F470227

General Info

Members Datasets Scaffolds Average Seq Length
623 453 421 303

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0106636|Ga0496126_0106636_777_1859
Length 360
Sequence MAGFPLISAETDIGIATRALPQSRWSLRGTSIVSAVVVSIVACAVCNDAVKQLTSMTLFAKISAHNDERTARLAGIGLMLLAVFTFSFGDAIGKFMVATYSVGELLLLRACAALXXLLPLLWRQRMAFAQLERPWLQLLRAVLSTAEVTAFFLATVYLPLADVITYYLACPIFVTALSAIVLRERVGWRRWTAILVGFCGVLIALHPSPQTVSWPALIALGGSTSFAVLMLITRSLRATPDVVLASTQFAGTFVFGALLSPIGWVTPDLVSLGLFAAAGCISVAALFCVNRSLKLAPASVVVPYQYSMIIWAVMFGYAVFGDVPSMATIVGAAIIXGAGLYIFLRERNLGRKVTVVSPPV

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
7 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
8 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
17 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
18 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
19 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
20 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
21 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
22 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
23 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
24 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
25 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
26 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
27 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
28 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
29 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
30 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
31 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
32 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
33 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
34 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
35 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
36 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
37 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
38 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
39 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
40 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
41 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
42 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
43 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
44 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
45 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
46 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
47 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
48 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
49 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
50 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
51 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
52 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
53 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
54 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
55 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
56 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
57 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
58 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
59 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
60 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
61 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
62 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
63 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
64 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
65 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
66 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
67 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
68 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
69 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
70 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
71 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
72 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
73 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
74 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
75 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
76 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
77 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
78 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
79 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
80 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
81 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
82 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
83 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
84 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
85 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
86 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
87 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
88 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
89 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
90 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
91 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
92 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
93 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
94 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
95 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
96 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
97 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
98 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
99 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
100 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
101 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
102 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
103 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
104 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
105 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
106 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
107 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
108 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
109 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
110 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
111 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
112 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
113 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
114 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
115 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
116 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
117 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
118 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
119 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
120 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
121 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
122 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
123 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
124 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
125 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
126 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
127 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
128 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
129 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
130 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
131 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
132 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
133 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
134 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
135 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
136 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
137 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
138 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
139 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
140 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
141 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
142 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
143 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
144 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
145 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
146 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
147 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
148 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
149 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
150 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
151 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
152 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
153 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
