F470189

General Info

Members Datasets Scaffolds Average Seq Length
623 307 1246 272

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10509897|Ga0105238_105098971
Length 309
Sequence MRVLFLGDLVGRSGRSAVIEALPGLRERYRLDFVVVNGENAAGGFGITETILVELLDAGADVVTTGNHVFDQRETLVYIERYDRLLRPINYPQGTPGKGAGLFKAANGAQVLVINAMGRVFMADLDEPFRAVEKELEACGLKTCADAIIIDFHAEATSEKEAMGFFVDGRASAVIGTHTHVPTADEQILPRGTGYISDVGMCGDFNSVLGMDKDEPLNRFLTKIPSGRYAPALGEATLCAIAIDIDDTTGLARAIAPLRIGRRPGVQVSMEREMACGLGACLGCVVETRRGMIASCVQGPIFDLDEIVW

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
162 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
163 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
164 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
165 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
166 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
167 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
168 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
169 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
180 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
187 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
210 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
211 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
229 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
230 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
291 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
292 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
296 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
297 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
298 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
299 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
300 2842694124 Methylopila sp. R-72369 Isolate Unclassified
301 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
302 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
303 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
304 2909042592 Labrys sp. LIt4 Isolate Nodule
305 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
306 641522639 Methylobacterium sp. 4-46 Isolate Nodule
307 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 0.32
Isolates 1.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0.48
Rhizoplane 9.79
Rhizosphere 87.8
Stem 0
Stem Tuber 0
Unclassified 5.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10509897 3300009551 Bacteria 1204
2 JGI24743J22301_10004620 3300001991 Bacteria 2254
3 JGI24738J21930_10019885 3300002075 Bacteria 1398
4 JGI24744J21845_10005120 3300002077 Unclassified 2713
5 JGI24751J29686_10009424 3300002459 Bacteria 2006
6 Ga0070676_10007398 3300005328 Bacteria 5893
7 Ga0070683_100153210 3300005329 Bacteria 2185
8 Ga0070690_100027821 3300005330 Bacteria 3498
9 Ga0070670_100001190 3300005331 Bacteria 20633
10 Ga0068869_100375778 3300005334 Bacteria 1164
11 Ga0070666_10003012 3300005335 Bacteria 10216
12 Ga0070680_100001970 3300005336 Bacteria 15109
13 Ga0070682_100003034 3300005337 Bacteria 9309
14 Ga0068868_100000904 3300005338 Bacteria 20173
15 Ga0068868_100035881 3300005338 Unclassified 3835
16 Ga0068868_100177986 3300005338 Bacteria 1763
17 Ga0070660_100001178 3300005339 Bacteria 17696
18 Ga0070660_100029003 3300005339 Unclassified 4144
19 Ga0070689_100004127 3300005340 Bacteria 9782
20 Ga0070689_100036702 3300005340 Bacteria 3748
21 Ga0070689_100169742 3300005340 Bacteria 1767
22 Ga0070691_10000155 3300005341 Bacteria 22187
23 Ga0070691_10151131 3300005341 Bacteria 1190
24 Ga0070687_100050098 3300005343 Bacteria 2155
25 Ga0070692_10003545 3300005345 Bacteria 6348
26 Ga0070692_10036402 3300005345 Bacteria 2497
27 Ga0070668_100000692 3300005347 Bacteria 22968
28 Ga0070675_100012884 3300005354 Bacteria 6563
29 Ga0070675_100371356 3300005354 Bacteria 1272
30 Ga0070671_100054784 3300005355 Bacteria 3316
31 Ga0070671_100148692 3300005355 Unclassified 1978
32 Ga0070673_100000626 3300005364 Bacteria 19353
33 Ga0070688_100000139 3300005365 Bacteria 39353
34 Ga0070688_100008062 3300005365 Bacteria 5704
35 Ga0070688_100119802 3300005365 Bacteria 1761
36 Ga0070688_100194001 3300005365 Bacteria 1417
37 Ga0070659_100048145 3300005366 Unclassified 3348
38 Ga0070667_100017103 3300005367 Bacteria 6008
39 Ga0070709_10001924 3300005434 Bacteria 11284
40 Ga0070709_10011161 3300005434 Bacteria 4997
41 Ga0070709_10210638 3300005434 Bacteria 1381
42 Ga0070714_100016853 3300005435 Bacteria 5909
43 Ga0070714_100220502 3300005435 Bacteria 1743
44 Ga0070713_100020215 3300005436 Bacteria 5100
45 Ga0070713_100684072 3300005436 Bacteria 979
46 Ga0070701_10001747 3300005438 Bacteria 8179
47 Ga0070701_10033438 3300005438 Bacteria 2569
48 Ga0070701_10048981 3300005438 Bacteria 2183
49 Ga0070711_100033148 3300005439 Bacteria 3438
50 Ga0070711_100090723 3300005439 Bacteria 2201
51 Ga0070705_100000298 3300005440 Bacteria 29561
52 Ga0070705_100063514 3300005440 Bacteria 2203
53 Ga0070705_100342943 3300005440 Bacteria 1086
54 Ga0070700_100000648 3300005441 Bacteria 17205
55 Ga0070700_100003435 3300005441 Bacteria 8168
56 Ga0070700_100252940 3300005441 Bacteria 1265
57 Ga0070694_100004154 3300005444 Bacteria 8699
58 Ga0070694_100032137 3300005444 Unclassified 3446
59 Ga0070663_100003945 3300005455 Bacteria 8650
60 Ga0070663_100041642 3300005455 Bacteria 3223
61 Ga0070678_100049207 3300005456 Unclassified 3040
62 Ga0070678_100089920 3300005456 Bacteria 2351
63 Ga0070678_100112125 3300005456 Bacteria 2135
64 Ga0070662_100001411 3300005457 Bacteria 14824
65 Ga0070681_10242960 3300005458 Bacteria 1714
66 Ga0070685_10002499 3300005466 Bacteria 9438
67 Ga0070685_10012478 3300005466 Bacteria 4465
68 Ga0070698_100460349 3300005471 Bacteria 1208
69 Ga0070679_100029421 3300005530 Bacteria 5420
70 Ga0070684_100003622 3300005535 Bacteria 11630
71 Ga0070697_100030376 3300005536 Bacteria 4340
72 Ga0070697_100455915 3300005536 Bacteria 1114
73 Ga0068853_100116956 3300005539 Bacteria 2374
74 Ga0068853_100128698 3300005539 Bacteria 2264
75 Ga0070672_100004918 3300005543 Bacteria 8793
76 Ga0070672_100118589 3300005543 Bacteria 2164
77 Ga0070686_100000266 3300005544 Bacteria 35675
78 Ga0070686_100005291 3300005544 Bacteria 7133
79 Ga0070695_100047000 3300005545 Bacteria 2755
80 Ga0070696_100000333 3300005546 Bacteria 28647
81 Ga0070696_100113255 3300005546 Bacteria 1955
82 Ga0070696_100141085 3300005546 Bacteria 1761
83 Ga0070696_100187266 3300005546 Bacteria 1539
84 Ga0070693_100021448 3300005547 Bacteria 3422
85 Ga0070665_100009279 3300005548 Bacteria 9959
86 Ga0070665_100199816 3300005548 Bacteria 2000
87 Ga0070704_100201570 3300005549 Bacteria 1606
88 Ga0070704_100266045 3300005549 Bacteria 1414
89 Ga0068855_100007108 3300005563 Bacteria 13578
