0373946_0050870 | 3300035171 | Bacteria | 1732 |
| 340 | Ga0373942_0067045 | 3300035207 | Bacteria | 1040 |
| 341 | Ga0373962_0013532 | 3300035242 | Bacteria | 2068 |
| 342 | Ga0316574_0119238 | 3300035398 | Bacteria | 1693 |
| 343 | Ga0373931_0027767 | 3300035691 | Bacteria | 2891 |
| 344 | Ga0373931_0056976 | 3300035691 | Bacteria | 2095 |
| 345 | Ga0373931_0408401 | 3300035691 | Bacteria | 861 |
| 346 | Ga0373935_0137336 | 3300035692 | Bacteria | 1648 |
| 347 | Ga0373927_0058203 | 3300035695 | Bacteria | 2499 |
| 348 | Ga0373947_0151591 | 3300035725 | Bacteria | 1493 |
| 349 | Ga0373937_0059314 | 3300036401 | Bacteria | 3517 |
| 350 | Ga0316582_0007422 | 3300036647 | Bacteria | 5833 |
| 351 | Ga0316584_0002253 | 3300036712 | Bacteria | 12117 |
| 352 | Ga0395899_0198641 | 3300037312 | Bacteria | 1400 |
| 353 | Ga0395900_0081331 | 3300037418 | Bacteria | 3328 |
| 354 | Ga0395898_0029163 | 3300037466 | Bacteria | 5529 |
| 355 | Ga0395898_0040038 | 3300037466 | Bacteria | 4637 |
| 356 | Ga0395905_0007320 | 3300037471 | Bacteria | 10998 |
| 357 | Ga0395901_0003430 | 3300038443 | Bacteria | 15971 |
| 358 | Ga0395901_0172397 | 3300038443 | Bacteria | 2270 |
| 359 | Ga0439456_039272 | 3300042013 | Bacteria | 1024 |
| 360 | Ga0451577_0408383 | 3300042876 | Bacteria | 1233 |
| 361 | Ga0439440_0035063 | 3300042993 | Bacteria | 1202 |
| 362 | Ga0453684_0048131 | 3300044712 | Bacteria | 5644 |
| 363 | Ga0451576_0139773 | 3300045051 | Bacteria | 2526 |
| 364 | Ga0495617_092894 | 3300046452 | Bacteria | 984 |
| 365 | Ga0495603_0000028 | 3300046455 | Bacteria | 61042 |
| 366 | Ga0495603_0114168 | 3300046455 | Unclassified | 1575 |
| 367 | Ga0495629_0068903 | 3300046459 | Bacteria | 2468 |
| 368 | Ga0495641_0077609 | 3300046461 | Bacteria | 1489 |
| 369 | Ga0495641_0104816 | 3300046461 | Unclassified | 1262 |
| 370 | Ga0495580_0008815 | 3300046472 | Bacteria | 7984 |
| 371 | Ga0495580_0146151 | 3300046472 | Bacteria | 1639 |
| 372 | Ga0495582_0005654 | 3300046473 | Bacteria | 6960 |
| 373 | Ga0495605_0052188 | 3300046474 | Bacteria | 1988 |
| 374 | Ga0495605_0186505 | 3300046474 | Bacteria | 910 |
| 375 | Ga0495584_0051127 | 3300046491 | Bacteria | 2081 |
| 376 | Ga0495594_0000900 | 3300046499 | Bacteria | 15394 |
| 377 | Ga0495607_0060793 | 3300046501 | Unclassified | 2149 |
| 378 | Ga0495608_0257980 | 3300046511 | Bacteria | 1086 |
| 379 | Ga0495631_0067051 | 3300046518 | Unclassified | 1553 |
| 380 | Ga0495637_0142900 | 3300046520 | Bacteria | 907 |
| 381 | Ga0495644_0067453 | 3300046523 | Unclassified | 1344 |
| 382 | Ga0495644_0114446 | 3300046523 | Bacteria | 1024 |
| 383 | Ga0495642_0009571 | 3300046528 | Unclassified | 3708 |
| 384 | Ga0495609_0022992 | 3300046538 | Unclassified | 2869 |
| 385 | Ga0495622_0008830 | 3300046557 | Bacteria | 4667 |
| 386 | Ga0495656_0002027 | 3300046615 | Bacteria | 6671 |
| 387 | Ga0495656_0014054 | 3300046615 | Bacteria | 2994 |
| 388 | Ga0495656_0031477 | 3300046615 | Bacteria | 2152 |
| 389 | Ga0495634_0051035 | 3300046642 | Bacteria | 2776 |
| 390 | Ga0495659_0009778 | 3300046664 | Bacteria | 3069 |
| 391 | Ga0495588_0002098 | 3300046674 | Bacteria | 8555 |
| 392 | Ga0495658_0006562 | 3300046683 | Bacteria | 5715 |
| 393 | Ga0495613_0002754 | 3300046689 | Bacteria | 13202 |
| 394 | Ga0495613_0090020 | 3300046689 | Bacteria | 2223 |
| 395 | Ga0495589_0019560 | 3300046794 | Unclassified | 3468 |
| 396 | Ga0495589_0144228 | 3300046794 | Bacteria | 1139 |
| 397 | Ga0495581_0023992 | 3300047315 | Bacteria | 3534 |
| 398 | Ga0495581_0065798 | 3300047315 | Bacteria | 2096 |
| 399 | Ga0495636_0050513 | 3300047318 | Bacteria | 1741 |
| 400 | Ga0495676_0020922 | 3300047321 | Bacteria | 5728 |
| 401 | Ga0495676_0035644 | 3300047321 | Bacteria | 4160 |
| 402 | Ga0495680_0059143 | 3300047322 | Bacteria | 2960 |
| 403 | Ga0495685_051351 | 3300047447 | Bacteria | 1398 |
| 404 | Ga0495593_0001079 | 3300047673 | Bacteria | 15934 |
| 405 | Ga0495614_0010537 | 3300048089 | Bacteria | 4076 |
| 406 | Ga0495615_0070242 | 3300048090 | Unclassified | 942 |
| 407 | Ga0495626_0064139 | 3300048091 | Bacteria | 1665 |
| 408 | Ga0496100_0007013 | 3300048903 | Bacteria | 6181 |
| 409 | Ga0496100_0020956 | 3300048903 | Unclassified | 3928 |
| 410 | Ga0496100_0041031 | 3300048903 | Bacteria | 2947 |
| 411 | Ga0496101_0027362 | 3300048904 | Bacteria | 3972 |
| 412 | Ga0496101_0086149 | 3300048904 | Bacteria | 2329 |
| 413 | Ga0496101_0101264 | 3300048904 | Unclassified | 2156 |
| 414 | Ga0496101_0364966 | 3300048904 | Bacteria | 1135 |
| 415 | Ga0496102_0012313 | 3300048905 | Bacteria | 7398 |
| 416 | Ga0496102_0034877 | 3300048905 | Bacteria | 4528 |
| 417 | Ga0496102_0045439 | 3300048905 | Bacteria | 3988 |
| 418 | Ga0496102_0087250 | 3300048905 | Unclassified | 2882 |
| 419 | Ga0496102_0104593 | 3300048905 | Bacteria | 2633 |
| 420 | Ga0496102_0660238 | 3300048905 | Bacteria | 969 |
| 421 | Ga0496103_0215899 | 3300048906 | Unclassified | 1233 |