154 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
155 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
156 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
157 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
158 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
159 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
160 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
161 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
162 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
163 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
164 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
165 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
166 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
167 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
168 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
169 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
170 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
171 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
172 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
173 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
174 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
175 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
176 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
177 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
178 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
179 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
180 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
181 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
182 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
183 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
184 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
185 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
186 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
187 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
188 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
189 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
190 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
191 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
192 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
193 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
194 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
195 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
196 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
197 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
198 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
199 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
200 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
201 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
202 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
203 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
204 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
205 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
206 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
207 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
208 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
209 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
210 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
211 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
212 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
213 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
214 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
215 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
216 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
217 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
218 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
219 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
220 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
221 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
222 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
223 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
224 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
225 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
226 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
227 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
228 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
229 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
230 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
231 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
232 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
233 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
237 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
239 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
240 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
241 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
242 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
276 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
277 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
278 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
281 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
282 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
283 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
284 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
285 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
286 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
287 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
288 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
289 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
290 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
291 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
292 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
293 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
294 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
295 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
296 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
297 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
298 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
299 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
300 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
301 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
302 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
303 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
304 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
305 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
306 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
307 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
308 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
309 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
310 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
311 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
312 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
313 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
314 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
315 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
316 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
317 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
318 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
319 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
320 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
321 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
322 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
323 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
324 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
325 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
326 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
327 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
328 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
329 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
330 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
331 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
332 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
333 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
334 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
335 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
336 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
337 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
338 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
339 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
340 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