90 Ga0070664_100021593 3300005564 Bacteria 5309
91 Ga0070664_100154414 3300005564 Bacteria 2028
92 Ga0068857_100121149 3300005577 Bacteria 2355
93 Ga0068854_100000885 3300005578 Bacteria 18009
94 Ga0068856_100034039 3300005614 Bacteria 4990
95 Ga0070702_100000139 3300005615 Bacteria 22443
96 Ga0070702_100126360 3300005615 Bacteria 1608
97 Ga0068852_100142268 3300005616 Bacteria 2221
98 Ga0068859_100039960 3300005617 Unclassified 4708
99 Ga0068859_100041947 3300005617 Bacteria 4596
100 Ga0068859_100122480 3300005617 Bacteria 2668
101 Ga0068859_100288891 3300005617 Bacteria 1733
102 Ga0068866_10005610 3300005718 Bacteria 5194
103 Ga0068866_10017689 3300005718 Bacteria 3210
104 Ga0068866_10020419 3300005718 Bacteria 3035
105 Ga0068861_100002618 3300005719 Bacteria 11760
106 Ga0068861_100108096 3300005719 Bacteria 2225
107 Ga0068861_100170534 3300005719 Bacteria 1803
108 Ga0068863_100000834 3300005841 Bacteria 30888
109 Ga0068858_100003998 3300005842 Bacteria 14550
110 Ga0068858_100149280 3300005842 Bacteria 2197
111 Ga0068858_100415811 3300005842 Bacteria 1293
112 Ga0068860_100002133 3300005843 Bacteria 20873
113 Ga0068860_100206969 3300005843 Bacteria 1903
114 Ga0068860_100553610 3300005843 Bacteria 1153
115 Ga0068862_100030783 3300005844 Bacteria 4524
116 Ga0068862_100164125 3300005844 Bacteria 1985
117 Ga0068862_100349959 3300005844 Bacteria 1371
118 Ga0081455_10002556 3300005937 Bacteria 21604
119 Ga0081455_10003325 3300005937 Bacteria 18556
120 Ga0081455_10019283 3300005937 Bacteria 6456
121 Ga0070715_10000276 3300006163 Bacteria 12446
122 Ga0070715_10005604 3300006163 Bacteria 4200
123 Ga0070715_10128150 3300006163 Bacteria 1218
124 Ga0070716_100004597 3300006173 Bacteria 6618
125 Ga0070712_100000828 3300006175 Bacteria 18403
126 Ga0070712_100005886 3300006175 Bacteria 7591
127 Ga0075369_10051374 3300006186 Bacteria 1784
128 Ga0097621_100010851 3300006237 Bacteria 6685
129 Ga0068871_100014394 3300006358 Bacteria 5899
130 Ga0068871_100117958 3300006358 Bacteria 2239
131 Ga0068871_100217136 3300006358 Bacteria 1656
132 Ga0075428_100011583 3300006844 Bacteria 9812
133 Ga0075428_100070251 3300006844 Unclassified 3828
134 Ga0075428_100086167 3300006844 Bacteria 3426
135 Ga0075431_100006991 3300006847 Bacteria 11220
136 Ga0075431_100055379 3300006847 Unclassified 4090
137 Ga0075433_10256043 3300006852 Bacteria 1552
138 Ga0075433_10366430 3300006852 Bacteria 1272
139 Ga0075434_100003281 3300006871 Bacteria 14465
140 Ga0075434_100041932 3300006871 Bacteria 4536
141 Ga0075434_100143951 3300006871 Bacteria 2404
142 Ga0075434_100171550 3300006871 Bacteria 2189
143 Ga0075429_100107281 3300006880 Bacteria 2441
144 Ga0068865_100056168 3300006881 Bacteria 2742
145 Ga0068865_100115561 3300006881 Bacteria 1986
146 Ga0075436_100218020 3300006914 Bacteria 1354
147 Ga0097620_100039958 3300006931 Unclassified 4708
148 Ga0097620_100041946 3300006931 Bacteria 4596
149 Ga0097620_100122480 3300006931 Bacteria 2668
150 Ga0097620_100288884 3300006931 Bacteria 1733
151 Ga0075435_100019751 3300007076 Bacteria 5153
152 Ga0075435_100041656 3300007076 Bacteria 3672
153 Ga0075435_100096879 3300007076 Bacteria 2441
154 Ga0111539_10001059 3300009094 Bacteria 36230
155 Ga0111539_10052477 3300009094 Bacteria 4854
156 Ga0111539_10181577 3300009094 Bacteria 2457
157 Ga0111539_10428883 3300009094 Unclassified 1540
158 Ga0105245_10000795 3300009098 Bacteria 28669
159 Ga0105245_10225479 3300009098 Bacteria 1810
160 Ga0105247_10002860 3300009101 Bacteria 11507
161 Ga0105247_10006261 3300009101 Bacteria 7378
162 Ga0114129_10215849 3300009147 Bacteria 2591
163 Ga0114129_10287804 3300009147 Bacteria 2194
164 Ga0105243_10000766 3300009148 Bacteria 30817
165 Ga0105243_10229036 3300009148 Bacteria 1647
166 Ga0105241_10003139 3300009174 Bacteria 12289
167 Ga0105241_10040659 3300009174 Unclassified 3511
168 Ga0105241_10359087 3300009174 Bacteria 1267
169 Ga0105242_10000793 3300009176 Bacteria 24471
170 Ga0105242_10030834 3300009176 Unclassified 4283
171 Ga0105248_10004639 3300009177 Bacteria 15200
172 Ga0105248_10030555 3300009177 Bacteria 6017
173 Ga0105248_10046620 3300009177 Bacteria 4858
174 Ga0105237_10002479 3300009545 Bacteria 22904
175 Ga0105237_10040217 3300009545 Bacteria 4716
176 Ga0105237_10168181 3300009545 Bacteria 2192
177 Ga0105238_10092838 3300009551 Unclassified 3006
178 Ga0105249_10007009 3300009553 Bacteria 9835
179 Ga0105249_10056676 3300009553 Unclassified 3588
180 Ga0105249_10069542 3300009553 Bacteria 3249
181 Ga0105249_10501314 3300009553 Bacteria 1259
182 Ga0105239_10182836 3300010375 Bacteria 2345
183 Ga0105246_10010014 3300011119 Bacteria 5847
184 Ga0105246_10055644 3300011119 Bacteria 2731
185 Ga0105246_10110680 3300011119 Bacteria 2017
186 Ga0157371_10083949 3300013102 Bacteria 2255
187 Ga0157369_10047944 3300013105 Bacteria 4637
188 Ga0157378_10013602 3300013297 Bacteria 7116
189 Ga0157378_10100131 3300013297 Bacteria 2645
190 Ga0157378_10189161 3300013297 Bacteria 1941
191 Ga0163162_10001264 3300013306 Bacteria 23644
192 Ga0163162_10002935 3300013306 Bacteria 16269
193 Ga0163162_10148700 3300013306 Bacteria 2459
194 Ga0163162_10241485 3300013306 Bacteria 1937
195 Ga0157375_10014913 3300013308 Bacteria 6948
196 Ga0157375_10023817 3300013308 Bacteria 5657
197 Ga0157375_10151038 3300013308 Bacteria 2458
198 Ga0163163_10003201 3300014325 Bacteria 13874
199 Ga0163163_10128921 3300014325 Bacteria 2569
200 Ga0163163_10262066 3300014325 Bacteria 1780
201 Ga0157380_10001853 3300014326 Bacteria 13986
202 Ga0157380_10011619 3300014326 Bacteria 6364
203 Ga0157380_10051410 3300014326 Bacteria 3259
204 Ga0157380_10354977 3300014326 Bacteria 1373
205 Ga0157377_10000274 3300014745 Bacteria 25093
206 Ga0157377_10001978 3300014745 Bacteria 8968
207 Ga0157377_10179369 3300014745 Bacteria 1331
208 Ga0157379_10008173 3300014968 Bacteria 9086
209 Ga0157379_10016482 3300014968 Bacteria 6499
210 Ga0157379_10247599 3300014968 Bacteria 1617
211 Ga0157376_10000272 3300014969 Bacteria 35217
212 Ga0157376_10006162 3300014969 Bacteria 8446
213 Ga0157376_10023018 3300014969 Bacteria 4868
214 Ga0157376_10027829 3300014969 Bacteria 4486
215 Ga0157376_10526969 3300014969 Unclassified 1165
216 Ga0163161_10002256 3300017792 Bacteria 13831
217 Ga0163161_10008969 3300017792 Bacteria 6917
218 Ga0163161_10154784 3300017792 Bacteria 1744
219 Ga0207697_10063053 3300025315 Bacteria 1544
220 Ga0207692_10037573 3300025898 Bacteria 2369
221 Ga0207642_10038793 3300025899 Bacteria 2064
222 Ga0207642_10143347 3300025899 Bacteria 1262
223 Ga0207710_10012112 3300025900 Bacteria 3624
224 Ga0207710_10036307 3300025900 Bacteria 2172
225 Ga0207688_10013246 3300025901 Bacteria 4481
226 Ga0207680_10124970 3300025903 Bacteria 1687