| 422 | Ga0496103_0366320 | 3300048906 | Bacteria | 926 |
| 423 | Ga0496104_0012228 | 3300048907 | Bacteria | 7714 |
| 424 | Ga0496104_0095526 | 3300048907 | Bacteria | 2843 |
| 425 | Ga0496104_0175942 | 3300048907 | Bacteria | 2050 |
| 426 | Ga0496104_0198130 | 3300048907 | Bacteria | 1920 |
| 427 | Ga0496105_0021840 | 3300048908 | Bacteria | 5181 |
| 428 | Ga0496105_0162954 | 3300048908 | Bacteria | 1830 |
| 429 | Ga0496106_0016098 | 3300048909 | Bacteria | 5530 |
| 430 | Ga0496106_0174409 | 3300048909 | Bacteria | 1705 |
| 431 | Ga0496106_0405699 | 3300048909 | Bacteria | 1095 |
| 432 | Ga0496107_0013048 | 3300048910 | Bacteria | 5805 |
| 433 | Ga0496107_0044718 | 3300048910 | Bacteria | 3183 |
| 434 | Ga0496107_0063231 | 3300048910 | Bacteria | 2682 |
| 435 | Ga0496107_0081533 | 3300048910 | Bacteria | 2359 |
| 436 | Ga0496107_0391877 | 3300048910 | Bacteria | 1033 |
| 437 | Ga0496108_0031203 | 3300048911 | Bacteria | 4420 |
| 438 | Ga0496108_0089032 | 3300048911 | Bacteria | 2623 |
| 439 | Ga0496108_0236133 | 3300048911 | Bacteria | 1590 |
| 440 | Ga0496108_0290081 | 3300048911 | Bacteria | 1424 |
| 441 | Ga0496108_0403902 | 3300048911 | Bacteria | 1193 |
| 442 | Ga0496108_0542916 | 3300048911 | Bacteria | 1014 |
| 443 | Ga0496109_0042219 | 3300048912 | Bacteria | 4130 |
| 444 | Ga0496109_0059564 | 3300048912 | Bacteria | 3488 |
| 445 | Ga0496109_0474261 | 3300048912 | Bacteria | 1182 |
| 446 | Ga0496110_0015786 | 3300048913 | Bacteria | 6295 |
| 447 | Ga0496110_0373935 | 3300048913 | Bacteria | 1298 |
| 448 | Ga0496111_0016669 | 3300048914 | Bacteria | 5067 |
| 449 | Ga0496111_0265408 | 3300048914 | Bacteria | 1274 |
| 450 | Ga0496111_0276173 | 3300048914 | Bacteria | 1246 |
| 451 | Ga0496112_0004454 | 3300048915 | Bacteria | 11871 |
| 452 | Ga0496112_0024394 | 3300048915 | Bacteria | 5789 |
| 453 | Ga0496112_0160399 | 3300048915 | Bacteria | 2215 |
| 454 | Ga0496112_0172587 | 3300048915 | Bacteria | 2127 |
| 455 | Ga0496113_0034188 | 3300048916 | Bacteria | 3707 |
| 456 | Ga0496113_0046446 | 3300048916 | Bacteria | 3224 |
| 457 | Ga0496113_0082518 | 3300048916 | Bacteria | 2465 |
| 458 | Ga0496113_0113128 | 3300048916 | Bacteria | 2115 |
| 459 | Ga0496113_0294180 | 3300048916 | Bacteria | 1299 |
| 460 | Ga0496114_0012064 | 3300048917 | Bacteria | 6914 |
| 461 | Ga0496114_0051543 | 3300048917 | Bacteria | 3426 |
| 462 | Ga0496114_0163699 | 3300048917 | Bacteria | 1935 |
| 463 | Ga0496114_0341783 | 3300048917 | Bacteria | 1323 |
| 464 | Ga0496115_0081918 | 3300048918 | Bacteria | 2628 |
| 465 | Ga0496115_0098949 | 3300048918 | Bacteria | 2389 |
| 466 | Ga0496115_0158225 | 3300048918 | Bacteria | 1872 |
| 467 | Ga0496115_0185300 | 3300048918 | Bacteria | 1720 |
| 468 | Ga0496115_0194637 | 3300048918 | Bacteria | 1675 |
| 469 | Ga0496118_0114797 | 3300048921 | Bacteria | 1775 |
| 470 | Ga0501031_0078963 | 3300049568 | Bacteria | 2144 |
| 471 | Ga0501031_0104426 | 3300049568 | Bacteria | 1849 |
| 472 | Ga0501031_0209401 | 3300049568 | Bacteria | 1271 |
| 473 | Ga0501032_0078762 | 3300049569 | Bacteria | 2194 |
| 474 | Ga0501033_0027148 | 3300049570 | Bacteria | 4307 |
| 475 | Ga0501033_0136315 | 3300049570 | Bacteria | 1776 |
| 476 | Ga0501033_0264168 | 3300049570 | Bacteria | 1218 |
| 477 | Ga0501034_0018091 | 3300049571 | Bacteria | 7232 |
| 478 | Ga0501034_0032293 | 3300049571 | Bacteria | 5318 |
| 479 | Ga0501036_0117893 | 3300049572 | Bacteria | 2242 |
| 480 | Ga0501036_0147416 | 3300049572 | Bacteria | 1985 |
| 481 | Ga0501036_0369343 | 3300049572 | Bacteria | 1197 |
| 482 | Ga0501037_0039464 | 3300049573 | Bacteria | 3476 |
| 483 | Ga0501037_0202390 | 3300049573 | Bacteria | 1403 |
| 484 | Ga0501037_0244730 | 3300049573 | Bacteria | 1256 |
| 485 | Ga0501038_0015555 | 3300049574 | Bacteria | 6917 |
| 486 | Ga0501038_0433691 | 3300049574 | Bacteria | 1012 |
| 487 | Ga0501039_0014908 | 3300049575 | Bacteria | 5944 |
| 488 | Ga0501039_0053034 | 3300049575 | Bacteria | 3138 |
| 489 | Ga0501039_0074400 | 3300049575 | Bacteria | 2640 |
| 490 | Ga0501039_0462300 | 3300049575 | Bacteria | 996 |
| 491 | Ga0501039_0777234 | 3300049575 | Bacteria | 747 |
| 492 | Ga0501040_0025878 | 3300049576 | Bacteria | 3947 |
| 493 | Ga0501040_0028816 | 3300049576 | Bacteria | 3744 |
| 494 | Ga0501040_0044240 | 3300049576 | Bacteria | 3036 |
| 495 | Ga0501040_0046331 | 3300049576 | Bacteria | 2968 |
| 496 | Ga0501041_0016541 | 3300049577 | Bacteria | 4386 |
| 497 | Ga0501041_0039523 | 3300049577 | Bacteria | 2863 |
| 498 | Ga0501041_0107502 | 3300049577 | Bacteria | 1729 |
| 499 | Ga0501041_0114481 | 3300049577 | Bacteria | 1674 |
| 500 | Ga0501042_0009014 | 3300049578 | Bacteria | 6629 |
| 501 | Ga0501042_0022837 | 3300049578 | Bacteria | 4371 |
| 502 | Ga0501042_0039292 | 3300049578 | Bacteria | 3362 |
| 503 | Ga0501042_0081204 | 3300049578 | Bacteria | 2323 |
| 504 | Ga0501042_0155166 | 3300049578 | Bacteria | 1651 |