341 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
342 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
343 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
344 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
345 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
346 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
347 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
348 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
349 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
350 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
351 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
354 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
355 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
356 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
357 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
358 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
359 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
360 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
361 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
362 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
363 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
364 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
365 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
366 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
367 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
368 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
369 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
383 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
384 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
385 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
386 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
387 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
388 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
389 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
390 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
391 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
393 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
394 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
395 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
396 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
397 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
400 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
403 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
404 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
405 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
406 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
407 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
408 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
409 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
410 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
411 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
412 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
413 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
414 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
415 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
416 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
417 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
418 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
419 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
420 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
421 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
422 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
423 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
424 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
425 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
426 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
427 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
428 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
429 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
430 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
431 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
432 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
433 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
434 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
435 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
436 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
437 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
438 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
439 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
440 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
441 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
442 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
443 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
444 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
445 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
446 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
447 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
448 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
449 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
450 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
451 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
452 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
453 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.12
Metatranscriptomes 0
Isolates 31.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.35
Nodule 23.92
Rhizoplane 3.37
Rhizosphere 50.08
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000028 3300003203 Bacteria 70247
2 JGI25406J46586_10047459 3300003203 Bacteria 1463
3 JGI25153J46596_10021483 3300003215 Bacteria 2404
4 JGI25160J50197_1005512 3300003354 Bacteria 5255
5 Ga0055542_1006352 3300003762 Bacteria 2536
6 Ga0065165_1007492 3300005262 Bacteria 5347
7 Ga0070683_100006154 3300005329 Bacteria 10062
8 Ga0070690_100088529 3300005330 Bacteria 2035
9 Ga0070680_100129552 3300005336 Bacteria 2110
10 Ga0070660_100048164 3300005339 Bacteria 3272
11 Ga0070668_100061368 3300005347 Bacteria 2912
12 Ga0070668_100145114 3300005347 Bacteria 1915
13 Ga0070674_100075415 3300005356 Bacteria 2395
14 Ga0070659_100016068 3300005366 Bacteria 5616
15 Ga0070659_100016790 3300005366 Bacteria 5500
16 Ga0070709_10000164 3300005434 Bacteria 42124
17 Ga0070709_10001896 3300005434 Bacteria 11350
18 Ga0070709_10086698 3300005434 Bacteria 2056
19 Ga0070709_10153727 3300005434 Bacteria 1593
20 Ga0070709_10175776 3300005434 Bacteria 1500
21 Ga0070714_100001570 3300005435 Bacteria 16615
22 Ga0070714_100006027 3300005435 Bacteria 9308
23 Ga0070714_100038947 3300005435 Bacteria 3999
24 Ga0070714_100347843 3300005435 Bacteria 1392
25 Ga0070713_100004073 3300005436 Bacteria 9731
26 Ga0070713_100009622 3300005436 Bacteria 6937
27 Ga0070713_100116702 3300005436 Bacteria 2335
28 Ga0070713_100265251 3300005436 Bacteria 1571
29 Ga0070710_10000739 3300005437 Bacteria 15565
30 Ga0070710_10016066 3300005437 Bacteria 3801
31 Ga0070711_100001284 3300005439 Bacteria 13635
32 Ga0070711_100011004 3300005439 Bacteria 5610
33 Ga0070711_100017891 3300005439 Bacteria 4517
34 Ga0070711_100042983 3300005439 Bacteria 3058
35 Ga0070711_100049129 3300005439 Bacteria 2888
36 Ga0070700_100077011 3300005441 Bacteria 2144
37 Ga0070663_100031844 3300005455 Bacteria 3628
38 Ga0070663_100048039 3300005455 Bacteria 3025
39 Ga0070678_100287030 3300005456 Bacteria 1394
40 Ga0070681_10062944 3300005458 Bacteria 3682
41 Ga0070681_10114581 3300005458 Bacteria 2634
42 Ga0070681_10214341 3300005458 Bacteria 1842
43 Ga0068867_100014350 3300005459 Bacteria 5612
44 Ga0070706_100079195 3300005467 Bacteria 3041
45 Ga0070679_100033349 3300005530 Bacteria 5098
46 Ga0070679_100063924 3300005530 Bacteria 3667
47 Ga0070684_100028558 3300005535 Bacteria 4720
48 Ga0068853_100009728 3300005539 Bacteria 7755
49 Ga0068853_100305003 3300005539 Bacteria 1473
50 Ga0070693_100170503 3300005547 Bacteria 1393
51 Ga0070693_100261828 3300005547 Bacteria 1151
52 Ga0068855_100030586 3300005563 Bacteria 6437
53 Ga0068855_100049264 3300005563 Bacteria 4969
54 Ga0068855_100077011 3300005563 Bacteria 3869
55 Ga0068854_100336271 3300005578 Bacteria 1232
56 Ga0068856_100000651 3300005614 Bacteria 37648
57 Ga0068856_100028103 3300005614 Bacteria 5489
58 Ga0068852_100022926 3300005616 Bacteria 5016
59 Ga0068864_100233462 3300005618 Bacteria 1702
60 Ga0068861_100059368 3300005719 Bacteria 2928
61 Ga0068861_100155546 3300005719 Bacteria 1880
62 Ga0068862_100612693 3300005844 Bacteria 1046
63 Ga0081455_10015012 3300005937 Bacteria 7544