227 Ga0207680_10164964 3300025903 Bacteria 1488
228 Ga0207647_10001875 3300025904 Bacteria 16096
229 Ga0207647_10109192 3300025904 Bacteria 1636
230 Ga0207685_10005607 3300025905 Bacteria 3334
231 Ga0207685_10181619 3300025905 Bacteria 976
232 Ga0207699_10001015 3300025906 Bacteria 13296
233 Ga0207699_10015803 3300025906 Unclassified 3932
234 Ga0207699_10053049 3300025906 Bacteria 2403
235 Ga0207645_10004533 3300025907 Bacteria 10262
236 Ga0207684_10291259 3300025910 Bacteria 1408
237 Ga0207654_10002679 3300025911 Bacteria 9043
238 Ga0207654_10041668 3300025911 Unclassified 2594
239 Ga0207654_10243472 3300025911 Bacteria 1203
240 Ga0207707_10190317 3300025912 Bacteria 1790
241 Ga0207671_10452200 3300025914 Bacteria 1023
242 Ga0207693_10000607 3300025915 Bacteria 32076
243 Ga0207693_10001496 3300025915 Bacteria 20625
244 Ga0207693_10037181 3300025915 Bacteria 3837
245 Ga0207663_10026018 3300025916 Bacteria 3391
246 Ga0207663_10052628 3300025916 Bacteria 2540
247 Ga0207662_10063512 3300025918 Bacteria 2220
248 Ga0207657_10000086 3300025919 Bacteria 88712
249 Ga0207657_10028294 3300025919 Bacteria 5115
250 Ga0207649_10014932 3300025920 Bacteria 4358
251 Ga0207659_10046524 3300025926 Bacteria 3064
252 Ga0207659_10301308 3300025926 Bacteria 1316
253 Ga0207700_10586133 3300025928 Bacteria 992
254 Ga0207664_10021367 3300025929 Bacteria 4811
255 Ga0207644_10510796 3300025931 Bacteria 992
256 Ga0207706_10000234 3300025933 Bacteria 60759
257 Ga0207686_10048613 3300025934 Bacteria 2628
258 Ga0207709_10005243 3300025935 Bacteria 7374
259 Ga0207709_10080993 3300025935 Bacteria 2092
260 Ga0207670_10006243 3300025936 Bacteria 6600
261 Ga0207670_10242111 3300025936 Bacteria 1390
262 Ga0207670_10281134 3300025936 Bacteria 1297
263 Ga0207669_10021994 3300025937 Bacteria 3379
264 Ga0207669_10076727 3300025937 Bacteria 2122
265 Ga0207704_10071758 3300025938 Bacteria 2198
266 Ga0207665_10000120 3300025939 Bacteria 51773
267 Ga0207691_10000538 3300025940 Bacteria 37878
268 Ga0207691_10003814 3300025940 Bacteria 14633
269 Ga0207691_10279201 3300025940 Bacteria 1437
270 Ga0207711_10022999 3300025941 Bacteria 5217
271 Ga0207711_10033799 3300025941 Bacteria 4329
272 Ga0207711_10315215 3300025941 Bacteria 1444
273 Ga0207689_10171134 3300025942 Bacteria 1790
274 Ga0207689_10281033 3300025942 Bacteria 1378
275 Ga0207661_10071414 3300025944 Bacteria 2837
276 Ga0207679_10054450 3300025945 Bacteria 2945
277 Ga0207679_10345641 3300025945 Bacteria 1295
278 Ga0207667_10412255 3300025949 Bacteria 1375
279 Ga0207651_10105171 3300025960 Bacteria 2105
280 Ga0207712_10012365 3300025961 Bacteria 5453
281 Ga0207712_10024591 3300025961 Bacteria 3991
282 Ga0207668_10016635 3300025972 Bacteria 4594
283 Ga0207640_10337269 3300025981 Bacteria 1206
284 Ga0207658_10129054 3300025986 Bacteria 2028
285 Ga0207677_10370260 3300026023 Bacteria 1206
286 Ga0207703_10067186 3300026035 Bacteria 2950
287 Ga0207703_10570444 3300026035 Bacteria 1068
288 Ga0207639_10116536 3300026041 Bacteria 2187
289 Ga0207678_10000048 3300026067 Bacteria 90920
290 Ga0207678_10010558 3300026067 Bacteria 8113
291 Ga0207678_10048274 3300026067 Bacteria 3680
292 Ga0207708_10000443 3300026075 Bacteria 32270
293 Ga0207708_10001294 3300026075 Bacteria 18819
294 Ga0207708_10022951 3300026075 Bacteria 4713
295 Ga0207708_10111050 3300026075 Bacteria 2128
296 Ga0207702_10100263 3300026078 Bacteria 2554
297 Ga0207648_10000681 3300026089 Bacteria 38041
298 Ga0207648_10071283 3300026089 Bacteria 3028
299 Ga0207648_10083711 3300026089 Bacteria 2782
300 Ga0207648_10194894 3300026089 Bacteria 1796
301 Ga0207676_10107867 3300026095 Bacteria 2323
302 Ga0207676_10463699 3300026095 Bacteria 1197
303 Ga0207674_10003550 3300026116 Bacteria 19032
304 Ga0207675_100000155 3300026118 Bacteria 60380
305 Ga0207675_100003526 3300026118 Bacteria 15259
306 Ga0207675_100013005 3300026118 Bacteria 7769
307 Ga0207675_100072839 3300026118 Bacteria 3213
308 Ga0207683_10001544 3300026121 Bacteria 20756
309 Ga0207683_10001926 3300026121 Bacteria 18374
310 Ga0207683_10132007 3300026121 Bacteria 2247
311 Ga0207683_10152917 3300026121 Bacteria 2083
312 Ga0207428_10010697 3300027907 Bacteria 8183
313 Ga0207428_10034083 3300027907 Bacteria 4176
314 Ga0268266_10021468 3300028379 Bacteria 5500
315 Ga0268266_10408782 3300028379 Bacteria 1284
316 Ga0268265_10058582 3300028380 Bacteria 2942
317 Ga0268265_10102582 3300028380 Bacteria 2314
318 Ga0268265_10331304 3300028380 Bacteria 1383
319 Ga0268265_10437715 3300028380 Bacteria 1218
320 Ga0268264_10004457 3300028381 Bacteria 11942
321 Ga0268264_10188929 3300028381 Bacteria 1876
322 Ga0316575_10037680 3300031665 Bacteria 1905
323 Ga0316575_10044653 3300031665 Bacteria 1758
324 Ga0316579_10000697 3300031691 Bacteria 11453
325 Ga0316576_10116085 3300031727 Bacteria 2008
326 Ga0316578_10033720 3300031728 Bacteria 2935
327 Ga0316577_10024803 3300031733 Bacteria 3334
328 Ga0316583_10004109 3300032133 Bacteria 5171
329 Ga0316585_10009688 3300032137 Bacteria 2817
330 Ga0316580_10023464 3300032139 Bacteria 1905
331 Ga0316593_10005717 3300032168 Bacteria 3307
332 Ga0307510_10061970 3300033180 Bacteria 3827
333 Ga0316596_1016823 3300033541 Bacteria 1834
334 Ga0373944_0052719 3300035089 Bacteria 1286
335 Ga0373939_0057411 3300035114 Bacteria 1228
336 Ga0373945_0019259 3300035116 Bacteria 2329
337 Ga0373960_0032485 3300035121 Bacteria 1466
338 Ga0373943_0028799 3300035170 Bacteria 2620
339 Ga0373946_0050870 3300035171 Bacteria 1732
340 Ga0373942_0067045 3300035207 Bacteria 1040
341 Ga0373962_0013532 3300035242 Bacteria 2068
342 Ga0316574_0119238 3300035398 Bacteria 1693
343 Ga0373931_0027767 3300035691 Bacteria 2891
344 Ga0373931_0056976 3300035691 Bacteria 2095
345 Ga0373931_0408401 3300035691 Bacteria 861
346 Ga0373935_0137336 3300035692 Bacteria 1648
347 Ga0373927_0058203 3300035695 Bacteria 2499
348 Ga0373947_0151591 3300035725 Bacteria 1493
349 Ga0373937_0059314 3300036401 Bacteria 3517
350 Ga0316582_0007422 3300036647 Bacteria 5833
351 Ga0316584_0002253 3300036712 Bacteria 12117
352 Ga0395899_0198641 3300037312 Bacteria 1400
353 Ga0395900_0081331 3300037418 Bacteria 3328
354 Ga0395898_0029163 3300037466 Bacteria 5529
355 Ga0395898_0040038 3300037466 Bacteria 4637
356 Ga0395905_0007320 3300037471 Bacteria 10998
357 Ga0395901_0003430 3300038443 Bacteria 15971
358 Ga0395901_0172397 3300038443 Bacteria 2270
359 Ga0439456_039272 3300042013 Bacteria 1024
360 Ga0451577_0408383 3300042876 Bacteria 1233
361 Ga0439440_0035063 3300042993 Bacteria 1202
362 Ga0453684_0048131 3300044712 Bacteria 5644
363 Ga0451576_0139773 3300045051 Bacteria 2526
364 Ga0495617_092894 3300046452 Bacteria 984
365 Ga0495603_0000028 3300046455 Bacteria 61042