| 505 | Ga0501043_0241924 | 3300049579 | Bacteria | 1392 |
| 506 | Ga0501046_0010629 | 3300049580 | Bacteria | 7897 |
| 507 | Ga0501046_0091260 | 3300049580 | Bacteria | 2343 |
| 508 | Ga0501046_0171727 | 3300049580 | Bacteria | 1627 |
| 509 | Ga0501048_0021562 | 3300049582 | Bacteria | 4717 |
| 510 | Ga0501048_0088928 | 3300049582 | Bacteria | 2179 |
| 511 | Ga0501048_0159217 | 3300049582 | Bacteria | 1597 |
| 512 | Ga0501067_0015608 | 3300049583 | Bacteria | 4205 |
| 513 | Ga0501067_0052455 | 3300049583 | Bacteria | 2260 |
| 514 | Ga0501067_0083470 | 3300049583 | Bacteria | 1772 |
| 515 | Ga0501068_0017455 | 3300049584 | Bacteria | 4151 |
| 516 | Ga0501068_0020130 | 3300049584 | Bacteria | 3883 |
| 517 | Ga0501070_0107148 | 3300049586 | Bacteria | 2310 |
| 518 | Ga0501071_0014148 | 3300049587 | Bacteria | 5454 |
| 519 | Ga0501071_0037992 | 3300049587 | Bacteria | 3439 |
| 520 | Ga0501071_0062028 | 3300049587 | Bacteria | 2708 |
| 521 | Ga0501071_0144381 | 3300049587 | Bacteria | 1773 |
| 522 | Ga0501072_0136664 | 3300049588 | Bacteria | 1954 |
| 523 | Ga0501072_0151743 | 3300049588 | Bacteria | 1847 |
| 524 | Ga0501073_0042621 | 3300049589 | Bacteria | 3202 |
| 525 | Ga0501074_0022576 | 3300049590 | Bacteria | 4573 |
| 526 | Ga0501074_0101801 | 3300049590 | Bacteria | 2056 |
| 527 | Ga0501074_0207014 | 3300049590 | Bacteria | 1398 |
| 528 | Ga0501074_0224205 | 3300049590 | Bacteria | 1338 |
| 529 | Ga0501075_0019115 | 3300049591 | Bacteria | 4969 |
| 530 | Ga0501075_0023449 | 3300049591 | Bacteria | 4519 |
| 531 | Ga0501075_0031641 | 3300049591 | Bacteria | 3928 |
| 532 | Ga0501075_0066250 | 3300049591 | Bacteria | 2725 |
| 533 | Ga0501075_0078341 | 3300049591 | Bacteria | 2501 |
| 534 | Ga0501075_0094603 | 3300049591 | Bacteria | 2268 |
| 535 | Ga0501075_0325394 | 3300049591 | Bacteria | 1171 |
| 536 | Ga0501076_0007328 | 3300049592 | Bacteria | 8027 |
| 537 | Ga0501076_0035210 | 3300049592 | Bacteria | 3918 |
| 538 | Ga0501076_0039846 | 3300049592 | Bacteria | 3689 |
| 539 | Ga0501076_0084048 | 3300049592 | Bacteria | 2556 |
| 540 | Ga0501076_0126464 | 3300049592 | Bacteria | 2071 |
| 541 | Ga0501076_0161591 | 3300049592 | Bacteria | 1825 |
| 542 | Ga0501076_0247191 | 3300049592 | Bacteria | 1459 |
| 543 | Ga0501077_0024477 | 3300049593 | Bacteria | 3834 |
| 544 | Ga0501077_0052105 | 3300049593 | Bacteria | 2599 |
| 545 | Ga0501077_0053245 | 3300049593 | Bacteria | 2569 |
| 546 | Ga0501077_0266732 | 3300049593 | Bacteria | 1089 |
| 547 | Ga0501079_0012782 | 3300049741 | Bacteria | 6411 |
| 548 | Ga0501079_0046433 | 3300049741 | Bacteria | 3351 |
| 549 | Ga0501079_0172126 | 3300049741 | Bacteria | 1688 |
| 550 | Ga0501080_0063684 | 3300049742 | Bacteria | 3431 |
| 551 | Ga0501080_0156704 | 3300049742 | Bacteria | 2103 |
| 552 | Ga0501080_0278755 | 3300049742 | Bacteria | 1520 |
| 553 | Ga0501081_0015228 | 3300049743 | Bacteria | 5073 |
| 554 | Ga0501081_0016073 | 3300049743 | Bacteria | 4943 |
| 555 | Ga0501081_0016834 | 3300049743 | Bacteria | 4832 |
| 556 | Ga0501081_0034371 | 3300049743 | Bacteria | 3449 |
| 557 | Ga0501081_0147869 | 3300049743 | Bacteria | 1686 |
| 558 | Ga0501083_0085039 | 3300049744 | Bacteria | 2093 |
| 559 | Ga0501083_0207967 | 3300049744 | Bacteria | 1276 |
| 560 | Ga0501083_0246775 | 3300049744 | Bacteria | 1162 |
| 561 | Ga0501044_0160661 | 3300049823 | Bacteria | 2224 |
| 562 | Ga0501044_0299911 | 3300049823 | Bacteria | 1536 |
| 563 | Ga0501045_0006758 | 3300049824 | Bacteria | 7942 |
| 564 | Ga0501045_0010321 | 3300049824 | Bacteria | 6543 |
| 565 | Ga0501045_0045547 | 3300049824 | Bacteria | 3193 |
| 566 | Ga0501045_0117449 | 3300049824 | Bacteria | 1974 |
| 567 | nmdc:mga05p37_221598_c1 | 3300050507 | Bacteria | 2283 |
| 568 | nmdc:mga09592_91655_c1 | 3300050508 | Bacteria | 2597 |
| 569 | nmdc:mga0qj67_323143_c1 | 3300050509 | Bacteria | 1249 |
| 570 | nmdc:mga06r32_227197_c1 | 3300050510 | Bacteria | 1855 |
| 571 | nmdc:mga06r32_22855_c1 | 3300050510 | Bacteria | 5783 |
| 572 | nmdc:mga06r32_67718_c1 | 3300050510 | Bacteria | 3447 |
| 573 | nmdc:mga08y16_268913_c1 | 3300050511 | Bacteria | 1760 |
| 574 | nmdc:mga08y16_29814_c1 | 3300050511 | Bacteria | 5745 |
| 575 | nmdc:mga08y16_345_c1 | 3300050511 | Bacteria | 41778 |
| 576 | nmdc:mga08y16_366265_c1 | 3300050511 | Unclassified | 1479 |
| 577 | nmdc:mga08y16_94158_c1 | 3300050511 | Bacteria | 3121 |
| 578 | nmdc:mga0n895_106393_c1 | 3300050512 | Bacteria | 2818 |
| 579 | nmdc:mga0n895_18214_c1 | 3300050512 | Bacteria | 6493 |
| 580 | nmdc:mga0n895_31259_c1 | 3300050512 | Bacteria | 5096 |
| 581 | nmdc:mga0n895_46096_c1 | 3300050512 | Bacteria | 4258 |
| 582 | nmdc:mga0rr50_37768_c1 | 3300050513 | Bacteria | 3489 |
| 583 | nmdc:mga0rr50_5898_c1 | 3300050513 | Bacteria | 7371 |
| 584 | nmdc:mga0a205_15555_c1 | 3300050515 | Bacteria | 7110 |
| 585 | nmdc:mga0a205_229469_c1 | 3300050515 | Bacteria | 1740 |