64 Ga0081455_10024524 3300005937 Bacteria 5583
65 Ga0081455_10036566 3300005937 Bacteria 4370
66 Ga0081455_10157700 3300005937 Bacteria 1743
67 Ga0081538_10084935 3300005981 Bacteria 1665
68 Ga0081540_1003056 3300005983 Bacteria 13411
69 Ga0081540_1005177 3300005983 Bacteria 9762
70 Ga0081540_1008688 3300005983 Bacteria 7074
71 Ga0081540_1012681 3300005983 Bacteria 5529
72 Ga0081540_1066657 3300005983 Bacteria 1686
73 Ga0081540_1093375 3300005983 Bacteria 1318
74 Ga0081539_10000048 3300005985 Bacteria 272906
75 Ga0081539_10010443 3300005985 Bacteria 7540
76 Ga0070717_10040761 3300006028 Bacteria 3784
77 Ga0070717_10083530 3300006028 Bacteria 2686
78 Ga0070717_10099985 3300006028 Bacteria 2462
79 Ga0070717_10326071 3300006028 Bacteria 1369
80 Ga0075368_10103887 3300006042 Bacteria 1168
81 Ga0075364_10035246 3300006051 Bacteria 3233
82 Ga0070715_10003674 3300006163 Bacteria 4931
83 Ga0070715_10017909 3300006163 Bacteria 2690
84 Ga0070716_100007420 3300006173 Bacteria 5398
85 Ga0070716_100112934 3300006173 Bacteria 1687
86 Ga0070712_100069248 3300006175 Bacteria 2517
87 Ga0070712_100196331 3300006175 Bacteria 1582
88 Ga0075362_10000843 3300006177 Bacteria 9223
89 Ga0075369_10051973 3300006186 Bacteria 1775
90 Ga0075366_10009232 3300006195 Bacteria 5504
91 Ga0075370_10013839 3300006353 Bacteria 4292
92 Ga0099825_1030311 3300006941 Bacteria 2408
93 Ga0099795_10009703 3300007788 Bacteria 2804
94 Ga0105240_10045699 3300009093 Bacteria 5554
95 Ga0105240_10147214 3300009093 Bacteria 2809
96 Ga0105240_10568205 3300009093 Bacteria 1253
97 Ga0111539_10203041 3300009094 Bacteria 2311
98 Ga0105245_10141777 3300009098 Bacteria 2264
99 Ga0105237_10616764 3300009545 Bacteria 1092
100 Ga0105238_10079650 3300009551 Bacteria 3266
101 Ga0105239_10010622 3300010375 Bacteria 10298
102 Ga0105239_10230791 3300010375 Bacteria 2076
103 Ga0157373_10045181 3300013100 Bacteria 3145
104 Ga0157371_10065110 3300013102 Bacteria 2581
105 Ga0157370_10051513 3300013104 Bacteria 3933
106 Ga0157370_10105143 3300013104 Bacteria 2642
107 Ga0157370_10277641 3300013104 Bacteria 1548
108 Ga0157369_10116637 3300013105 Bacteria 2835
109 Ga0157369_10273725 3300013105 Bacteria 1759
110 Ga0157378_10002715 3300013297 Bacteria 15762
111 Ga0163162_10023717 3300013306 Bacteria 6055
112 Ga0163162_10456865 3300013306 Bacteria 1409
113 Ga0157372_10042512 3300013307 Bacteria 5027
114 Ga0163163_10078698 3300014325 Bacteria 3294
115 Ga0157377_10158429 3300014745 Bacteria 1406
116 Ga0157376_10431457 3300014969 Bacteria 1281
117 Ga0214544_1012884 3300021320 Bacteria 10561
118 Ga0214542_1012745 3300021321 Bacteria 10603
119 Ga0214543_1013104 3300021327 Bacteria 10603
120 Ga0213876_10058904 3300021384 Bacteria 2027
121 Ga0209563_100389 3300025230 Bacteria 15790
122 Ga0209677_100521 3300025253 Bacteria 21414
123 Ga0209677_104684 3300025253 Bacteria 3857
124 Ga0209148_1000418 3300025254 Bacteria 47611
125 Ga0209233_1001987 3300025261 Bacteria 7745
126 Ga0209455_1004235 3300025272 Bacteria 4781
127 Ga0209455_1005058 3300025272 Bacteria 4171
128 Ga0209673_1030134 3300025273 Bacteria 1714
129 Ga0209564_1003322 3300025295 Bacteria 11175
130 Ga0209758_1001512 3300025297 Bacteria 26996
131 Ga0209758_1016078 3300025297 Bacteria 3823
132 Ga0209758_1026750 3300025297 Bacteria 2487
133 Ga0207426_1007219 3300025302 Bacteria 4683
134 Ga0207656_10001743 3300025321 Bacteria 7236
135 Ga0207692_10001768 3300025898 Bacteria 8195
136 Ga0207692_10033011 3300025898 Bacteria 2492
137 Ga0207685_10018407 3300025905 Bacteria 2280
138 Ga0207685_10051187 3300025905 Bacteria 1594
139 Ga0207699_10000184 3300025906 Bacteria 37990
140 Ga0207699_10023773 3300025906 Bacteria 3340
141 Ga0207699_10040069 3300025906 Bacteria 2697
142 Ga0207699_10090977 3300025906 Bacteria 1915
143 Ga0207699_10135906 3300025906 Bacteria 1610
144 Ga0207699_10151145 3300025906 Bacteria 1536
145 Ga0207705_10009249 3300025909 Bacteria 7171
146 Ga0207684_10355690 3300025910 Bacteria 1260
147 Ga0207707_10001922 3300025912 Bacteria 18882
148 Ga0207707_10054240 3300025912 Bacteria 3490
149 Ga0207707_10202391 3300025912 Bacteria 1731
150 Ga0207695_10000148 3300025913 Bacteria 208344
151 Ga0207695_10106336 3300025913 Bacteria 2792
152 Ga0207695_10161705 3300025913 Bacteria 2170
153 Ga0207671_10158504 3300025914 Bacteria 1752
154 Ga0207693_10019276 3300025915 Bacteria 5429
155 Ga0207693_10042627 3300025915 Bacteria 3572
156 Ga0207693_10070846 3300025915 Bacteria 2728
157 Ga0207693_10151393 3300025915 Bacteria 1825
158 Ga0207663_10000585 3300025916 Bacteria 16125
159 Ga0207663_10010422 3300025916 Bacteria 4949
160 Ga0207660_10059211 3300025917 Bacteria 2749
161 Ga0207660_10104552 3300025917 Bacteria 2120
162 Ga0207657_10000700 3300025919 Bacteria 35601
163 Ga0207652_10174009 3300025921 Bacteria 1932
164 Ga0207687_10109551 3300025927 Bacteria 2046
165 Ga0207700_10006418 3300025928 Bacteria 7099
166 Ga0207700_10015761 3300025928 Bacteria 4998
167 Ga0207700_10032364 3300025928 Bacteria 3729
168 Ga0207700_10110487 3300025928 Bacteria 2211
169 Ga0207700_10177181 3300025928 Bacteria 1782
170 Ga0207700_10262439 3300025928 Bacteria 1480
171 Ga0207664_10024726 3300025929 Bacteria 4516
172 Ga0207664_10040011 3300025929 Bacteria 3642
173 Ga0207664_10040064 3300025929 Bacteria 3640
174 Ga0207664_10216857 3300025929 Bacteria 1658
175 Ga0207690_10083060 3300025932 Bacteria 2242
176 Ga0207709_10154386 3300025935 Bacteria 1594
177 Ga0207665_10002484 3300025939 Bacteria 12418
178 Ga0207665_10012818 3300025939 Bacteria 5512
179 Ga0207665_10286208 3300025939 Bacteria 1228
180 Ga0207661_10001440 3300025944 Bacteria 16041
181 Ga0207667_10015124 3300025949 Bacteria 8775
182 Ga0207667_10080807 3300025949 Bacteria 3368
183 Ga0207667_10176204 3300025949 Bacteria 2197
184 Ga0207712_10143627 3300025961 Bacteria 1835
185 Ga0207668_10025372 3300025972 Bacteria 3835
186 Ga0207658_10222486 3300025986 Bacteria 1589
187 Ga0207639_10187886 3300026041 Bacteria 1763
188 Ga0207678_10065918 3300026067 Bacteria 3109
189 Ga0207678_10072529 3300026067 Bacteria 2950
190 Ga0207702_10000546 3300026078 Bacteria 42023
191 Ga0207648_10068399 3300026089 Bacteria 3094
192 Ga0207676_10336466 3300026095 Bacteria 1391
193 Ga0207675_100098545 3300026118 Bacteria 2753
194 Ga0207675_100449625 3300026118 Bacteria 1276
195 Ga0207675_100646951 3300026118 Bacteria 1063
196 Ga0207683_10274301 3300026121 Bacteria 1541
197 Ga0207698_10184690 3300026142 Bacteria 1851
198 Ga0207698_10409050 3300026142 Bacteria 1299
199 Ga0209389_1000102 3300027296 Bacteria 78475
200 Ga0209489_100404 3300027361 Bacteria 78473
201 Ga0209700_100408 3300027363 Bacteria 78496
202 Ga0268266_10111810 3300028379 Bacteria 2420
203 Ga0268265_10147487 3300028380 Bacteria 1979
204 Ga0268265_10450835 3300028380 Bacteria 1201
205 Ga0265334_10012836 3300028573 Bacteria 3513
206 Ga0265330_10026441 3300031235 Bacteria 2625
207 Ga0265330_10074102 3300031235 Bacteria 1471
208 Ga0265340_10010016 3300031247 Bacteria 5077
209 Ga0265340_10026153 3300031247 Bacteria 2951
210 Ga0265339_10000681 3300031249 Bacteria 26201
211 Ga0265339_10034747 3300031249 Bacteria 2832
212 Ga0265339_10058595 3300031249 Bacteria 2079
213 Ga0265331_10078360 3300031250 Bacteria 1538
214 Ga0307509_10176924 3300031507 Bacteria 2004
215 Ga0307508_10014712 3300031616 Bacteria 7135
216 Ga0265314_10028143 3300031711 Bacteria 4194
217 Ga0307507_10043368 3300033179 Bacteria 4465
218 Ga0307510_10006006 3300033180 Bacteria 14485
219 Ga0307510_10010850 3300033180 Bacteria 10828
220 Ga0373934_0029624 3300035086 Bacteria 2139
221 Ga0373923_0070385 3300035111 Bacteria 1501
222 Ga0373953_0005731 3300035117 Bacteria 4049
223 Ga0373954_0001520 3300035118 Bacteria 9435
224 Ga0373956_0000581 3300035119 Bacteria 14992
225 Ga0373957_0000761 3300035120 Bacteria 8366
226 Ga0373955_0017496 3300035172 Bacteria 3549
227 Ga0373935_0118114 3300035692 Bacteria 1768
228 Ga0373927_0009886 3300035695 Bacteria 6396
229 Ga0373927_0040514 3300035695 Bacteria 3021
230 Ga0373933_0007007 3300035724 Bacteria 6144
231 Ga0373937_0053065 3300036401 Bacteria 3718
232 Ga0373925_0077060 3300037068 Bacteria 2530
233 Ga0373925_0362462 3300037068 Bacteria 1178
234 Ga0395900_0065463 3300037418 Bacteria 3734
235 Ga0395901_0484469 3300038443 Bacteria 1261
236 Ga0436365_0402044 3300039437 Bacteria 1722
237 Ga0436365_1415755 3300039437 Bacteria 11379
238 Ga0436363_0949075 3300039450 Bacteria 1330
239 Ga0436362_0843798 3300039453 Bacteria 3237
240 Ga0466972_0000306 3300044658 Bacteria 28921
241 Ga0466966_0056011 3300044684 Bacteria 2495
242 Ga0466961_0000770 3300044693 Bacteria 20096
243 Ga0466961_0049755 3300044693 Bacteria 2678