366 Ga0495603_0114168 3300046455 Unclassified 1575
367 Ga0495629_0068903 3300046459 Bacteria 2468
368 Ga0495641_0077609 3300046461 Bacteria 1489
369 Ga0495641_0104816 3300046461 Unclassified 1262
370 Ga0495580_0008815 3300046472 Bacteria 7984
371 Ga0495580_0146151 3300046472 Bacteria 1639
372 Ga0495582_0005654 3300046473 Bacteria 6960
373 Ga0495605_0052188 3300046474 Bacteria 1988
374 Ga0495605_0186505 3300046474 Bacteria 910
375 Ga0495584_0051127 3300046491 Bacteria 2081
376 Ga0495594_0000900 3300046499 Bacteria 15394
377 Ga0495607_0060793 3300046501 Unclassified 2149
378 Ga0495608_0257980 3300046511 Bacteria 1086
379 Ga0495631_0067051 3300046518 Unclassified 1553
380 Ga0495637_0142900 3300046520 Bacteria 907
381 Ga0495644_0067453 3300046523 Unclassified 1344
382 Ga0495644_0114446 3300046523 Bacteria 1024
383 Ga0495642_0009571 3300046528 Unclassified 3708
384 Ga0495609_0022992 3300046538 Unclassified 2869
385 Ga0495622_0008830 3300046557 Bacteria 4667
386 Ga0495656_0002027 3300046615 Bacteria 6671
387 Ga0495656_0014054 3300046615 Bacteria 2994
388 Ga0495656_0031477 3300046615 Bacteria 2152
389 Ga0495634_0051035 3300046642 Bacteria 2776
390 Ga0495659_0009778 3300046664 Bacteria 3069
391 Ga0495588_0002098 3300046674 Bacteria 8555
392 Ga0495658_0006562 3300046683 Bacteria 5715
393 Ga0495613_0002754 3300046689 Bacteria 13202
394 Ga0495613_0090020 3300046689 Bacteria 2223
395 Ga0495589_0019560 3300046794 Unclassified 3468
396 Ga0495589_0144228 3300046794 Bacteria 1139
397 Ga0495581_0023992 3300047315 Bacteria 3534
398 Ga0495581_0065798 3300047315 Bacteria 2096
399 Ga0495636_0050513 3300047318 Bacteria 1741
400 Ga0495676_0020922 3300047321 Bacteria 5728
401 Ga0495676_0035644 3300047321 Bacteria 4160
402 Ga0495680_0059143 3300047322 Bacteria 2960
403 Ga0495685_051351 3300047447 Bacteria 1398
404 Ga0495593_0001079 3300047673 Bacteria 15934
405 Ga0495614_0010537 3300048089 Bacteria 4076
406 Ga0495615_0070242 3300048090 Unclassified 942
407 Ga0495626_0064139 3300048091 Bacteria 1665
408 Ga0496100_0007013 3300048903 Bacteria 6181
409 Ga0496100_0020956 3300048903 Unclassified 3928
410 Ga0496100_0041031 3300048903 Bacteria 2947
411 Ga0496101_0027362 3300048904 Bacteria 3972
412 Ga0496101_0086149 3300048904 Bacteria 2329
413 Ga0496101_0101264 3300048904 Unclassified 2156
414 Ga0496101_0364966 3300048904 Bacteria 1135
415 Ga0496102_0012313 3300048905 Bacteria 7398
416 Ga0496102_0034877 3300048905 Bacteria 4528
417 Ga0496102_0045439 3300048905 Bacteria 3988
418 Ga0496102_0087250 3300048905 Unclassified 2882
419 Ga0496102_0104593 3300048905 Bacteria 2633
420 Ga0496102_0660238 3300048905 Bacteria 969
421 Ga0496103_0215899 3300048906 Unclassified 1233
422 Ga0496103_0366320 3300048906 Bacteria 926
423 Ga0496104_0012228 3300048907 Bacteria 7714
424 Ga0496104_0095526 3300048907 Bacteria 2843
425 Ga0496104_0175942 3300048907 Bacteria 2050
426 Ga0496104_0198130 3300048907 Bacteria 1920
427 Ga0496105_0021840 3300048908 Bacteria 5181
428 Ga0496105_0162954 3300048908 Bacteria 1830
429 Ga0496106_0016098 3300048909 Bacteria 5530
430 Ga0496106_0174409 3300048909 Bacteria 1705
431 Ga0496106_0405699 3300048909 Bacteria 1095
432 Ga0496107_0013048 3300048910 Bacteria 5805
433 Ga0496107_0044718 3300048910 Bacteria 3183
434 Ga0496107_0063231 3300048910 Bacteria 2682
435 Ga0496107_0081533 3300048910 Bacteria 2359
436 Ga0496107_0391877 3300048910 Bacteria 1033
437 Ga0496108_0031203 3300048911 Bacteria 4420
438 Ga0496108_0089032 3300048911 Bacteria 2623
439 Ga0496108_0236133 3300048911 Bacteria 1590
440 Ga0496108_0290081 3300048911 Bacteria 1424
441 Ga0496108_0403902 3300048911 Bacteria 1193
442 Ga0496108_0542916 3300048911 Bacteria 1014
443 Ga0496109_0042219 3300048912 Bacteria 4130
444 Ga0496109_0059564 3300048912 Bacteria 3488
445 Ga0496109_0474261 3300048912 Bacteria 1182
446 Ga0496110_0015786 3300048913 Bacteria 6295
447 Ga0496110_0373935 3300048913 Bacteria 1298
448 Ga0496111_0016669 3300048914 Bacteria 5067
449 Ga0496111_0265408 3300048914 Bacteria 1274
450 Ga0496111_0276173 3300048914 Bacteria 1246
451 Ga0496112_0004454 3300048915 Bacteria 11871
452 Ga0496112_0024394 3300048915 Bacteria 5789
453 Ga0496112_0160399 3300048915 Bacteria 2215
454 Ga0496112_0172587 3300048915 Bacteria 2127
455 Ga0496113_0034188 3300048916 Bacteria 3707
456 Ga0496113_0046446 3300048916 Bacteria 3224
457 Ga0496113_0082518 3300048916 Bacteria 2465
458 Ga0496113_0113128 3300048916 Bacteria 2115
459 Ga0496113_0294180 3300048916 Bacteria 1299
460 Ga0496114_0012064 3300048917 Bacteria 6914
461 Ga0496114_0051543 3300048917 Bacteria 3426
462 Ga0496114_0163699 3300048917 Bacteria 1935
463 Ga0496114_0341783 3300048917 Bacteria 1323
464 Ga0496115_0081918 3300048918 Bacteria 2628
465 Ga0496115_0098949 3300048918 Bacteria 2389
466 Ga0496115_0158225 3300048918 Bacteria 1872
467 Ga0496115_0185300 3300048918 Bacteria 1720
468 Ga0496115_0194637 3300048918 Bacteria 1675
469 Ga0496118_0114797 3300048921 Bacteria 1775
470 Ga0501031_0078963 3300049568 Bacteria 2144
471 Ga0501031_0104426 3300049568 Bacteria 1849
472 Ga0501031_0209401 3300049568 Bacteria 1271
473 Ga0501032_0078762 3300049569 Bacteria 2194
474 Ga0501033_0027148 3300049570 Bacteria 4307
475 Ga0501033_0136315 3300049570 Bacteria 1776
476 Ga0501033_0264168 3300049570 Bacteria 1218
477 Ga0501034_0018091 3300049571 Bacteria 7232
478 Ga0501034_0032293 3300049571 Bacteria 5318
479 Ga0501036_0117893 3300049572 Bacteria 2242
480 Ga0501036_0147416 3300049572 Bacteria 1985
481 Ga0501036_0369343 3300049572 Bacteria 1197
482 Ga0501037_0039464 3300049573 Bacteria 3476
483 Ga0501037_0202390 3300049573 Bacteria 1403
484 Ga0501037_0244730 3300049573 Bacteria 1256
485 Ga0501038_0015555 3300049574 Bacteria 6917
486 Ga0501038_0433691 3300049574 Bacteria 1012
487 Ga0501039_0014908 3300049575 Bacteria 5944
488 Ga0501039_0053034 3300049575 Bacteria 3138
489 Ga0501039_0074400 3300049575 Bacteria 2640
490 Ga0501039_0462300 3300049575 Bacteria 996
491 Ga0501039_0777234 3300049575 Bacteria 747
492 Ga0501040_0025878 3300049576 Bacteria 3947
493 Ga0501040_0028816 3300049576 Bacteria 3744
494 Ga0501040_0044240 3300049576 Bacteria 3036
495 Ga0501040_0046331 3300049576 Bacteria 2968
496 Ga0501041_0016541 3300049577 Bacteria 4386
497 Ga0501041_0039523 3300049577 Bacteria 2863
498 Ga0501041_0107502 3300049577 Bacteria 1729
499 Ga0501041_0114481 3300049577 Bacteria 1674
500 Ga0501042_0009014 3300049578 Bacteria 6629
501 Ga0501042_0022837 3300049578 Bacteria 4371
502 Ga0501042_0039292 3300049578 Bacteria 3362
503 Ga0501042_0081204 3300049578 Bacteria 2323
504 Ga0501042_0155166 3300049578 Bacteria 1651
505 Ga0501043_0241924 3300049579 Bacteria 1392
506 Ga0501046_0010629 3300049580 Bacteria 7897