| 586 | Ga0495601_0006873 | 3300053077 | Bacteria | 6664 |
| 587 | Ga0495601_0101540 | 3300053077 | Bacteria | 1858 |
| 588 | Ga0495612_0012370 | 3300053078 | Bacteria | 3440 |
| 589 | Ga0495655_0000198 | 3300053083 | Bacteria | 11334 |
| 590 | Ga0495655_0030465 | 3300053083 | Bacteria | 1305 |
| 591 | Ga0495619_0032696 | 3300053085 | Bacteria | 3376 |
| 592 | Ga0500593_000184 | 3300053117 | Bacteria | 25269 |
| 593 | Ga0500618_002767 | 3300053125 | Bacteria | 6380 |
| 594 | Ga0500568_0000004 | 3300053139 | Bacteria | 621666 |
| 595 | Ga0501084_0017740 | 3300054114 | Bacteria | 5923 |
| 596 | Ga0501084_0037100 | 3300054114 | Bacteria | 4072 |
| 597 | Ga0501084_0100692 | 3300054114 | Bacteria | 2426 |
| 598 | Ga0501084_0188371 | 3300054114 | Bacteria | 1741 |
| 599 | Ga0501084_0598677 | 3300054114 | Bacteria | 931 |
| 600 | Ga0501082_0053657 | 3300060353 | Bacteria | 3474 |
| 601 | Ga0501082_0053765 | 3300060353 | Bacteria | 3470 |
| 602 | Ga0501082_0070735 | 3300060353 | Bacteria | 3004 |
| 603 | Ga0501082_0140581 | 3300060353 | Bacteria | 2095 |
| 604 | Ga0501082_0223844 | 3300060353 | Bacteria | 1637 |
| 605 | Ga0501082_0224719 | 3300060353 | Bacteria | 1634 |
| 606 | Ga0530510_0007363 | 3300061734 | Bacteria | 7662 |
| 607 | Ga0530510_0012630 | 3300061734 | Bacteria | 5936 |
| 608 | Ga0530510_0015107 | 3300061734 | Bacteria | 5453 |
| 609 | Ga0530510_0086988 | 3300061734 | Bacteria | 2277 |
| 610 | Ga0530510_0173084 | 3300061734 | Bacteria | 1599 |
| 611 | Ga0530510_0199947 | 3300061734 | Bacteria | 1484 |
| 612 | 2738746814 | 2738541281 | Bacteria | 5112672 |
| 613 | 2739356044 | 2738543032 | Bacteria | 5115625 |
| 614 | 2776262250 | 2775506901 | Bacteria | 9631051 |
| 615 | 2829747445 | 2829745981 | Bacteria | 5406054 |
| 616 | 2842695233 | 2842694124 | Bacteria | 4063419 |
| 617 | 2842701400 | 2842698319 | Bacteria | 5190321 |
| 618 | 2861692346 | 2861691609 | Bacteria | 5628931 |
| 619 | 2891090556 | 2891088606 | Bacteria | 4762464 |
| 620 | 2909046577 | 2909042592 | Bacteria | 6499737 |
| 621 | 3003670358 | 3003665799 | Bacteria | 7279786 |
| 622 | 641643264 | 641522639 | Bacteria | 7737025 |
| 623 | 643602187 | 643348564 | Bacteria | 8839022 |
| 624 | Ga0105238_10509897 | |||
| 625 | JGI24743J22301_10004620 | |||
| 626 | JGI24738J21930_10019885 | |||
| 627 | JGI24744J21845_10005120 | |||
| 628 | JGI24751J29686_10009424 | |||
| 629 | Ga0070676_10007398 | |||
| 630 | Ga0070683_100153210 | |||
| 631 | Ga0070690_100027821 | |||
| 632 | Ga0070670_100001190 | |||
| 633 | Ga0068869_100375778 | |||
| 634 | Ga0070666_10003012 | |||
| 635 | Ga0070680_100001970 | |||
| 636 | Ga0070682_100003034 | |||
| 637 | Ga0068868_100000904 | |||
| 638 | Ga0068868_100035881 | |||
| 639 | Ga0068868_100177986 | |||
| 640 | Ga0070660_100001178 | |||
| 641 | Ga0070660_100029003 | |||
| 642 | Ga0070689_100004127 | |||
| 643 | Ga0070689_100036702 | |||
| 644 | Ga0070689_100169742 | |||
| 645 | Ga0070691_10000155 | |||
| 646 | Ga0070691_10151131 | |||
| 647 | Ga0070687_100050098 | |||
| 648 | Ga0070692_10003545 | |||
| 649 | Ga0070692_10036402 | |||
| 650 | Ga0070668_100000692 | |||
| 651 | Ga0070675_100012884 | |||
| 652 | Ga0070675_100371356 | |||
| 653 | Ga0070671_100054784 | |||
| 654 | Ga0070671_100148692 | |||
| 655 | Ga0070673_100000626 | |||
| 656 | Ga0070688_100000139 | |||
| 657 | Ga0070688_100008062 | |||
| 658 | Ga0070688_100119802 | |||
| 659 | Ga0070688_100194001 | |||
| 660 | Ga0070659_100048145 | |||
| 661 | Ga0070667_100017103 | |||
| 662 | Ga0070709_10001924 | |||
| 663 | Ga0070709_10011161 | |||
| 664 | Ga0070709_10210638 | |||
| 665 | Ga0070714_100016853 | |||
| 666 | Ga0070714_100220502 | |||
| 667 | Ga0070713_100020215 | |||
| 668 | Ga0070713_100684072 | |||
| 669 | Ga0070701_10001747 | |||
| 670 | Ga0070701_10033438 | |||
| 671 | Ga0070701_10048981 | |||
| 672 | Ga0070711_100033148 | |||
| 673 | Ga0070711_100090723 | |||
| 674 | Ga0070705_100000298 | |||
| 675 | Ga0070705_100063514 | |||
| 676 | Ga0070705_100342943 | |||
| 677 | Ga0070700_100000648 | |||
| 678 | Ga0070700_100003435 | |||
| 679 | Ga0070700_100252940 | |||
| 680 | Ga0070694_100004154 | |||
| 681 | Ga0070694_100032137 | |||
| 682 | Ga0070663_100003945 | |||
| 683 | Ga0070663_100041642 | |||
| 684 | Ga0070678_100049207 | |||
| 685 | Ga0070678_100089920 | |||
| 686 | Ga0070678_100112125 | |||
| 687 | Ga0070662_100001411 | |||
| 688 | Ga0070681_10242960 | |||
| 689 | Ga0070685_10002499 | |||
| 690 | Ga0070685_10012478 | |||
| 691 | Ga0070698_100460349 | |||
| 692 | Ga0070679_100029421 | |||
| 693 | Ga0070684_100003622 | |||
| 694 | Ga0070697_100030376 | |||
| 695 | Ga0070697_100455915 | |||
| 696 | Ga0068853_100116956 | |||
| 697 | Ga0068853_100128698 | |||
| 698 | Ga0070672_100004918 | |||
| 699 | Ga0070672_100118589 | |||
| 700 | Ga0070686_100000266 | |||
| 701 | Ga0070686_100005291 | |||
| 702 | Ga0070695_100047000 | |||
| 703 | Ga0070696_100000333 | |||
| 704 | Ga0070696_100113255 | |||