244 Ga0466963_0066403 3300044694 Bacteria 2420
245 Ga0466968_0090692 3300044735 Bacteria 1354
246 Ga0466957_0035928 3300044842 Bacteria 2976
247 Ga0466957_0056716 3300044842 Bacteria 2396
248 Ga0466957_0228143 3300044842 Bacteria 1232
249 Ga0466958_0238708 3300045836 Bacteria 1161
250 Ga0466967_0627808 3300045976 Bacteria 1061
251 Ga0495592_0022218 3300046454 Bacteria 4825
252 Ga0495592_0044030 3300046454 Bacteria 3337
253 Ga0495629_0007671 3300046459 Bacteria 7943
254 Ga0495638_0000880 3300046460 Bacteria 30953
255 Ga0495638_0232530 3300046460 Bacteria 1025
256 Ga0495651_0008760 3300046462 Bacteria 7760
257 Ga0495651_0040036 3300046462 Bacteria 3645
258 Ga0495651_0096249 3300046462 Bacteria 2212
259 Ga0495605_0114101 3300046474 Bacteria 1230
260 Ga0495664_0008828 3300046477 Bacteria 5631
261 Ga0495664_0027723 3300046477 Bacteria 3304
262 Ga0495585_0182818 3300046492 Bacteria 1077
263 Ga0495606_0001471 3300046507 Bacteria 31450
264 Ga0495608_0006267 3300046511 Bacteria 8436
265 Ga0495628_0038896 3300046516 Bacteria 3806
266 Ga0495628_0112660 3300046516 Bacteria 2091
267 Ga0495648_0001934 3300046524 Bacteria 19744
268 Ga0495640_0019643 3300046533 Bacteria 4983
269 Ga0495640_0038762 3300046533 Bacteria 3350
270 Ga0495587_0008831 3300046536 Bacteria 6466
271 Ga0495587_0032807 3300046536 Bacteria 3137
272 Ga0495645_0031591 3300046543 Bacteria 3859
273 Ga0495667_0052300 3300046559 Bacteria 2691
274 Ga0495634_0063737 3300046642 Bacteria 2445
275 Ga0495625_0138787 3300046660 Bacteria 1641
276 Ga0495635_0003485 3300046663 Bacteria 10875
277 Ga0495635_0026217 3300046663 Bacteria 4058
278 Ga0495635_0040741 3300046663 Bacteria 3209
279 Ga0495659_0021291 3300046664 Bacteria 2184
280 Ga0495657_0003047 3300046675 Bacteria 13866
281 Ga0495657_0036576 3300046675 Bacteria 3392
282 Ga0495599_0003206 3300046678 Bacteria 9534
283 Ga0495599_0012350 3300046678 Bacteria 5262
284 Ga0495646_0015426 3300046680 Bacteria 4850
285 Ga0495613_0047346 3300046689 Bacteria 3177
286 Ga0495600_0003090 3300046809 Bacteria 9727
287 Ga0495600_0064327 3300046809 Bacteria 2397
288 Ga0495604_0003808 3300047317 Bacteria 12011
289 Ga0495604_0006193 3300047317 Bacteria 9496
290 Ga0495674_0041493 3300047319 Bacteria 4110
291 Ga0495674_0144674 3300047319 Bacteria 1996
292 Ga0495672_0004164 3300047320 Bacteria 12008
293 Ga0495672_0010647 3300047320 Bacteria 6533
294 Ga0495676_0211376 3300047321 Bacteria 1342
295 Ga0495680_0002817 3300047322 Bacteria 17493
296 Ga0495680_0008874 3300047322 Bacteria 9092
297 Ga0495675_0004642 3300047444 Bacteria 8347
298 Ga0495675_0038465 3300047444 Bacteria 3046
299 Ga0495673_0089842 3300047469 Bacteria 1257
300 Ga0495684_0011885 3300047471 Bacteria 6715
301 Ga0495686_0031439 3300047472 Bacteria 3441
302 Ga0495686_0194862 3300047472 Bacteria 1166
303 Ga0495593_0000740 3300047673 Bacteria 18976
304 Ga0495602_0014115 3300048088 Bacteria 8123
305 Ga0496100_0060168 3300048903 Bacteria 2499
306 Ga0496101_0080684 3300048904 Bacteria 2404
307 Ga0496101_0142320 3300048904 Bacteria 1829
308 Ga0496102_0067179 3300048905 Bacteria 3288
309 Ga0496102_0110928 3300048905 Bacteria 2557
310 Ga0496104_0002017 3300048907 Bacteria 17626
311 Ga0496104_0034297 3300048907 Bacteria 4731
312 Ga0496105_0010240 3300048908 Bacteria 7371
313 Ga0496106_0002067 3300048909 Bacteria 15058
314 Ga0496106_0008113 3300048909 Bacteria 7756
315 Ga0496108_0000160 3300048911 Bacteria 64120
316 Ga0496108_0022344 3300048911 Bacteria 5200
317 Ga0496109_0000245 3300048912 Bacteria 52201
318 Ga0496109_0069128 3300048912 Bacteria 3238
319 Ga0496110_0041787 3300048913 Bacteria 4002
320 Ga0496112_0000018 3300048915 Bacteria 188820
321 Ga0496112_0003018 3300048915 Bacteria 13759
322 Ga0496112_0021930 3300048915 Bacteria 6078
323 Ga0496112_0075854 3300048915 Bacteria 3325
324 Ga0496113_0007747 3300048916 Bacteria 6935
325 Ga0496117_0012970 3300048920 Bacteria 7299
326 Ga0496118_0011919 3300048921 Bacteria 8414
327 Ga0496118_0019785 3300048921 Bacteria 6004
328 Ga0496118_0025690 3300048921 Bacteria 5041
329 Ga0496118_0056754 3300048921 Bacteria 2941
330 Ga0496120_0036819 3300048923 Bacteria 2908
331 Ga0496121_0000754 3300048924 Bacteria 59457
332 Ga0496121_0008230 3300048924 Bacteria 12349
333 Ga0496121_0011276 3300048924 Bacteria 9957
334 Ga0496121_0028354 3300048924 Bacteria 5213
335 Ga0496122_0097095 3300048925 Bacteria 1984
336 Ga0496124_0001369 3300048927 Bacteria 36505
337 Ga0496124_0153431 3300048927 Bacteria 1804
338 Ga0496125_0000207 3300048928 Bacteria 122897
339 Ga0496125_0000571 3300048928 Bacteria 63074
340 Ga0496125_0023754 3300048928 Bacteria 5652
341 Ga0496125_0101829 3300048928 Bacteria 2112
342 Ga0496126_0007899 3300048929 Bacteria 11583
343 Ga0496126_0039894 3300048929 Bacteria 4354
344 Ga0496126_0047110 3300048929 Bacteria 3948
345 Ga0496126_0106636 3300048929 Bacteria 2445
346 Ga0501031_0002803 3300049568 Bacteria 11123
347 Ga0501032_0001108 3300049569 Bacteria 21562
348 Ga0501032_0138326 3300049569 Bacteria 1604
349 Ga0501033_0000082 3300049570 Bacteria 89837
350 Ga0501033_0083898 3300049570 Bacteria 2335
351 Ga0501034_0000577 3300049571 Bacteria 58019
352 Ga0501034_0162794 3300049571 Bacteria 2201
353 Ga0501034_0233507 3300049571 Bacteria 1787
354 Ga0501036_0132358 3300049572 Bacteria 2105
355 Ga0501037_0000636 3300049573 Bacteria 27158
356 Ga0501038_0000234 3300049574 Bacteria 46892
357 Ga0501038_0075149 3300049574 Bacteria 2856
358 Ga0501038_0205628 3300049574 Bacteria 1578
359 Ga0501039_0000123 3300049575 Bacteria 53579
360 Ga0501042_0059782 3300049578 Bacteria 2722
361 Ga0501043_0022481 3300049579 Bacteria 4943
362 Ga0501046_0021709 3300049580 Bacteria 5295
363 Ga0501046_0121183 3300049580 Bacteria 1990
364 Ga0501046_0237333 3300049580 Bacteria 1346
365 Ga0501047_0000131 3300049581 Bacteria 91079
366 Ga0501047_0023892 3300049581 Bacteria 5870
367 Ga0501048_0000170 3300049582 Bacteria 40800
368 Ga0501068_0001508 3300049584 Bacteria 12400
369 Ga0501070_0026223 3300049586 Bacteria 4892
370 Ga0501070_0042209 3300049586 Bacteria 3799
371 Ga0501070_0444179 3300049586 Bacteria 1046
372 Ga0501071_0016663 3300049587 Bacteria 5055
373 Ga0501071_0316469 3300049587 Bacteria 1185
374 Ga0501072_0000393 3300049588 Bacteria 31319
375 Ga0501073_0000062 3300049589 Bacteria 66884
376 Ga0501073_0105659 3300049589 Bacteria 1954
377 Ga0501074_0000055 3300049590 Bacteria 55557
378 Ga0501074_0023981 3300049590 Bacteria 4434
379 Ga0501074_0067492 3300049590 Bacteria 2572
380 Ga0501079_0000344 3300049741 Bacteria 29520
381 Ga0501080_0009294 3300049742 Bacteria 8964
382 Ga0501080_0229900 3300049742 Bacteria 1695
383 Ga0501083_0000199 3300049744 Bacteria 38479
384 Ga0501035_0000123 3300049822 Bacteria 93734
385 Ga0501035_0111999 3300049822 Bacteria 2391
386 Ga0501044_0000329 3300049823 Bacteria 59853
387 Ga0501044_0017585 3300049823 Bacteria 7669
388 Ga0501044_0124655 3300049823 Bacteria 2574
389 nmdc:mga03n38_66264_c1 3300050490 Bacteria 1658
390 nmdc:mga0k408_69684_c1 3300050493 Bacteria 2053
391 nmdc:mga06z11_255696_c1 3300050494 Bacteria 1032
392 nmdc:mga07m45_28492_c1 3300050496 Bacteria 3083
393 nmdc:mga0sz30_38947_c1 3300050516 Bacteria 1993
394 Ga0495601_0004083 3300053077 Bacteria 8421
395 Ga0500635_0001630 3300053080 Bacteria 5410
396 Ga0495595_0001468 3300053084 Bacteria 9210
397 Ga0495619_0002627 3300053085 Bacteria 11737
398 Ga0500643_000112 3300053087 Bacteria 84793
399 Ga0500646_0025937 3300053090 Bacteria 1586
400 Ga0500647_0041511 3300053091 Bacteria 2207
401 Ga0500583_0097404 3300053092 Bacteria 1437
402 Ga0500651_0098602 3300053093 Bacteria 1793
403 Ga0500566_0000262 3300053094 Bacteria 28125
404 Ga0500566_0001195 3300053094 Bacteria 15155
405 Ga0500640_013264 3300053095 Bacteria 3404
406 Ga0500557_000021 3300053105 Bacteria 89662
407 Ga0500595_020565 3300053119 Bacteria 2372
408 Ga0500595_026631 3300053119 Bacteria 1990
409 Ga0500595_039159 3300053119 Bacteria 1535
410 Ga0500618_047508 3300053125 Bacteria 976
411 Ga0500642_0000583 3300053130 Bacteria 10905
412 Ga0500590_022652 3300053148 Bacteria 3265
413 Ga0500619_074693 3300053154 Bacteria 1132
414 Ga0500622_0048224 3300053156 Bacteria 2198
415 Ga0500639_047211 3300053163 Bacteria 2249
416 Ga0500636_0049762 3300053177 Bacteria 2465
417 Ga0500637_0007260 3300053178 Bacteria 5528
418 Ga0500637_0009209 3300053178 Bacteria 5016
419 Ga0500596_001422 3300053735 Bacteria 4836
420 Ga0500599_002162 3300053736 Bacteria 2338
421 Ga0501084_0019273 3300054114 Bacteria 5682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0077060 Ga0373925_0077060_568_1605 252
2 3300010375 Ga0105239_10230791 Ga0105239_102307912 269