507 Ga0501046_0091260 3300049580 Bacteria 2343
508 Ga0501046_0171727 3300049580 Bacteria 1627
509 Ga0501048_0021562 3300049582 Bacteria 4717
510 Ga0501048_0088928 3300049582 Bacteria 2179
511 Ga0501048_0159217 3300049582 Bacteria 1597
512 Ga0501067_0015608 3300049583 Bacteria 4205
513 Ga0501067_0052455 3300049583 Bacteria 2260
514 Ga0501067_0083470 3300049583 Bacteria 1772
515 Ga0501068_0017455 3300049584 Bacteria 4151
516 Ga0501068_0020130 3300049584 Bacteria 3883
517 Ga0501070_0107148 3300049586 Bacteria 2310
518 Ga0501071_0014148 3300049587 Bacteria 5454
519 Ga0501071_0037992 3300049587 Bacteria 3439
520 Ga0501071_0062028 3300049587 Bacteria 2708
521 Ga0501071_0144381 3300049587 Bacteria 1773
522 Ga0501072_0136664 3300049588 Bacteria 1954
523 Ga0501072_0151743 3300049588 Bacteria 1847
524 Ga0501073_0042621 3300049589 Bacteria 3202
525 Ga0501074_0022576 3300049590 Bacteria 4573
526 Ga0501074_0101801 3300049590 Bacteria 2056
527 Ga0501074_0207014 3300049590 Bacteria 1398
528 Ga0501074_0224205 3300049590 Bacteria 1338
529 Ga0501075_0019115 3300049591 Bacteria 4969
530 Ga0501075_0023449 3300049591 Bacteria 4519
531 Ga0501075_0031641 3300049591 Bacteria 3928
532 Ga0501075_0066250 3300049591 Bacteria 2725
533 Ga0501075_0078341 3300049591 Bacteria 2501
534 Ga0501075_0094603 3300049591 Bacteria 2268
535 Ga0501075_0325394 3300049591 Bacteria 1171
536 Ga0501076_0007328 3300049592 Bacteria 8027
537 Ga0501076_0035210 3300049592 Bacteria 3918
538 Ga0501076_0039846 3300049592 Bacteria 3689
539 Ga0501076_0084048 3300049592 Bacteria 2556
540 Ga0501076_0126464 3300049592 Bacteria 2071
541 Ga0501076_0161591 3300049592 Bacteria 1825
542 Ga0501076_0247191 3300049592 Bacteria 1459
543 Ga0501077_0024477 3300049593 Bacteria 3834
544 Ga0501077_0052105 3300049593 Bacteria 2599
545 Ga0501077_0053245 3300049593 Bacteria 2569
546 Ga0501077_0266732 3300049593 Bacteria 1089
547 Ga0501079_0012782 3300049741 Bacteria 6411
548 Ga0501079_0046433 3300049741 Bacteria 3351
549 Ga0501079_0172126 3300049741 Bacteria 1688
550 Ga0501080_0063684 3300049742 Bacteria 3431
551 Ga0501080_0156704 3300049742 Bacteria 2103
552 Ga0501080_0278755 3300049742 Bacteria 1520
553 Ga0501081_0015228 3300049743 Bacteria 5073
554 Ga0501081_0016073 3300049743 Bacteria 4943
555 Ga0501081_0016834 3300049743 Bacteria 4832
556 Ga0501081_0034371 3300049743 Bacteria 3449
557 Ga0501081_0147869 3300049743 Bacteria 1686
558 Ga0501083_0085039 3300049744 Bacteria 2093
559 Ga0501083_0207967 3300049744 Bacteria 1276
560 Ga0501083_0246775 3300049744 Bacteria 1162
561 Ga0501044_0160661 3300049823 Bacteria 2224
562 Ga0501044_0299911 3300049823 Bacteria 1536
563 Ga0501045_0006758 3300049824 Bacteria 7942
564 Ga0501045_0010321 3300049824 Bacteria 6543
565 Ga0501045_0045547 3300049824 Bacteria 3193
566 Ga0501045_0117449 3300049824 Bacteria 1974
567 nmdc:mga05p37_221598_c1 3300050507 Bacteria 2283
568 nmdc:mga09592_91655_c1 3300050508 Bacteria 2597
569 nmdc:mga0qj67_323143_c1 3300050509 Bacteria 1249
570 nmdc:mga06r32_227197_c1 3300050510 Bacteria 1855
571 nmdc:mga06r32_22855_c1 3300050510 Bacteria 5783
572 nmdc:mga06r32_67718_c1 3300050510 Bacteria 3447
573 nmdc:mga08y16_268913_c1 3300050511 Bacteria 1760
574 nmdc:mga08y16_29814_c1 3300050511 Bacteria 5745
575 nmdc:mga08y16_345_c1 3300050511 Bacteria 41778
576 nmdc:mga08y16_366265_c1 3300050511 Unclassified 1479
577 nmdc:mga08y16_94158_c1 3300050511 Bacteria 3121
578 nmdc:mga0n895_106393_c1 3300050512 Bacteria 2818
579 nmdc:mga0n895_18214_c1 3300050512 Bacteria 6493
580 nmdc:mga0n895_31259_c1 3300050512 Bacteria 5096
581 nmdc:mga0n895_46096_c1 3300050512 Bacteria 4258
582 nmdc:mga0rr50_37768_c1 3300050513 Bacteria 3489
583 nmdc:mga0rr50_5898_c1 3300050513 Bacteria 7371
584 nmdc:mga0a205_15555_c1 3300050515 Bacteria 7110
585 nmdc:mga0a205_229469_c1 3300050515 Bacteria 1740
586 Ga0495601_0006873 3300053077 Bacteria 6664
587 Ga0495601_0101540 3300053077 Bacteria 1858
588 Ga0495612_0012370 3300053078 Bacteria 3440
589 Ga0495655_0000198 3300053083 Bacteria 11334
590 Ga0495655_0030465 3300053083 Bacteria 1305
591 Ga0495619_0032696 3300053085 Bacteria 3376
592 Ga0500593_000184 3300053117 Bacteria 25269
593 Ga0500618_002767 3300053125 Bacteria 6380
594 Ga0500568_0000004 3300053139 Bacteria 621666
595 Ga0501084_0017740 3300054114 Bacteria 5923
596 Ga0501084_0037100 3300054114 Bacteria 4072
597 Ga0501084_0100692 3300054114 Bacteria 2426
598 Ga0501084_0188371 3300054114 Bacteria 1741
599 Ga0501084_0598677 3300054114 Bacteria 931
600 Ga0501082_0053657 3300060353 Bacteria 3474
601 Ga0501082_0053765 3300060353 Bacteria 3470
602 Ga0501082_0070735 3300060353 Bacteria 3004
603 Ga0501082_0140581 3300060353 Bacteria 2095
604 Ga0501082_0223844 3300060353 Bacteria 1637
605 Ga0501082_0224719 3300060353 Bacteria 1634
606 Ga0530510_0007363 3300061734 Bacteria 7662
607 Ga0530510_0012630 3300061734 Bacteria 5936
608 Ga0530510_0015107 3300061734 Bacteria 5453
609 Ga0530510_0086988 3300061734 Bacteria 2277
610 Ga0530510_0173084 3300061734 Bacteria 1599
611 Ga0530510_0199947 3300061734 Bacteria 1484
612 2738746814 2738541281 Bacteria 5112672
613 2739356044 2738543032 Bacteria 5115625
614 2776262250 2775506901 Bacteria 9631051
615 2829747445 2829745981 Bacteria 5406054
616 2842695233 2842694124 Bacteria 4063419
617 2842701400 2842698319 Bacteria 5190321
618 2861692346 2861691609 Bacteria 5628931
619 2891090556 2891088606 Bacteria 4762464
620 2909046577 2909042592 Bacteria 6499737
621 3003670358 3003665799 Bacteria 7279786
622 641643264 641522639 Bacteria 7737025
623 643602187 643348564 Bacteria 8839022
624 Ga0105238_10509897
625 JGI24743J22301_10004620
626 JGI24738J21930_10019885
627 JGI24744J21845_10005120
628 JGI24751J29686_10009424
629 Ga0070676_10007398
630 Ga0070683_100153210
631 Ga0070690_100027821
632 Ga0070670_100001190
633 Ga0068869_100375778
634 Ga0070666_10003012
635 Ga0070680_100001970
636 Ga0070682_100003034
637 Ga0068868_100000904
638 Ga0068868_100035881
639 Ga0068868_100177986
640 Ga0070660_100001178
641 Ga0070660_100029003
642 Ga0070689_100004127
643 Ga0070689_100036702
644 Ga0070689_100169742
645 Ga0070691_10000155
646 Ga0070691_10151131
647 Ga0070687_100050098
648 Ga0070692_10003545
649 Ga0070692_10036402
650 Ga0070668_100000692
651 Ga0070675_100012884
652 Ga0070675_100371356
653 Ga0070671_100054784
654 Ga0070671_100148692
655 Ga0070673_100000626
656 Ga0070688_100000139
657 Ga0070688_100008062
658 Ga0070688_100119802
659 Ga0070688_100194001
660 Ga0070659_100048145
661 Ga0070667_100017103
662 Ga0070709_10001924
663 Ga0070709_10011161
664 Ga0070709_10210638
665 Ga0070714_100016853
666 Ga0070714_100220502
667 Ga0070713_100020215
668 Ga0070713_100684072
669 Ga0070701_10001747