| 705 | Ga0070696_100141085 | |||
| 706 | Ga0070696_100187266 | |||
| 707 | Ga0070693_100021448 | |||
| 708 | Ga0070665_100009279 | |||
| 709 | Ga0070665_100199816 | |||
| 710 | Ga0070704_100201570 | |||
| 711 | Ga0070704_100266045 | |||
| 712 | Ga0068855_100007108 | |||
| 713 | Ga0070664_100021593 | |||
| 714 | Ga0070664_100154414 | |||
| 715 | Ga0068857_100121149 | |||
| 716 | Ga0068854_100000885 | |||
| 717 | Ga0068856_100034039 | |||
| 718 | Ga0070702_100000139 | |||
| 719 | Ga0070702_100126360 | |||
| 720 | Ga0068852_100142268 | |||
| 721 | Ga0068859_100039960 | |||
| 722 | Ga0068859_100041947 | |||
| 723 | Ga0068859_100122480 | |||
| 724 | Ga0068859_100288891 | |||
| 725 | Ga0068866_10005610 | |||
| 726 | Ga0068866_10017689 | |||
| 727 | Ga0068866_10020419 | |||
| 728 | Ga0068861_100002618 | |||
| 729 | Ga0068861_100108096 | |||
| 730 | Ga0068861_100170534 | |||
| 731 | Ga0068863_100000834 | |||
| 732 | Ga0068858_100003998 | |||
| 733 | Ga0068858_100149280 | |||
| 734 | Ga0068858_100415811 | |||
| 735 | Ga0068860_100002133 | |||
| 736 | Ga0068860_100206969 | |||
| 737 | Ga0068860_100553610 | |||
| 738 | Ga0068862_100030783 | |||
| 739 | Ga0068862_100164125 | |||
| 740 | Ga0068862_100349959 | |||
| 741 | Ga0081455_10002556 | |||
| 742 | Ga0081455_10003325 | |||
| 743 | Ga0081455_10019283 | |||
| 744 | Ga0070715_10000276 | |||
| 745 | Ga0070715_10005604 | |||
| 746 | Ga0070715_10128150 | |||
| 747 | Ga0070716_100004597 | |||
| 748 | Ga0070712_100000828 | |||
| 749 | Ga0070712_100005886 | |||
| 750 | Ga0075369_10051374 | |||
| 751 | Ga0097621_100010851 | |||
| 752 | Ga0068871_100014394 | |||
| 753 | Ga0068871_100117958 | |||
| 754 | Ga0068871_100217136 | |||
| 755 | Ga0075428_100011583 | |||
| 756 | Ga0075428_100070251 | |||
| 757 | Ga0075428_100086167 | |||
| 758 | Ga0075431_100006991 | |||
| 759 | Ga0075431_100055379 | |||
| 760 | Ga0075433_10256043 | |||
| 761 | Ga0075433_10366430 | |||
| 762 | Ga0075434_100003281 | |||
| 763 | Ga0075434_100041932 | |||
| 764 | Ga0075434_100143951 | |||
| 765 | Ga0075434_100171550 | |||
| 766 | Ga0075429_100107281 | |||
| 767 | Ga0068865_100056168 | |||
| 768 | Ga0068865_100115561 | |||
| 769 | Ga0075436_100218020 | |||
| 770 | Ga0097620_100039958 | |||
| 771 | Ga0097620_100041946 | |||
| 772 | Ga0097620_100122480 | |||
| 773 | Ga0097620_100288884 | |||
| 774 | Ga0075435_100019751 | |||
| 775 | Ga0075435_100041656 | |||
| 776 | Ga0075435_100096879 | |||
| 777 | Ga0111539_10001059 | |||
| 778 | Ga0111539_10052477 | |||
| 779 | Ga0111539_10181577 | |||
| 780 | Ga0111539_10428883 | |||
| 781 | Ga0105245_10000795 | |||
| 782 | Ga0105245_10225479 | |||
| 783 | Ga0105247_10002860 | |||
| 784 | Ga0105247_10006261 | |||
| 785 | Ga0114129_10215849 | |||
| 786 | Ga0114129_10287804 | |||
| 787 | Ga0105243_10000766 | |||
| 788 | Ga0105243_10229036 | |||
| 789 | Ga0105241_10003139 | |||
| 790 | Ga0105241_10040659 | |||
| 791 | Ga0105241_10359087 | |||
| 792 | Ga0105242_10000793 | |||
| 793 | Ga0105242_10030834 | |||
| 794 | Ga0105248_10004639 | |||
| 795 | Ga0105248_10030555 | |||
| 796 | Ga0105248_10046620 | |||
| 797 | Ga0105237_10002479 | |||
| 798 | Ga0105237_10040217 | |||
| 799 | Ga0105237_10168181 | |||
| 800 | Ga0105238_10092838 | |||
| 801 | Ga0105249_10007009 | |||
| 802 | Ga0105249_10056676 | |||
| 803 | Ga0105249_10069542 | |||
| 804 | Ga0105249_10501314 | |||
| 805 | Ga0105239_10182836 | |||
| 806 | Ga0105246_10010014 | |||
| 807 | Ga0105246_10055644 | |||
| 808 | Ga0105246_10110680 | |||
| 809 | Ga0157371_10083949 | |||
| 810 | Ga0157369_10047944 | |||
| 811 | Ga0157378_10013602 | |||
| 812 | Ga0157378_10100131 | |||
| 813 | Ga0157378_10189161 | |||
| 814 | Ga0163162_10001264 | |||
| 815 | Ga0163162_10002935 | |||
| 816 | Ga0163162_10148700 | |||
| 817 | Ga0163162_10241485 | |||
| 818 | Ga0157375_10014913 | |||
| 819 | Ga0157375_10023817 | |||
| 820 | Ga0157375_10151038 | |||
| 821 | Ga0163163_10003201 | |||
| 822 | Ga0163163_10128921 | |||
| 823 | Ga0163163_10262066 | |||
| 824 | Ga0157380_10001853 | |||
| 825 | Ga0157380_10011619 | |||
| 826 | Ga0157380_10051410 | |||
| 827 | Ga0157380_10354977 | |||
| 828 | Ga0157377_10000274 | |||
| 829 | Ga0157377_10001978 | |||
| 830 | Ga0157377_10179369 | |||
| 831 | Ga0157379_10008173 | |||
| 832 | Ga0157379_10016482 | |||
| 833 | Ga0157379_10247599 | |||
| 834 | Ga0157376_10000272 | |||
| 835 | Ga0157376_10006162 | |||
| 836 | Ga0157376_10023018 | |||
| 837 | Ga0157376_10027829 | |||
| 838 | Ga0157376_10526969 | |||
| 839 | Ga0163161_10002256 | |||
| 840 | Ga0163161_10008969 | |||
| 841 | Ga0163161_10154784 | |||
| 842 | Ga0207697_10063053 | |||
| 843 | Ga0207692_10037573 | |||
| 844 | Ga0207642_10038793 | |||
| 845 | Ga0207642_10143347 | |||
| 846 | Ga0207710_10012112 | |||
| 847 | Ga0207710_10036307 | |||
| 848 | Ga0207688_10013246 | |||
| 849 | Ga0207680_10124970 | |||
| 850 | Ga0207680_10164964 | |||