3 3300033179 Ga0307507_10043368 Ga0307507_100433684 269
4 3300035692 Ga0373935_0118114 Ga0373935_0118114_99_1016 269
5 3300035695 Ga0373927_0009886 Ga0373927_0009886_4368_5285 269
6 3300048909 Ga0496106_0008113 Ga0496106_0008113_283_1272 269
7 3300048920 Ga0496117_0012970 Ga0496117_0012970_1792_2781 269
8 3300048921 Ga0496118_0011919 Ga0496118_0011919_4377_5366 269
9 3300048924 Ga0496121_0008230 Ga0496121_0008230_10230_11219 269
10 3300048927 Ga0496124_0001369 Ga0496124_0001369_31010_31999 269
11 3300048928 Ga0496125_0023754 Ga0496125_0023754_1441_2430 269
12 3300048929 Ga0496126_0039894 Ga0496126_0039894_2386_3375 269
13 3300026121 Ga0207683_10274301 Ga0207683_102743012 270
14 3300031507 Ga0307509_10176924 Ga0307509_101769242 272
15 3300005983 Ga0081540_1012681 Ga0081540_10126817 273
16 3300047469 Ga0495673_0089842 Ga0495673_0089842_211_1179 274
17 3300035086 Ga0373934_0029624 Ga0373934_0029624_1181_2098 279
18 3300005983 Ga0081540_1066657 Ga0081540_10666571 287
19 3300005937 Ga0081455_10157700 Ga0081455_101577002 288
20 3300025913 Ga0207695_10106336 Ga0207695_101063364 288
21 3300028573 Ga0265334_10012836 Ga0265334_100128363 288
22 3300046660 Ga0495625_0138787 Ga0495625_0138787_16_882 288
23 3300005439 Ga0070711_100011004 Ga0070711_1000110044 289
24 3300005458 Ga0070681_10062944 Ga0070681_100629444 289
25 3300005530 Ga0070679_100063924 Ga0070679_1000639242 289
26 3300005563 Ga0068855_100049264 Ga0068855_1000492644 289
27 3300009093 Ga0105240_10147214 Ga0105240_101472144 289
28 3300013104 Ga0157370_10277641 Ga0157370_102776412 289
29 3300013105 Ga0157369_10116637 Ga0157369_101166373 289
30 3300025912 Ga0207707_10054240 Ga0207707_100542402 289
31 3300025913 Ga0207695_10161705 Ga0207695_101617051 289
32 3300025949 Ga0207667_10015124 Ga0207667_100151248 289
33 3300026041 Ga0207639_10187886 Ga0207639_101878862 289
34 3300005330 Ga0070690_100088529 Ga0070690_1000885293 290
35 3300005347 Ga0070668_100061368 Ga0070668_1000613682 290
36 3300005441 Ga0070700_100077011 Ga0070700_1000770112 290
37 3300005455 Ga0070663_100031844 Ga0070663_1000318444 290
38 3300005459 Ga0068867_100014350 Ga0068867_1000143502 290
39 3300005719 Ga0068861_100059368 Ga0068861_1000593682 290
40 3300009094 Ga0111539_10203041 Ga0111539_102030413 290
41 3300025972 Ga0207668_10025372 Ga0207668_100253724 290
42 3300026118 Ga0207675_100098545 Ga0207675_1000985452 290
43 3300028380 Ga0268265_10147487 Ga0268265_101474873 290
44 3300046474 Ga0495605_0114101 Ga0495605_0114101_136_1050 290
45 3300046492 Ga0495585_0182818 Ga0495585_0182818_80_994 290
46 3300046664 Ga0495659_0021291 Ga0495659_0021291_379_1293 290
47 3300048904 Ga0496101_0142320 Ga0496101_0142320_423_1337 290
48 3300048905 Ga0496102_0067179 Ga0496102_0067179_1510_2424 290
49 3300021384 Ga0213876_10058904 Ga0213876_100589042 291
50 3300039437 Ga0436365_1415755 Ga0436365_1415755_3794_4711 291
51 3300005435 Ga0070714_100038947 Ga0070714_1000389473 292
52 3300005436 Ga0070713_100116702 Ga0070713_1001167022 292
53 3300005937 Ga0081455_10036566 Ga0081455_100365662 292
54 3300025928 Ga0207700_10262439 Ga0207700_102624392 292
55 3300025929 Ga0207664_10040011 Ga0207664_100400112 292
56 3300048915 Ga0496112_0075854 Ga0496112_0075854_514_1431 293
57 3300053178 Ga0500637_0009209 Ga0500637_0009209_1739_2665 293
58 3300053091 Ga0500647_0041511 Ga0500647_0041511_45_971 294
59 3300053094 Ga0500566_0001195 Ga0500566_0001195_9505_10431 294
60 3300053148 Ga0500590_022652 Ga0500590_022652_49_975 294
61 3300047472 Ga0495686_0031439 Ga0495686_0031439_305_1216 295
62 3300053095 Ga0500640_013264 Ga0500640_013264_2344_3270 295
63 3300053163 Ga0500639_047211 Ga0500639_047211_503_1429 295
64 iso_pu_bacteria 2941531003 2941535312 295
65 3300046462 Ga0495651_0096249 Ga0495651_0096249_711_1625 297
66 iso_pu_bacteria 2824773399 2824781387 297
67 3300003203 JGI25406J46586_10047459 JGI25406J46586_100474592 298
68 3300005435 Ga0070714_100347843 Ga0070714_1003478432 298
69 3300005985 Ga0081539_10010443 Ga0081539_100104436 298
70 3300006051 Ga0075364_10035246 Ga0075364_100352462 298
71 3300006177 Ga0075362_10000843 Ga0075362_100008434 298
72 3300006195 Ga0075366_10009232 Ga0075366_100092326 298
73 3300031616 Ga0307508_10014712 Ga0307508_100147122 298
74 3300047321 Ga0495676_0211376 Ga0495676_0211376_212_1126 298
75 3300050490 nmdc:mga03n38_66264_c1 nmdc:mga03n38_66264_c1_325_1236 298
76 3300050493 nmdc:mga0k408_69684_c1 nmdc:mga0k408_69684_c1_1098_2009 298
77 3300050516 nmdc:mga0sz30_38947_c1 nmdc:mga0sz30_38947_c1_423_1334 298
78 3300031247 Ga0265340_10010016 Ga0265340_100100162 300
79 iso_pu_bacteria 2507262055 2507505480 300
80 iso_pu_bacteria 2508501009 2508539365 300
81 iso_pu_bacteria 2508501042 2508695695 300
82 iso_pu_bacteria 2513237092 2513623893 300
83 iso_pu_bacteria 2513237094 2513642223 300
84 iso_pu_bacteria 2513237096 2513659539 300
85 iso_pu_bacteria 2513237098 2513671860 300
86 iso_pu_bacteria 2513237101 2513695321 300
87 iso_pu_bacteria 2513237104 2513718273 300
88 iso_pu_bacteria 2513237137 2513859355 300
89 iso_pu_bacteria 2513237139 2513873315 300
90 iso_pu_bacteria 2513237145 2513921528 300
91 iso_pu_bacteria 2513237161 2514014644 300
92 iso_pu_bacteria 2515154112 2515627677 300
93 iso_pu_bacteria 2517093001 2517106245 300
94 iso_pu_bacteria 2524023210 2524469737 300
95 iso_pu_bacteria 2524023228 2524537515 300
96 iso_pu_bacteria 2528768022 2528852700 300
97 iso_pu_bacteria 2617270735 2617352029 300
98 iso_pu_bacteria 2617270741 2617373499 300
99 iso_pu_bacteria 2667528175 2671124069 300
100 iso_pu_bacteria 2721755755 2723841854 300
101 iso_pu_bacteria 2728368998 2728755256 300
102 iso_pu_bacteria 2791355196 2793062270 300
103 iso_pu_bacteria 2791355197 2793072681 300
104 iso_pu_bacteria 2791355199 2793078271 300
105 iso_pu_bacteria 2802429603 2805920663 300
106 iso_pu_bacteria 2824600985 2824604392 300
107 iso_pu_bacteria 2824609381 2824614878 300
108 iso_pu_bacteria 2824653114 2824656326 300
109 iso_pu_bacteria 2824661429 2824667263 300
110 iso_pu_bacteria 2824671348 2824671783 300
111 iso_pu_bacteria 2824679649 2824684708 300
112 iso_pu_bacteria 2824687955 2824688535 300
113 iso_pu_bacteria 2824696289 2824703172 300
114 iso_pu_bacteria 2824704595 2824710348 300
115 iso_pu_bacteria 2824732956 2824737648 300
116 iso_pu_bacteria 2824746037 2824751170 300
117 iso_pu_bacteria 2824753945 2824760684 300
118 iso_pu_bacteria 2824763712 2824768488 300
119 iso_pu_bacteria 2824773399 2824779962 300
120 iso_pu_bacteria 2838122688 2838124731 300
121 iso_pu_bacteria 2841941048 2841945423 300
122 iso_pu_bacteria 2841949485 2841952209 300
123 iso_pu_bacteria 2841957949 2841965315 300
124 iso_pu_bacteria 2841966195 2841970401 300
125 iso_pu_bacteria 2841974524 2841981653 300
126 iso_pu_bacteria 2841983080 2841984933 300
127 iso_pu_bacteria 2844315083 2844315577 300
128 iso_pu_bacteria 2847930680 2847931279 300
129 iso_pu_bacteria 2847939898 2847942373 300
130 iso_pu_bacteria 2849076700 2849083247 300
131 iso_pu_bacteria 2857509624 2857516321 300
132 iso_pu_bacteria 2874590934 2874592517 300
133 iso_pu_bacteria 2874604998 2874607855 300
134 iso_pu_bacteria 2874612657 2874618675 300
135 iso_pu_bacteria 2874620515 2874621170 300
136 iso_pu_bacteria 2874645413 2874647136 300
137 iso_pu_bacteria 2876761206 2876769674 300
138 iso_pu_bacteria 2876771140 2876772520 300
139 iso_pu_bacteria 2876808645 2876809316 300
140 iso_pu_bacteria 2876818435 2876819781 300
141 iso_pu_bacteria 2879074833 2879076287 300
142 iso_pu_bacteria 2879083081 2879083801 300
143 iso_pu_bacteria 2879099564 2879101958 300
144 iso_pu_bacteria 2879110137 2879113274 300
145 iso_pu_bacteria 2879127579 2879128771 300
146 iso_pu_bacteria 2879142872 2879142899 300
147 iso_pu_bacteria 2881364244 2881368958 300
148 iso_pu_bacteria 2881665667 2881672939 300
149 iso_pu_bacteria 2885374607 2885377586 300
150 iso_pu_bacteria 2885383462 2885388216 300
151 iso_pu_bacteria 2885409591 2885417972 300
152 iso_pu_bacteria 2888388044 2888390469 300
153 iso_pu_bacteria 2888419890 2888420091 300
154 iso_pu_bacteria 2889033259 2889035272 300
155 iso_pu_bacteria 2903727486 2903733514 300
156 iso_pu_bacteria 2903748898 2903758767 300
157 iso_pu_bacteria 2903768456 2903774025 300
158 iso_pu_bacteria 2904666416 2904667715 300
159 iso_pu_bacteria 2904690495 2904690976 300
160 iso_pu_bacteria 2904699407 2904708371 300
161 iso_pu_bacteria 2904711408 2904716296 300
162 iso_pu_bacteria 2906602504 2906608868 300
163 iso_pu_bacteria 2906610324 2906613541 300
164 iso_pu_bacteria 2906626472 2906631704 300
165 iso_pu_bacteria 2906635258 2906642602 300
166 iso_pu_bacteria 2906660503 2906668078 300