670 Ga0070701_10033438
671 Ga0070701_10048981
672 Ga0070711_100033148
673 Ga0070711_100090723
674 Ga0070705_100000298
675 Ga0070705_100063514
676 Ga0070705_100342943
677 Ga0070700_100000648
678 Ga0070700_100003435
679 Ga0070700_100252940
680 Ga0070694_100004154
681 Ga0070694_100032137
682 Ga0070663_100003945
683 Ga0070663_100041642
684 Ga0070678_100049207
685 Ga0070678_100089920
686 Ga0070678_100112125
687 Ga0070662_100001411
688 Ga0070681_10242960
689 Ga0070685_10002499
690 Ga0070685_10012478
691 Ga0070698_100460349
692 Ga0070679_100029421
693 Ga0070684_100003622
694 Ga0070697_100030376
695 Ga0070697_100455915
696 Ga0068853_100116956
697 Ga0068853_100128698
698 Ga0070672_100004918
699 Ga0070672_100118589
700 Ga0070686_100000266
701 Ga0070686_100005291
702 Ga0070695_100047000
703 Ga0070696_100000333
704 Ga0070696_100113255
705 Ga0070696_100141085
706 Ga0070696_100187266
707 Ga0070693_100021448
708 Ga0070665_100009279
709 Ga0070665_100199816
710 Ga0070704_100201570
711 Ga0070704_100266045
712 Ga0068855_100007108
713 Ga0070664_100021593
714 Ga0070664_100154414
715 Ga0068857_100121149
716 Ga0068854_100000885
717 Ga0068856_100034039
718 Ga0070702_100000139
719 Ga0070702_100126360
720 Ga0068852_100142268
721 Ga0068859_100039960
722 Ga0068859_100041947
723 Ga0068859_100122480
724 Ga0068859_100288891
725 Ga0068866_10005610
726 Ga0068866_10017689
727 Ga0068866_10020419
728 Ga0068861_100002618
729 Ga0068861_100108096
730 Ga0068861_100170534
731 Ga0068863_100000834
732 Ga0068858_100003998
733 Ga0068858_100149280
734 Ga0068858_100415811
735 Ga0068860_100002133
736 Ga0068860_100206969
737 Ga0068860_100553610
738 Ga0068862_100030783
739 Ga0068862_100164125
740 Ga0068862_100349959
741 Ga0081455_10002556
742 Ga0081455_10003325
743 Ga0081455_10019283
744 Ga0070715_10000276
745 Ga0070715_10005604
746 Ga0070715_10128150
747 Ga0070716_100004597
748 Ga0070712_100000828
749 Ga0070712_100005886
750 Ga0075369_10051374
751 Ga0097621_100010851
752 Ga0068871_100014394
753 Ga0068871_100117958
754 Ga0068871_100217136
755 Ga0075428_100011583
756 Ga0075428_100070251
757 Ga0075428_100086167
758 Ga0075431_100006991
759 Ga0075431_100055379
760 Ga0075433_10256043
761 Ga0075433_10366430
762 Ga0075434_100003281
763 Ga0075434_100041932
764 Ga0075434_100143951
765 Ga0075434_100171550
766 Ga0075429_100107281
767 Ga0068865_100056168
768 Ga0068865_100115561
769 Ga0075436_100218020
770 Ga0097620_100039958
771 Ga0097620_100041946
772 Ga0097620_100122480
773 Ga0097620_100288884
774 Ga0075435_100019751
775 Ga0075435_100041656
776 Ga0075435_100096879
777 Ga0111539_10001059
778 Ga0111539_10052477
779 Ga0111539_10181577
780 Ga0111539_10428883
781 Ga0105245_10000795
782 Ga0105245_10225479
783 Ga0105247_10002860
784 Ga0105247_10006261
785 Ga0114129_10215849
786 Ga0114129_10287804
787 Ga0105243_10000766
788 Ga0105243_10229036
789 Ga0105241_10003139
790 Ga0105241_10040659
791 Ga0105241_10359087
792 Ga0105242_10000793
793 Ga0105242_10030834
794 Ga0105248_10004639
795 Ga0105248_10030555
796 Ga0105248_10046620
797 Ga0105237_10002479
798 Ga0105237_10040217
799 Ga0105237_10168181
800 Ga0105238_10092838
801 Ga0105249_10007009
802 Ga0105249_10056676
803 Ga0105249_10069542
804 Ga0105249_10501314
805 Ga0105239_10182836
806 Ga0105246_10010014
807 Ga0105246_10055644
808 Ga0105246_10110680
809 Ga0157371_10083949
810 Ga0157369_10047944
811 Ga0157378_10013602
812 Ga0157378_10100131
813 Ga0157378_10189161
814 Ga0163162_10001264
815 Ga0163162_10002935
816 Ga0163162_10148700
817 Ga0163162_10241485
818 Ga0157375_10014913
819 Ga0157375_10023817
820 Ga0157375_10151038
821 Ga0163163_10003201
822 Ga0163163_10128921
823 Ga0163163_10262066
824 Ga0157380_10001853
825 Ga0157380_10011619
826 Ga0157380_10051410
827 Ga0157380_10354977
828 Ga0157377_10000274
829 Ga0157377_10001978
830 Ga0157377_10179369
831 Ga0157379_10008173
832 Ga0157379_10016482
833 Ga0157379_10247599
834 Ga0157376_10000272
835 Ga0157376_10006162
836 Ga0157376_10023018
837 Ga0157376_10027829
838 Ga0157376_10526969
839 Ga0163161_10002256
840 Ga0163161_10008969
841 Ga0163161_10154784
842 Ga0207697_10063053
843 Ga0207692_10037573
844 Ga0207642_10038793
845 Ga0207642_10143347
846 Ga0207710_10012112
847 Ga0207710_10036307
848 Ga0207688_10013246
849 Ga0207680_10124970
850 Ga0207680_10164964
851 Ga0207647_10001875
852 Ga0207647_10109192
853 Ga0207685_10005607
854 Ga0207685_10181619
855 Ga0207699_10001015
856 Ga0207699_10015803
857 Ga0207699_10053049
858 Ga0207645_10004533
859 Ga0207684_10291259
860 Ga0207654_10002679
861 Ga0207654_10041668
862 Ga0207654_10243472
863 Ga0207707_10190317
864 Ga0207671_10452200
865 Ga0207693_10000607
866 Ga0207693_10001496
867 Ga0207693_10037181
868 Ga0207663_10026018
869 Ga0207663_10052628
870 Ga0207662_10063512
871 Ga0207657_10000086
872 Ga0207657_10028294
873 Ga0207649_10014932
874 Ga0207659_10046524
875 Ga0207659_10301308
876 Ga0207700_10586133
877 Ga0207664_10021367
878 Ga0207644_10510796
879 Ga0207706_10000234
880 Ga0207686_10048613
881 Ga0207709_10005243
882 Ga0207709_10080993
883 Ga0207670_10006243
884 Ga0207670_10242111
885 Ga0207670_10281134
886 Ga0207669_10021994
887 Ga0207669_10076727
888 Ga0207704_10071758
889 Ga0207665_10000120
890 Ga0207691_10000538
891 Ga0207691_10003814
892 Ga0207691_10279201
893 Ga0207711_10022999
894 Ga0207711_10033799
895 Ga0207711_10315215
896 Ga0207689_10171134
897 Ga0207689_10281033
898 Ga0207661_10071414
899 Ga0207679_10054450
900 Ga0207679_10345641
901 Ga0207667_10412255
902 Ga0207651_10105171
903 Ga0207712_10012365
904 Ga0207712_10024591
905 Ga0207668_10016635
906 Ga0207640_10337269
907 Ga0207658_10129054
908 Ga0207677_10370260
909 Ga0207703_10067186
910 Ga0207703_10570444
911 Ga0207639_10116536
912 Ga0207678_10000048
913 Ga0207678_10010558
914 Ga0207678_10048274
915 Ga0207708_10000443
916 Ga0207708_10001294
917 Ga0207708_10022951
918 Ga0207708_10111050
919 Ga0207702_10100263
920 Ga0207648_10000681
921 Ga0207648_10071283
922 Ga0207648_10083711
923 Ga0207648_10194894
924 Ga0207676_10107867
925 Ga0207676_10463699
926 Ga0207674_10003550
927 Ga0207675_100000155
928 Ga0207675_100003526
929 Ga0207675_100013005
930 Ga0207675_100072839
931 Ga0207683_10001544
932 Ga0207683_10001926
933 Ga0207683_10132007
934 Ga0207683_10152917
935 Ga0207428_10010697
936 Ga0207428_10034083
937 Ga0268266_10021468
938 Ga0268266_10408782
939 Ga0268265_10058582
940 Ga0268265_10102582
941 Ga0268265_10331304
942 Ga0268265_10437715
943 Ga0268264_10004457
944 Ga0268264_10188929
945 Ga0316575_10037680
946 Ga0316575_10044653
947 Ga0316579_10000697
948 Ga0316576_10116085
949 Ga0316578_10033720
950 Ga0316577_10024803
951 Ga0316583_10004109
952 Ga0316585_10009688
953 Ga0316580_10023464
954 Ga0316593_10005717
955 Ga0307510_10061970