| 851 | Ga0207647_10001875 | |||
| 852 | Ga0207647_10109192 | |||
| 853 | Ga0207685_10005607 | |||
| 854 | Ga0207685_10181619 | |||
| 855 | Ga0207699_10001015 | |||
| 856 | Ga0207699_10015803 | |||
| 857 | Ga0207699_10053049 | |||
| 858 | Ga0207645_10004533 | |||
| 859 | Ga0207684_10291259 | |||
| 860 | Ga0207654_10002679 | |||
| 861 | Ga0207654_10041668 | |||
| 862 | Ga0207654_10243472 | |||
| 863 | Ga0207707_10190317 | |||
| 864 | Ga0207671_10452200 | |||
| 865 | Ga0207693_10000607 | |||
| 866 | Ga0207693_10001496 | |||
| 867 | Ga0207693_10037181 | |||
| 868 | Ga0207663_10026018 | |||
| 869 | Ga0207663_10052628 | |||
| 870 | Ga0207662_10063512 | |||
| 871 | Ga0207657_10000086 | |||
| 872 | Ga0207657_10028294 | |||
| 873 | Ga0207649_10014932 | |||
| 874 | Ga0207659_10046524 | |||
| 875 | Ga0207659_10301308 | |||
| 876 | Ga0207700_10586133 | |||
| 877 | Ga0207664_10021367 | |||
| 878 | Ga0207644_10510796 | |||
| 879 | Ga0207706_10000234 | |||
| 880 | Ga0207686_10048613 | |||
| 881 | Ga0207709_10005243 | |||
| 882 | Ga0207709_10080993 | |||
| 883 | Ga0207670_10006243 | |||
| 884 | Ga0207670_10242111 | |||
| 885 | Ga0207670_10281134 | |||
| 886 | Ga0207669_10021994 | |||
| 887 | Ga0207669_10076727 | |||
| 888 | Ga0207704_10071758 | |||
| 889 | Ga0207665_10000120 | |||
| 890 | Ga0207691_10000538 | |||
| 891 | Ga0207691_10003814 | |||
| 892 | Ga0207691_10279201 | |||
| 893 | Ga0207711_10022999 | |||
| 894 | Ga0207711_10033799 | |||
| 895 | Ga0207711_10315215 | |||
| 896 | Ga0207689_10171134 | |||
| 897 | Ga0207689_10281033 | |||
| 898 | Ga0207661_10071414 | |||
| 899 | Ga0207679_10054450 | |||
| 900 | Ga0207679_10345641 | |||
| 901 | Ga0207667_10412255 | |||
| 902 | Ga0207651_10105171 | |||
| 903 | Ga0207712_10012365 | |||
| 904 | Ga0207712_10024591 | |||
| 905 | Ga0207668_10016635 | |||
| 906 | Ga0207640_10337269 | |||
| 907 | Ga0207658_10129054 | |||
| 908 | Ga0207677_10370260 | |||
| 909 | Ga0207703_10067186 | |||
| 910 | Ga0207703_10570444 | |||
| 911 | Ga0207639_10116536 | |||
| 912 | Ga0207678_10000048 | |||
| 913 | Ga0207678_10010558 | |||
| 914 | Ga0207678_10048274 | |||
| 915 | Ga0207708_10000443 | |||
| 916 | Ga0207708_10001294 | |||
| 917 | Ga0207708_10022951 | |||
| 918 | Ga0207708_10111050 | |||
| 919 | Ga0207702_10100263 | |||
| 920 | Ga0207648_10000681 | |||
| 921 | Ga0207648_10071283 | |||
| 922 | Ga0207648_10083711 | |||
| 923 | Ga0207648_10194894 | |||
| 924 | Ga0207676_10107867 | |||
| 925 | Ga0207676_10463699 | |||
| 926 | Ga0207674_10003550 | |||
| 927 | Ga0207675_100000155 | |||
| 928 | Ga0207675_100003526 | |||
| 929 | Ga0207675_100013005 | |||
| 930 | Ga0207675_100072839 | |||
| 931 | Ga0207683_10001544 | |||
| 932 | Ga0207683_10001926 | |||
| 933 | Ga0207683_10132007 | |||
| 934 | Ga0207683_10152917 | |||
| 935 | Ga0207428_10010697 | |||
| 936 | Ga0207428_10034083 | |||
| 937 | Ga0268266_10021468 | |||
| 938 | Ga0268266_10408782 | |||
| 939 | Ga0268265_10058582 | |||
| 940 | Ga0268265_10102582 | |||
| 941 | Ga0268265_10331304 | |||
| 942 | Ga0268265_10437715 | |||
| 943 | Ga0268264_10004457 | |||
| 944 | Ga0268264_10188929 | |||
| 945 | Ga0316575_10037680 | |||
| 946 | Ga0316575_10044653 | |||
| 947 | Ga0316579_10000697 | |||
| 948 | Ga0316576_10116085 | |||
| 949 | Ga0316578_10033720 | |||
| 950 | Ga0316577_10024803 | |||
| 951 | Ga0316583_10004109 | |||
| 952 | Ga0316585_10009688 | |||
| 953 | Ga0316580_10023464 | |||
| 954 | Ga0316593_10005717 | |||
| 955 | Ga0307510_10061970 | |||
| 956 | Ga0316596_1016823 | |||
| 957 | Ga0373944_0052719 | |||
| 958 | Ga0373939_0057411 | |||
| 959 | Ga0373945_0019259 | |||
| 960 | Ga0373960_0032485 | |||
| 961 | Ga0373943_0028799 | |||
| 962 | Ga0373946_0050870 | |||
| 963 | Ga0373942_0067045 | |||
| 964 | Ga0373962_0013532 | |||
| 965 | Ga0316574_0119238 | |||
| 966 | Ga0373931_0027767 | |||
| 967 | Ga0373931_0056976 | |||
| 968 | Ga0373931_0408401 | |||
| 969 | Ga0373935_0137336 | |||
| 970 | Ga0373927_0058203 | |||
| 971 | Ga0373947_0151591 | |||
| 972 | Ga0373937_0059314 | |||
| 973 | Ga0316582_0007422 | |||
| 974 | Ga0316584_0002253 | |||
| 975 | Ga0395899_0198641 | |||
| 976 | Ga0395900_0081331 | |||
| 977 | Ga0395898_0029163 | |||
| 978 | Ga0395898_0040038 | |||
| 979 | Ga0395905_0007320 | |||
| 980 | Ga0395901_0003430 | |||
| 981 | Ga0395901_0172397 | |||
| 982 | Ga0439456_039272 | |||
| 983 | Ga0451577_0408383 | |||
| 984 | Ga0439440_0035063 | |||
| 985 | Ga0453684_0048131 | |||
| 986 | Ga0451576_0139773 | |||
| 987 | Ga0495617_092894 | |||
| 988 | Ga0495603_0000028 | |||
| 989 | Ga0495603_0114168 | |||
| 990 | Ga0495629_0068903 | |||
| 991 | Ga0495641_0077609 | |||
| 992 | Ga0495641_0104816 | |||
| 993 | Ga0495580_0008815 | |||
| 994 | Ga0495580_0146151 | |||
| 995 | Ga0495582_0005654 | |||
| 996 | Ga0495605_0052188 | |||
| 997 | Ga0495605_0186505 | |||
| 998 | Ga0495584_0051127 | |||
| 999 | Ga0495594_0000900 | |||
| 1000 | Ga0495607_0060793 | |||
| 1001 | Ga0495608_0257980 | |||