167 iso_pu_bacteria 2908739725 2908747683 300
168 iso_pu_bacteria 2908756301 2908757034 300
169 iso_pu_bacteria 2908775508 2908775970 300
170 iso_pu_bacteria 2922361189 2922363242 300
171 iso_pu_bacteria 2922368715 2922369350 300
172 iso_pu_bacteria 2922386360 2922388454 300
173 iso_pu_bacteria 2922393267 2922396549 300
174 iso_pu_bacteria 2922425934 2922433982 300
175 iso_pu_bacteria 2929615660 2929618819 300
176 iso_pu_bacteria 2929624759 2929628496 300
177 iso_pu_bacteria 2932794094 2932794112 300
178 iso_pu_bacteria 2932801729 2932809187 300
179 iso_pu_bacteria 2932809354 2932816224 300
180 iso_pu_bacteria 2932818245 2932827631 300
181 iso_pu_bacteria 2932828146 2932833714 300
182 iso_pu_bacteria 2933577622 2933580471 300
183 iso_pu_bacteria 2935608549 2935615489 300
184 iso_pu_bacteria 2935616580 2935623240 300
185 iso_pu_bacteria 2935630451 2935636010 300
186 iso_pu_bacteria 2935648319 2935654418 300
187 iso_pu_bacteria 2935656913 2935663298 300
188 iso_pu_bacteria 2935665750 2935674956 300
189 iso_pu_bacteria 2935675223 2935679375 300
190 iso_pu_bacteria 2935684952 2935686617 300
191 iso_pu_bacteria 2935694250 2935700400 300
192 iso_pu_bacteria 2935713505 2935716305 300
193 iso_pu_bacteria 2935722832 2935723571 300
194 iso_pu_bacteria 2935732158 2935735126 300
195 iso_pu_bacteria 2935741537 2935744083 300
196 iso_pu_bacteria 2935750917 2935752583 300
197 iso_pu_bacteria 2935760218 2935763281 300
198 iso_pu_bacteria 2935769743 2935774256 300
199 iso_pu_bacteria 2935777560 2935785134 300
200 iso_pu_bacteria 2935785616 2935789029 300
201 iso_pu_bacteria 2935793552 2935796779 300
202 iso_pu_bacteria 2935801545 2935808339 300
203 iso_pu_bacteria 2935819856 2935825710 300
204 iso_pu_bacteria 2935837841 2935846001 300
205 iso_pu_bacteria 2935847175 2935853474 300
206 iso_pu_bacteria 2935855204 2935861488 300
207 iso_pu_bacteria 2935864058 2935869607 300
208 iso_pu_bacteria 2935873716 2935879936 300
209 iso_pu_bacteria 2935883170 2935889139 300
210 iso_pu_bacteria 2935908558 2935915076 300
211 iso_pu_bacteria 2935916978 2935918924 300
212 iso_pu_bacteria 2935926038 2935931359 300
213 iso_pu_bacteria 2935934488 2935939956 300
214 iso_pu_bacteria 2935942939 2935947697 300
215 iso_pu_bacteria 2935951376 2935956468 300
216 iso_pu_bacteria 2935959822 2935966685 300
217 iso_pu_bacteria 2935967501 2935973262 300
218 iso_pu_bacteria 2935975950 2935980494 300
219 iso_pu_bacteria 2935984226 2935990155 300
220 iso_pu_bacteria 2936002035 2936008894 300
221 iso_pu_bacteria 2936011229 2936017543 300
222 iso_pu_bacteria 2936019824 2936025956 300
223 iso_pu_bacteria 2936028420 2936034798 300
224 iso_pu_bacteria 2936037263 2936041054 300
225 iso_pu_bacteria 2936046547 2936052944 300
226 iso_pu_bacteria 2936055302 2936060197 300
227 iso_pu_bacteria 2940556831 2940558496 300
228 iso_pu_bacteria 2941507105 2941512686 300
229 iso_pu_bacteria 2941515067 2941520476 300
230 iso_pu_bacteria 2941523033 2941528490 300
231 iso_pu_bacteria 3005474847 3005475304 300
232 iso_pu_bacteria 3005483717 3005486641 300
233 iso_pu_bacteria 3005506211 3005508947 300
234 iso_pu_bacteria 3005594810 3005595268 300
235 iso_pu_bacteria 3005710791 3005711214 300
236 iso_pu_bacteria 3005718088 3005718515 300
237 iso_pu_bacteria 8006926726 8006927282 300
238 iso_pu_bacteria 8006933436 8006935973 300
239 iso_pu_bacteria 8006964411 8006967672 300
240 iso_pu_bacteria 8006973647 8006975903 300
241 iso_pu_bacteria 8006984368 8006991138 300
242 iso_pu_bacteria 8006994254 8007000471 300
243 iso_pu_bacteria 8016522445 8016526361 300
244 iso_pu_bacteria 8016530956 8016531428 300
245 iso_pu_bacteria 8016539877 8016544640 300
246 iso_pu_bacteria 8016548790 8016557438 300
247 iso_pu_bacteria 8016557553 8016565793 300
248 iso_pu_bacteria 8016566248 8016569695 300
249 iso_pu_bacteria 8016575299 8016582300 300
250 iso_pu_bacteria 8016583857 8016586112 300
251 iso_pu_bacteria 8016613128 8016618235 300
252 iso_pu_bacteria 8016622563 8016622884 300
253 iso_pu_bacteria 8016630954 8016635392 300
254 iso_pu_bacteria 8017057580 8017058682 300
255 iso_pu_bacteria 8019530166 8019531260 300
256 iso_pu_bacteria 8019538911 8019540294 300
257 iso_pu_bacteria 8019547302 8019549882 300
258 iso_pu_bacteria 8019555841 8019562684 300
259 iso_pu_bacteria 8019565922 8019572765 300
260 iso_pu_bacteria 8019619141 8019623197 300
261 iso_pu_bacteria 8019648815 8019652248 300
262 iso_pu_bacteria 8019659431 8019666736 300
263 iso_pu_bacteria 8019678201 8019679495 300
264 iso_pu_bacteria 8019687851 8019696016 300
265 iso_pu_bacteria 8055742211 8055742668 300
266 iso_pu_bacteria 8056673599 8056676177 300
267 iso_pu_bacteria 8056689827 8056693809 300
268 iso_pu_bacteria 8056967851 8056971526 300
269 iso_pu_bacteria 2721755755 2723844242 301
270 iso_pu_bacteria 2824617872 2824620998 301
271 iso_pu_bacteria 2824626560 2824629947 301
272 iso_pu_bacteria 2824635225 2824636312 301
273 iso_pu_bacteria 2824644064 2824648601 301
274 iso_pu_bacteria 2824704595 2824704596 301
275 iso_pu_bacteria 2824714736 2824718497 301
276 iso_pu_bacteria 2824723954 2824724506 301
277 3300005366 Ga0070659_100016068 Ga0070659_1000160685 302
278 3300005539 Ga0068853_100009728 Ga0068853_1000097287 302
279 3300005563 Ga0068855_100030586 Ga0068855_1000305864 302
280 3300013100 Ga0157373_10045181 Ga0157373_100451813 302
281 3300013104 Ga0157370_10051513 Ga0157370_100515132 302
282 3300025909 Ga0207705_10009249 Ga0207705_100092495 302
283 3300025919 Ga0207657_10000700 Ga0207657_1000070015 302
284 3300025921 Ga0207652_10174009 Ga0207652_101740092 302
285 3300025949 Ga0207667_10080807 Ga0207667_100808074 302
286 3300031249 Ga0265339_10058595 Ga0265339_100585952 302
287 3300038443 Ga0395901_0484469 Ga0395901_0484469_153_1064 302
288 3300048924 Ga0496121_0011276 Ga0496121_0011276_69_980 302
289 3300048925 Ga0496122_0097095 Ga0496122_0097095_1047_1958 302
290 3300048928 Ga0496125_0000207 Ga0496125_0000207_48104_49015 302
291 3300048928 Ga0496125_0000571 Ga0496125_0000571_47145_48056 302
292 3300049571 Ga0501034_0162794 Ga0501034_0162794_898_1809 302
293 3300049572 Ga0501036_0132358 Ga0501036_0132358_143_1054 302
294 3300049580 Ga0501046_0121183 Ga0501046_0121183_420_1331 302
295 3300053125 Ga0500618_047508 Ga0500618_047508_12_923 302
296 3300005339 Ga0070660_100048164 Ga0070660_1000481643 303
297 3300047320 Ga0495672_0004164 Ga0495672_0004164_11025_11939 303
298 3300047320 Ga0495672_0010647 Ga0495672_0010647_5440_6354 303
299 3300049570 Ga0501033_0083898 Ga0501033_0083898_937_1851 303
300 3300049571 Ga0501034_0233507 Ga0501034_0233507_709_1623 303
301 3300049574 Ga0501038_0205628 Ga0501038_0205628_485_1399 303
302 3300049822 Ga0501035_0111999 Ga0501035_0111999_727_1641 303
303 3300049823 Ga0501044_0124655 Ga0501044_0124655_1154_2068 303
304 3300003215 JGI25153J46596_10021483 JGI25153J46596_100214833 304
305 3300003354 JGI25160J50197_1005512 JGI25160J50197_10055123 304
306 3300003762 Ga0055542_1006352 Ga0055542_10063522 304
307 3300005262 Ga0065165_1007492 Ga0065165_10074924 304
308 3300005347 Ga0070668_100145114 Ga0070668_1001451142 304
309 3300005356 Ga0070674_100075415 Ga0070674_1000754152 304
310 3300005456 Ga0070678_100287030 Ga0070678_1002870302 304
311 3300005539 Ga0068853_100305003 Ga0068853_1003050031 304
312 3300005547 Ga0070693_100170503 Ga0070693_1001705031 304
313 3300005578 Ga0068854_100336271 Ga0068854_1003362712 304
314 3300005614 Ga0068856_100000651 Ga0068856_10000065135 304
315 3300005719 Ga0068861_100155546 Ga0068861_1001555462 304
316 3300005844 Ga0068862_100612693 Ga0068862_1006126931 304
317 3300005937 Ga0081455_10015012 Ga0081455_100150127 304
318 3300005937 Ga0081455_10024524 Ga0081455_100245241 304
319 3300005981 Ga0081538_10084935 Ga0081538_100849352 304
320 3300005983 Ga0081540_1003056 Ga0081540_100305617 304
321 3300005983 Ga0081540_1005177 Ga0081540_10051776 304
322 3300005983 Ga0081540_1008688 Ga0081540_10086886 304
323 3300005983 Ga0081540_1093375 Ga0081540_10933752 304
324 3300006042 Ga0075368_10103887 Ga0075368_101038871 304
325 3300006186 Ga0075369_10051973 Ga0075369_100519732 304
326 3300006353 Ga0075370_10013839 Ga0075370_100138392 304
327 3300006941 Ga0099825_1030311 Ga0099825_10303113 304
328 3300009093 Ga0105240_10045699 Ga0105240_100456994 304
329 3300009098 Ga0105245_10141777 Ga0105245_101417772 304
330 3300013297 Ga0157378_10002715 Ga0157378_100027151 304
331 3300013306 Ga0163162_10456865 Ga0163162_104568651 304
332 3300014745 Ga0157377_10158429 Ga0157377_101584292 304
333 3300014969 Ga0157376_10431457 Ga0157376_104314571 304
334 3300021320 Ga0214544_1012884 Ga0214544_10128843 304
335 3300021321 Ga0214542_1012745 Ga0214542_10127453 304