956 Ga0316596_1016823
957 Ga0373944_0052719
958 Ga0373939_0057411
959 Ga0373945_0019259
960 Ga0373960_0032485
961 Ga0373943_0028799
962 Ga0373946_0050870
963 Ga0373942_0067045
964 Ga0373962_0013532
965 Ga0316574_0119238
966 Ga0373931_0027767
967 Ga0373931_0056976
968 Ga0373931_0408401
969 Ga0373935_0137336
970 Ga0373927_0058203
971 Ga0373947_0151591
972 Ga0373937_0059314
973 Ga0316582_0007422
974 Ga0316584_0002253
975 Ga0395899_0198641
976 Ga0395900_0081331
977 Ga0395898_0029163
978 Ga0395898_0040038
979 Ga0395905_0007320
980 Ga0395901_0003430
981 Ga0395901_0172397
982 Ga0439456_039272
983 Ga0451577_0408383
984 Ga0439440_0035063
985 Ga0453684_0048131
986 Ga0451576_0139773
987 Ga0495617_092894
988 Ga0495603_0000028
989 Ga0495603_0114168
990 Ga0495629_0068903
991 Ga0495641_0077609
992 Ga0495641_0104816
993 Ga0495580_0008815
994 Ga0495580_0146151
995 Ga0495582_0005654
996 Ga0495605_0052188
997 Ga0495605_0186505
998 Ga0495584_0051127
999 Ga0495594_0000900
1000 Ga0495607_0060793
1001 Ga0495608_0257980
1002 Ga0495631_0067051
1003 Ga0495637_0142900
1004 Ga0495644_0067453
1005 Ga0495644_0114446
1006 Ga0495642_0009571
1007 Ga0495609_0022992
1008 Ga0495622_0008830
1009 Ga0495656_0002027
1010 Ga0495656_0014054
1011 Ga0495656_0031477
1012 Ga0495634_0051035
1013 Ga0495659_0009778
1014 Ga0495588_0002098
1015 Ga0495658_0006562
1016 Ga0495613_0002754
1017 Ga0495613_0090020
1018 Ga0495589_0019560
1019 Ga0495589_0144228
1020 Ga0495581_0023992
1021 Ga0495581_0065798
1022 Ga0495636_0050513
1023 Ga0495676_0020922
1024 Ga0495676_0035644
1025 Ga0495680_0059143
1026 Ga0495685_051351
1027 Ga0495593_0001079
1028 Ga0495614_0010537
1029 Ga0495615_0070242
1030 Ga0495626_0064139
1031 Ga0496100_0007013
1032 Ga0496100_0020956
1033 Ga0496100_0041031
1034 Ga0496101_0027362
1035 Ga0496101_0086149
1036 Ga0496101_0101264
1037 Ga0496101_0364966
1038 Ga0496102_0012313
1039 Ga0496102_0034877
1040 Ga0496102_0045439
1041 Ga0496102_0087250
1042 Ga0496102_0104593
1043 Ga0496102_0660238
1044 Ga0496103_0215899
1045 Ga0496103_0366320
1046 Ga0496104_0012228
1047 Ga0496104_0095526
1048 Ga0496104_0175942
1049 Ga0496104_0198130
1050 Ga0496105_0021840
1051 Ga0496105_0162954
1052 Ga0496106_0016098
1053 Ga0496106_0174409
1054 Ga0496106_0405699
1055 Ga0496107_0013048
1056 Ga0496107_0044718
1057 Ga0496107_0063231
1058 Ga0496107_0081533
1059 Ga0496107_0391877
1060 Ga0496108_0031203
1061 Ga0496108_0089032
1062 Ga0496108_0236133
1063 Ga0496108_0290081
1064 Ga0496108_0403902
1065 Ga0496108_0542916
1066 Ga0496109_0042219
1067 Ga0496109_0059564
1068 Ga0496109_0474261
1069 Ga0496110_0015786
1070 Ga0496110_0373935
1071 Ga0496111_0016669
1072 Ga0496111_0265408
1073 Ga0496111_0276173
1074 Ga0496112_0004454
1075 Ga0496112_0024394
1076 Ga0496112_0160399
1077 Ga0496112_0172587
1078 Ga0496113_0034188
1079 Ga0496113_0046446
1080 Ga0496113_0082518
1081 Ga0496113_0113128
1082 Ga0496113_0294180
1083 Ga0496114_0012064
1084 Ga0496114_0051543
1085 Ga0496114_0163699
1086 Ga0496114_0341783
1087 Ga0496115_0081918
1088 Ga0496115_0098949
1089 Ga0496115_0158225
1090 Ga0496115_0185300
1091 Ga0496115_0194637
1092 Ga0496118_0114797
1093 Ga0501031_0078963
1094 Ga0501031_0104426
1095 Ga0501031_0209401
1096 Ga0501032_0078762
1097 Ga0501033_0027148
1098 Ga0501033_0136315
1099 Ga0501033_0264168
1100 Ga0501034_0018091
1101 Ga0501034_0032293
1102 Ga0501036_0117893
1103 Ga0501036_0147416
1104 Ga0501036_0369343
1105 Ga0501037_0039464
1106 Ga0501037_0202390
1107 Ga0501037_0244730
1108 Ga0501038_0015555
1109 Ga0501038_0433691
1110 Ga0501039_0014908
1111 Ga0501039_0053034
1112 Ga0501039_0074400
1113 Ga0501039_0462300
1114 Ga0501039_0777234
1115 Ga0501040_0025878
1116 Ga0501040_0028816
1117 Ga0501040_0044240
1118 Ga0501040_0046331
1119 Ga0501041_0016541
1120 Ga0501041_0039523
1121 Ga0501041_0107502
1122 Ga0501041_0114481
1123 Ga0501042_0009014
1124 Ga0501042_0022837
1125 Ga0501042_0039292
1126 Ga0501042_0081204
1127 Ga0501042_0155166
1128 Ga0501043_0241924
1129 Ga0501046_0010629
1130 Ga0501046_0091260
1131 Ga0501046_0171727
1132 Ga0501048_0021562
1133 Ga0501048_0088928
1134 Ga0501048_0159217
1135 Ga0501067_0015608
1136 Ga0501067_0052455
1137 Ga0501067_0083470
1138 Ga0501068_0017455
1139 Ga0501068_0020130
1140 Ga0501070_0107148
1141 Ga0501071_0014148
1142 Ga0501071_0037992
1143 Ga0501071_0062028
1144 Ga0501071_0144381
1145 Ga0501072_0136664
1146 Ga0501072_0151743
1147 Ga0501073_0042621
1148 Ga0501074_0022576
1149 Ga0501074_0101801
1150 Ga0501074_0207014
1151 Ga0501074_0224205
1152 Ga0501075_0019115
1153 Ga0501075_0023449
1154 Ga0501075_0031641
1155 Ga0501075_0066250
1156 Ga0501075_0078341
1157 Ga0501075_0094603
1158 Ga0501075_0325394
1159 Ga0501076_0007328
1160 Ga0501076_0035210
1161 Ga0501076_0039846
1162 Ga0501076_0084048
1163 Ga0501076_0126464
1164 Ga0501076_0161591
1165 Ga0501076_0247191
1166 Ga0501077_0024477
1167 Ga0501077_0052105
1168 Ga0501077_0053245
1169 Ga0501077_0266732
1170 Ga0501079_0012782
1171 Ga0501079_0046433
1172 Ga0501079_0172126
1173 Ga0501080_0063684
1174 Ga0501080_0156704
1175 Ga0501080_0278755
1176 Ga0501081_0015228
1177 Ga0501081_0016073
1178 Ga0501081_0016834
1179 Ga0501081_0034371
1180 Ga0501081_0147869
1181 Ga0501083_0085039
1182 Ga0501083_0207967
1183 Ga0501083_0246775
1184 Ga0501044_0160661
1185 Ga0501044_0299911
1186 Ga0501045_0006758
1187 Ga0501045_0010321
1188 Ga0501045_0045547
1189 Ga0501045_0117449
1190 nmdc:mga05p37_221598_c1
1191 nmdc:mga09592_91655_c1
1192 nmdc:mga0qj67_323143_c1
1193 nmdc:mga06r32_227197_c1
1194 nmdc:mga06r32_22855_c1
1195 nmdc:mga06r32_67718_c1
1196 nmdc:mga08y16_268913_c1
1197 nmdc:mga08y16_29814_c1
1198 nmdc:mga08y16_345_c1
1199 nmdc:mga08y16_366265_c1
1200 nmdc:mga08y16_94158_c1
1201 nmdc:mga0n895_106393_c1
1202 nmdc:mga0n895_18214_c1
1203 nmdc:mga0n895_31259_c1
1204 nmdc:mga0n895_46096_c1
1205 nmdc:mga0rr50_37768_c1
1206 nmdc:mga0rr50_5898_c1
1207 nmdc:mga0a205_15555_c1
1208 nmdc:mga0a205_229469_c1
1209 Ga0495601_0006873
1210 Ga0495601_0101540
1211 Ga0495612_0012370
1212 Ga0495655_0000198
1213 Ga0495655_0030465
1214 Ga0495619_0032696
1215 Ga0500593_000184
1216 Ga0500618_002767
1217 Ga0500568_0000004
1218 Ga0501084_0017740
1219 Ga0501084_0037100
1220 Ga0501084_0100692
1221 Ga0501084_0188371
1222 Ga0501084_0598677
1223 Ga0501082_0053657
1224 Ga0501082_0053765
1225 Ga0501082_0070735
1226 Ga0501082_0140581
1227 Ga0501082_0223844
1228 Ga0501082_0224719
1229 Ga0530510_0007363
1230 Ga0530510_0012630
1231 Ga0530510_0015107
1232 Ga0530510_0086988
1233 Ga0530510_0173084
1234 Ga0530510_0199947
1235 2738746814
1236 2739356044
1237 2776262250
1238 2829747445
1239 2842695233
1240 2842701400
1241 2861692346
1242 2891090556
1243 2909046577
1244 3003670358
1245 641643264
1246 643602187