| 1002 | Ga0495631_0067051 | |||
| 1003 | Ga0495637_0142900 | |||
| 1004 | Ga0495644_0067453 | |||
| 1005 | Ga0495644_0114446 | |||
| 1006 | Ga0495642_0009571 | |||
| 1007 | Ga0495609_0022992 | |||
| 1008 | Ga0495622_0008830 | |||
| 1009 | Ga0495656_0002027 | |||
| 1010 | Ga0495656_0014054 | |||
| 1011 | Ga0495656_0031477 | |||
| 1012 | Ga0495634_0051035 | |||
| 1013 | Ga0495659_0009778 | |||
| 1014 | Ga0495588_0002098 | |||
| 1015 | Ga0495658_0006562 | |||
| 1016 | Ga0495613_0002754 | |||
| 1017 | Ga0495613_0090020 | |||
| 1018 | Ga0495589_0019560 | |||
| 1019 | Ga0495589_0144228 | |||
| 1020 | Ga0495581_0023992 | |||
| 1021 | Ga0495581_0065798 | |||
| 1022 | Ga0495636_0050513 | |||
| 1023 | Ga0495676_0020922 | |||
| 1024 | Ga0495676_0035644 | |||
| 1025 | Ga0495680_0059143 | |||
| 1026 | Ga0495685_051351 | |||
| 1027 | Ga0495593_0001079 | |||
| 1028 | Ga0495614_0010537 | |||
| 1029 | Ga0495615_0070242 | |||
| 1030 | Ga0495626_0064139 | |||
| 1031 | Ga0496100_0007013 | |||
| 1032 | Ga0496100_0020956 | |||
| 1033 | Ga0496100_0041031 | |||
| 1034 | Ga0496101_0027362 | |||
| 1035 | Ga0496101_0086149 | |||
| 1036 | Ga0496101_0101264 | |||
| 1037 | Ga0496101_0364966 | |||
| 1038 | Ga0496102_0012313 | |||
| 1039 | Ga0496102_0034877 | |||
| 1040 | Ga0496102_0045439 | |||
| 1041 | Ga0496102_0087250 | |||
| 1042 | Ga0496102_0104593 | |||
| 1043 | Ga0496102_0660238 | |||
| 1044 | Ga0496103_0215899 | |||
| 1045 | Ga0496103_0366320 | |||
| 1046 | Ga0496104_0012228 | |||
| 1047 | Ga0496104_0095526 | |||
| 1048 | Ga0496104_0175942 | |||
| 1049 | Ga0496104_0198130 | |||
| 1050 | Ga0496105_0021840 | |||
| 1051 | Ga0496105_0162954 | |||
| 1052 | Ga0496106_0016098 | |||
| 1053 | Ga0496106_0174409 | |||
| 1054 | Ga0496106_0405699 | |||
| 1055 | Ga0496107_0013048 | |||
| 1056 | Ga0496107_0044718 | |||
| 1057 | Ga0496107_0063231 | |||
| 1058 | Ga0496107_0081533 | |||
| 1059 | Ga0496107_0391877 | |||
| 1060 | Ga0496108_0031203 | |||
| 1061 | Ga0496108_0089032 | |||
| 1062 | Ga0496108_0236133 | |||
| 1063 | Ga0496108_0290081 | |||
| 1064 | Ga0496108_0403902 | |||
| 1065 | Ga0496108_0542916 | |||
| 1066 | Ga0496109_0042219 | |||
| 1067 | Ga0496109_0059564 | |||
| 1068 | Ga0496109_0474261 | |||
| 1069 | Ga0496110_0015786 | |||
| 1070 | Ga0496110_0373935 | |||
| 1071 | Ga0496111_0016669 | |||
| 1072 | Ga0496111_0265408 | |||
| 1073 | Ga0496111_0276173 | |||
| 1074 | Ga0496112_0004454 | |||
| 1075 | Ga0496112_0024394 | |||
| 1076 | Ga0496112_0160399 | |||
| 1077 | Ga0496112_0172587 | |||
| 1078 | Ga0496113_0034188 | |||
| 1079 | Ga0496113_0046446 | |||
| 1080 | Ga0496113_0082518 | |||
| 1081 | Ga0496113_0113128 | |||
| 1082 | Ga0496113_0294180 | |||
| 1083 | Ga0496114_0012064 | |||
| 1084 | Ga0496114_0051543 | |||
| 1085 | Ga0496114_0163699 | |||
| 1086 | Ga0496114_0341783 | |||
| 1087 | Ga0496115_0081918 | |||
| 1088 | Ga0496115_0098949 | |||
| 1089 | Ga0496115_0158225 | |||
| 1090 | Ga0496115_0185300 | |||
| 1091 | Ga0496115_0194637 | |||
| 1092 | Ga0496118_0114797 | |||
| 1093 | Ga0501031_0078963 | |||
| 1094 | Ga0501031_0104426 | |||
| 1095 | Ga0501031_0209401 | |||
| 1096 | Ga0501032_0078762 | |||
| 1097 | Ga0501033_0027148 | |||
| 1098 | Ga0501033_0136315 | |||
| 1099 | Ga0501033_0264168 | |||
| 1100 | Ga0501034_0018091 | |||
| 1101 | Ga0501034_0032293 | |||
| 1102 | Ga0501036_0117893 | |||
| 1103 | Ga0501036_0147416 | |||
| 1104 | Ga0501036_0369343 | |||
| 1105 | Ga0501037_0039464 | |||
| 1106 | Ga0501037_0202390 | |||
| 1107 | Ga0501037_0244730 | |||
| 1108 | Ga0501038_0015555 | |||
| 1109 | Ga0501038_0433691 | |||
| 1110 | Ga0501039_0014908 | |||
| 1111 | Ga0501039_0053034 | |||
| 1112 | Ga0501039_0074400 | |||
| 1113 | Ga0501039_0462300 | |||
| 1114 | Ga0501039_0777234 | |||
| 1115 | Ga0501040_0025878 | |||
| 1116 | Ga0501040_0028816 | |||
| 1117 | Ga0501040_0044240 | |||
| 1118 | Ga0501040_0046331 | |||
| 1119 | Ga0501041_0016541 | |||
| 1120 | Ga0501041_0039523 | |||
| 1121 | Ga0501041_0107502 | |||
| 1122 | Ga0501041_0114481 | |||
| 1123 | Ga0501042_0009014 | |||
| 1124 | Ga0501042_0022837 | |||
| 1125 | Ga0501042_0039292 | |||
| 1126 | Ga0501042_0081204 | |||
| 1127 | Ga0501042_0155166 | |||
| 1128 | Ga0501043_0241924 | |||
| 1129 | Ga0501046_0010629 | |||
| 1130 | Ga0501046_0091260 | |||
| 1131 | Ga0501046_0171727 | |||
| 1132 | Ga0501048_0021562 | |||
| 1133 | Ga0501048_0088928 | |||
| 1134 | Ga0501048_0159217 | |||
| 1135 | Ga0501067_0015608 | |||
| 1136 | Ga0501067_0052455 | |||
| 1137 | Ga0501067_0083470 | |||
| 1138 | Ga0501068_0017455 | |||
| 1139 | Ga0501068_0020130 | |||
| 1140 | Ga0501070_0107148 | |||
| 1141 | Ga0501071_0014148 | |||
| 1142 | Ga0501071_0037992 | |||
| 1143 | Ga0501071_0062028 | |||
| 1144 | Ga0501071_0144381 | |||
| 1145 | Ga0501072_0136664 | |||
| 1146 | Ga0501072_0151743 | |||
| 1147 | Ga0501073_0042621 | |||
| 1148 | Ga0501074_0022576 | |||
| 1149 | Ga0501074_0101801 | |||