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13277

YmdB

YmdB-like protein

4

258

0.98

PF10418

DHODB_Fe-S_bind

Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B

271

308

0.94

PF00149

Metallophos

Calcineurin-like phosphoesterase

1

182

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b2o-assembly1.cif.gz_D crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. 0.9773 1 260
2cv9-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.96 1 262
1t70-assembly3.cif.gz_E crystal structure of a novel phosphatase from deinococcus radiodurans 0.9576 1 262
2cv9-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.9563 1 262
1t70-assembly3.cif.gz_E crystal structure of a novel phosphatase from deinococcus radiodurans 0.9539 1 262
ID Description Score Start End Superfamily
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9773 1 260 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9649 1 262 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9612 1 262 3.60.21.10
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9482 1 260 3.60.21.10
1t71A00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8769 1 274 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A434NV55-F1-model_v4 Metallophosphoesterase 1.002 1 59 GO:0004113
AF-A0A530R4K1-F1-model_v4 Metallophosphoesterase 1.001 1 122 GO:0004113
AF-A0A3D2P519-F1-model_v4 Metallophosphoesterase 0.9991 1 63 GO:0004113
AF-A0A3S1QVR6-F1-model_v4 Metallophosphoesterase 0.998 1 176 GO:0004113
AF-A0A435NMD2-F1-model_v4 deleted 0.9979 1 90

Map