| 1150 | Ga0501074_0207014 | |||
| 1151 | Ga0501074_0224205 | |||
| 1152 | Ga0501075_0019115 | |||
| 1153 | Ga0501075_0023449 | |||
| 1154 | Ga0501075_0031641 | |||
| 1155 | Ga0501075_0066250 | |||
| 1156 | Ga0501075_0078341 | |||
| 1157 | Ga0501075_0094603 | |||
| 1158 | Ga0501075_0325394 | |||
| 1159 | Ga0501076_0007328 | |||
| 1160 | Ga0501076_0035210 | |||
| 1161 | Ga0501076_0039846 | |||
| 1162 | Ga0501076_0084048 | |||
| 1163 | Ga0501076_0126464 | |||
| 1164 | Ga0501076_0161591 | |||
| 1165 | Ga0501076_0247191 | |||
| 1166 | Ga0501077_0024477 | |||
| 1167 | Ga0501077_0052105 | |||
| 1168 | Ga0501077_0053245 | |||
| 1169 | Ga0501077_0266732 | |||
| 1170 | Ga0501079_0012782 | |||
| 1171 | Ga0501079_0046433 | |||
| 1172 | Ga0501079_0172126 | |||
| 1173 | Ga0501080_0063684 | |||
| 1174 | Ga0501080_0156704 | |||
| 1175 | Ga0501080_0278755 | |||
| 1176 | Ga0501081_0015228 | |||
| 1177 | Ga0501081_0016073 | |||
| 1178 | Ga0501081_0016834 | |||
| 1179 | Ga0501081_0034371 | |||
| 1180 | Ga0501081_0147869 | |||
| 1181 | Ga0501083_0085039 | |||
| 1182 | Ga0501083_0207967 | |||
| 1183 | Ga0501083_0246775 | |||
| 1184 | Ga0501044_0160661 | |||
| 1185 | Ga0501044_0299911 | |||
| 1186 | Ga0501045_0006758 | |||
| 1187 | Ga0501045_0010321 | |||
| 1188 | Ga0501045_0045547 | |||
| 1189 | Ga0501045_0117449 | |||
| 1190 | nmdc:mga05p37_221598_c1 | |||
| 1191 | nmdc:mga09592_91655_c1 | |||
| 1192 | nmdc:mga0qj67_323143_c1 | |||
| 1193 | nmdc:mga06r32_227197_c1 | |||
| 1194 | nmdc:mga06r32_22855_c1 | |||
| 1195 | nmdc:mga06r32_67718_c1 | |||
| 1196 | nmdc:mga08y16_268913_c1 | |||
| 1197 | nmdc:mga08y16_29814_c1 | |||
| 1198 | nmdc:mga08y16_345_c1 | |||
| 1199 | nmdc:mga08y16_366265_c1 | |||
| 1200 | nmdc:mga08y16_94158_c1 | |||
| 1201 | nmdc:mga0n895_106393_c1 | |||
| 1202 | nmdc:mga0n895_18214_c1 | |||
| 1203 | nmdc:mga0n895_31259_c1 | |||
| 1204 | nmdc:mga0n895_46096_c1 | |||
| 1205 | nmdc:mga0rr50_37768_c1 | |||
| 1206 | nmdc:mga0rr50_5898_c1 | |||
| 1207 | nmdc:mga0a205_15555_c1 | |||
| 1208 | nmdc:mga0a205_229469_c1 | |||
| 1209 | Ga0495601_0006873 | |||
| 1210 | Ga0495601_0101540 | |||
| 1211 | Ga0495612_0012370 | |||
| 1212 | Ga0495655_0000198 | |||
| 1213 | Ga0495655_0030465 | |||
| 1214 | Ga0495619_0032696 | |||
| 1215 | Ga0500593_000184 | |||
| 1216 | Ga0500618_002767 | |||
| 1217 | Ga0500568_0000004 | |||
| 1218 | Ga0501084_0017740 | |||
| 1219 | Ga0501084_0037100 | |||
| 1220 | Ga0501084_0100692 | |||
| 1221 | Ga0501084_0188371 | |||
| 1222 | Ga0501084_0598677 | |||
| 1223 | Ga0501082_0053657 | |||
| 1224 | Ga0501082_0053765 | |||
| 1225 | Ga0501082_0070735 | |||
| 1226 | Ga0501082_0140581 | |||
| 1227 | Ga0501082_0223844 | |||
| 1228 | Ga0501082_0224719 | |||
| 1229 | Ga0530510_0007363 | |||
| 1230 | Ga0530510_0012630 | |||
| 1231 | Ga0530510_0015107 | |||
| 1232 | Ga0530510_0086988 | |||
| 1233 | Ga0530510_0173084 | |||
| 1234 | Ga0530510_0199947 | |||
| 1235 | 2738746814 | |||
| 1236 | 2739356044 | |||
| 1237 | 2776262250 | |||
| 1238 | 2829747445 | |||
| 1239 | 2842695233 | |||
| 1240 | 2842701400 | |||
| 1241 | 2861692346 | |||
| 1242 | 2891090556 | |||
| 1243 | 2909046577 | |||
| 1244 | 3003670358 | |||
| 1245 | 641643264 | |||
| 1246 | 643602187 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF10418
DHODB_Fe-S_bind
Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B
271
308
0.94
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4b2o-assembly1.cif.gz_D | crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. | 0.9773 | 1 | 260 |
| 2cv9-assembly1.cif.gz_A | crystal structure of a hypothetical protein from thermus thermophilus hb8 | 0.96 | 1 | 262 |
| 1t70-assembly3.cif.gz_E | crystal structure of a novel phosphatase from deinococcus radiodurans | 0.9576 | 1 | 262 |
| 2cv9-assembly1.cif.gz_A | crystal structure of a hypothetical protein from thermus thermophilus hb8 | 0.9563 | 1 | 262 |
| 1t70-assembly3.cif.gz_E | crystal structure of a novel phosphatase from deinococcus radiodurans | 0.9539 | 1 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4b2oD00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9773 | 1 | 260 | 3.60.21.10 |
| 2z06B00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9649 | 1 | 262 | 3.60.21.10 |
| 2z06B00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9612 | 1 | 262 | 3.60.21.10 |
| 4b2oD00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9482 | 1 | 260 | 3.60.21.10 |
| 1t71A00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8769 | 1 | 274 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A434NV55-F1-model_v4 | Metallophosphoesterase | 1.002 | 1 | 59 |
GO:0004113
|
| AF-A0A530R4K1-F1-model_v4 | Metallophosphoesterase | 1.001 | 1 | 122 |
GO:0004113
|
| AF-A0A3D2P519-F1-model_v4 | Metallophosphoesterase | 0.9991 | 1 | 63 |
GO:0004113
|
| AF-A0A3S1QVR6-F1-model_v4 | Metallophosphoesterase | 0.998 | 1 | 176 |
GO:0004113
|
| AF-A0A435NMD2-F1-model_v4 | deleted | 0.9979 | 1 | 90 |
|