336 3300021327 Ga0214543_1013104 Ga0214543_10131043 304
337 3300025230 Ga0209563_100389 Ga0209563_10038910 304
338 3300025253 Ga0209677_104684 Ga0209677_1046844 304
339 3300025254 Ga0209148_1000418 Ga0209148_100041819 304
340 3300025272 Ga0209455_1005058 Ga0209455_10050585 304
341 3300025273 Ga0209673_1030134 Ga0209673_10301342 304
342 3300025295 Ga0209564_1003322 Ga0209564_10033228 304
343 3300025297 Ga0209758_1016078 Ga0209758_10160782 304
344 3300025297 Ga0209758_1026750 Ga0209758_10267503 304
345 3300025302 Ga0207426_1007219 Ga0207426_10072194 304
346 3300025913 Ga0207695_10000148 Ga0207695_1000014853 304
347 3300025914 Ga0207671_10158504 Ga0207671_101585042 304
348 3300025927 Ga0207687_10109551 Ga0207687_101095512 304
349 3300025935 Ga0207709_10154386 Ga0207709_101543862 304
350 3300025961 Ga0207712_10143627 Ga0207712_101436272 304
351 3300025986 Ga0207658_10222486 Ga0207658_102224861 304
352 3300026078 Ga0207702_10000546 Ga0207702_1000054635 304
353 3300026089 Ga0207648_10068399 Ga0207648_100683992 304
354 3300026118 Ga0207675_100449625 Ga0207675_1004496251 304
355 3300026118 Ga0207675_100646951 Ga0207675_1006469511 304
356 3300026142 Ga0207698_10184690 Ga0207698_101846901 304
357 3300026142 Ga0207698_10409050 Ga0207698_104090501 304
358 3300027296 Ga0209389_1000102 Ga0209389_100010226 304
359 3300027361 Ga0209489_100404 Ga0209489_10040426 304
360 3300027363 Ga0209700_100408 Ga0209700_10040826 304
361 3300028379 Ga0268266_10111810 Ga0268266_101118103 304
362 3300028380 Ga0268265_10450835 Ga0268265_104508351 304
363 3300033180 Ga0307510_10006006 Ga0307510_100060068 304
364 3300044658 Ga0466972_0000306 Ga0466972_0000306_16161_17075 304
365 3300044693 Ga0466961_0000770 Ga0466961_0000770_35_949 304
366 3300044694 Ga0466963_0066403 Ga0466963_0066403_1271_2185 304
367 3300044842 Ga0466957_0228143 Ga0466957_0228143_55_969 304
368 3300046454 Ga0495592_0044030 Ga0495592_0044030_1426_2340 304
369 3300046460 Ga0495638_0000880 Ga0495638_0000880_20380_21294 304
370 3300046462 Ga0495651_0008760 Ga0495651_0008760_5577_6491 304
371 3300046477 Ga0495664_0008828 Ga0495664_0008828_3227_4141 304
372 3300046507 Ga0495606_0001471 Ga0495606_0001471_21500_22450 304
373 3300046516 Ga0495628_0038896 Ga0495628_0038896_2059_2973 304
374 3300046533 Ga0495640_0038762 Ga0495640_0038762_200_1114 304
375 3300046536 Ga0495587_0032807 Ga0495587_0032807_260_1174 304
376 3300046543 Ga0495645_0031591 Ga0495645_0031591_1829_2743 304
377 3300046559 Ga0495667_0052300 Ga0495667_0052300_282_1196 304
378 3300046642 Ga0495634_0063737 Ga0495634_0063737_750_1664 304
379 3300046663 Ga0495635_0026217 Ga0495635_0026217_144_1058 304
380 3300046663 Ga0495635_0040741 Ga0495635_0040741_1169_2083 304
381 3300046675 Ga0495657_0036576 Ga0495657_0036576_774_1688 304
382 3300046678 Ga0495599_0012350 Ga0495599_0012350_1502_2416 304
383 3300046809 Ga0495600_0064327 Ga0495600_0064327_883_1797 304
384 3300047317 Ga0495604_0003808 Ga0495604_0003808_10830_11744 304
385 3300047319 Ga0495674_0041493 Ga0495674_0041493_3105_4019 304
386 3300047322 Ga0495680_0008874 Ga0495680_0008874_7271_8185 304
387 3300047444 Ga0495675_0038465 Ga0495675_0038465_1516_2430 304
388 3300048903 Ga0496100_0060168 Ga0496100_0060168_605_1519 304
389 3300048907 Ga0496104_0002017 Ga0496104_0002017_6654_7568 304
390 3300048908 Ga0496105_0010240 Ga0496105_0010240_4400_5314 304
391 3300048923 Ga0496120_0036819 Ga0496120_0036819_490_1404 304
392 3300048927 Ga0496124_0153431 Ga0496124_0153431_122_1036 304
393 3300048928 Ga0496125_0101829 Ga0496125_0101829_199_1113 304
394 3300050494 nmdc:mga06z11_255696_c1 nmdc:mga06z11_255696_c1_65_979 304
395 3300050496 nmdc:mga07m45_28492_c1 nmdc:mga07m45_28492_c1_1040_1954 304
396 3300053087 Ga0500643_000112 Ga0500643_000112_45173_46087 304
397 3300053090 Ga0500646_0025937 Ga0500646_0025937_236_1150 304
398 3300053092 Ga0500583_0097404 Ga0500583_0097404_14_928 304
399 3300053094 Ga0500566_0000262 Ga0500566_0000262_23486_24400 304
400 3300053105 Ga0500557_000021 Ga0500557_000021_72088_73002 304
401 3300053119 Ga0500595_026631 Ga0500595_026631_726_1640 304
402 3300053130 Ga0500642_0000583 Ga0500642_0000583_8387_9301 304
403 3300053156 Ga0500622_0048224 Ga0500622_0048224_183_1097 304
404 3300053736 Ga0500599_002162 Ga0500599_002162_405_1319 304
405 iso_pu_bacteria 2744054633 2745077606 304
406 iso_pu_bacteria 2906643746 2906648368 304
407 3300003203 JGI25406J46586_10000028 JGI25406J46586_1000002815 305
408 3300005329 Ga0070683_100006154 Ga0070683_1000061547 305
409 3300005336 Ga0070680_100129552 Ga0070680_1001295521 305
410 3300005366 Ga0070659_100016790 Ga0070659_1000167904 305
411 3300005434 Ga0070709_10000164 Ga0070709_1000016438 305
412 3300005434 Ga0070709_10001896 Ga0070709_100018962 305
413 3300005434 Ga0070709_10086698 Ga0070709_100866982 305
414 3300005434 Ga0070709_10153727 Ga0070709_101537272 305
415 3300005434 Ga0070709_10175776 Ga0070709_101757762 305
416 3300005435 Ga0070714_100001570 Ga0070714_10000157014 305
417 3300005435 Ga0070714_100006027 Ga0070714_1000060275 305
418 3300005436 Ga0070713_100004073 Ga0070713_1000040737 305
419 3300005436 Ga0070713_100009622 Ga0070713_1000096224 305
420 3300005436 Ga0070713_100265251 Ga0070713_1002652512 305
421 3300005437 Ga0070710_10000739 Ga0070710_1000073911 305
422 3300005437 Ga0070710_10016066 Ga0070710_100160664 305
423 3300005439 Ga0070711_100001284 Ga0070711_10000128411 305
424 3300005439 Ga0070711_100017891 Ga0070711_1000178912 305
425 3300005439 Ga0070711_100042983 Ga0070711_1000429833 305
426 3300005439 Ga0070711_100049129 Ga0070711_1000491292 305
427 3300005455 Ga0070663_100048039 Ga0070663_1000480394 305
428 3300005458 Ga0070681_10114581 Ga0070681_101145814 305
429 3300005458 Ga0070681_10214341 Ga0070681_102143411 305
430 3300005467 Ga0070706_100079195 Ga0070706_1000791953 305
431 3300005530 Ga0070679_100033349 Ga0070679_1000333494 305
432 3300005535 Ga0070684_100028558 Ga0070684_1000285585 305
433 3300005547 Ga0070693_100261828 Ga0070693_1002618281 305
434 3300005563 Ga0068855_100077011 Ga0068855_1000770115 305
435 3300005614 Ga0068856_100028103 Ga0068856_1000281036 305
436 3300005616 Ga0068852_100022926 Ga0068852_1000229263 305
437 3300005618 Ga0068864_100233462 Ga0068864_1002334621 305
438 3300005985 Ga0081539_10000048 Ga0081539_10000048200 305
439 3300006028 Ga0070717_10040761 Ga0070717_100407614 305
440 3300006028 Ga0070717_10083530 Ga0070717_100835303 305
441 3300006028 Ga0070717_10099985 Ga0070717_100999852 305
442 3300006028 Ga0070717_10326071 Ga0070717_103260712 305
443 3300006163 Ga0070715_10003674 Ga0070715_100036745 305
444 3300006163 Ga0070715_10017909 Ga0070715_100179093 305
445 3300006173 Ga0070716_100007420 Ga0070716_1000074207 305
446 3300006173 Ga0070716_100112934 Ga0070716_1001129342 305
447 3300006175 Ga0070712_100069248 Ga0070712_1000692482 305
448 3300006175 Ga0070712_100196331 Ga0070712_1001963312 305
449 3300007788 Ga0099795_10009703 Ga0099795_100097034 305
450 3300009093 Ga0105240_10568205 Ga0105240_105682051 305
451 3300009545 Ga0105237_10616764 Ga0105237_106167641 305
452 3300009551 Ga0105238_10079650 Ga0105238_100796503 305
453 3300010375 Ga0105239_10010622 Ga0105239_100106222 305
454 3300013102 Ga0157371_10065110 Ga0157371_100651102 305
455 3300013104 Ga0157370_10105143 Ga0157370_101051432 305
456 3300013105 Ga0157369_10273725 Ga0157369_102737251 305
457 3300013306 Ga0163162_10023717 Ga0163162_100237176 305
458 3300013307 Ga0157372_10042512 Ga0157372_100425123 305
459 3300014325 Ga0163163_10078698 Ga0163163_100786984 305
460 3300025253 Ga0209677_100521 Ga0209677_1005215 305
461 3300025261 Ga0209233_1001987 Ga0209233_10019872 305
462 3300025272 Ga0209455_1004235 Ga0209455_10042355 305
463 3300025297 Ga0209758_1001512 Ga0209758_100151218 305
464 3300025321 Ga0207656_10001743 Ga0207656_100017434 305
465 3300025898 Ga0207692_10001768 Ga0207692_100017683 305
466 3300025898 Ga0207692_10033011 Ga0207692_100330111 305
467 3300025905 Ga0207685_10018407 Ga0207685_100184072 305
468 3300025905 Ga0207685_10051187 Ga0207685_100511872 305
469 3300025906 Ga0207699_10000184 Ga0207699_1000018413 305
470 3300025906 Ga0207699_10023773 Ga0207699_100237731 305
471 3300025906 Ga0207699_10040069 Ga0207699_100400692 305
472 3300025906 Ga0207699_10090977 Ga0207699_100909771 305
473 3300025906 Ga0207699_10135906 Ga0207699_101359061 305
474 3300025906 Ga0207699_10151145 Ga0207699_101511452 305
475 3300025910 Ga0207684_10355690 Ga0207684_103556901 305
476 3300025912 Ga0207707_10001922 Ga0207707_1000192222 305
477 3300025912 Ga0207707_10202391 Ga0207707_102023911 305
478 3300025915 Ga0207693_10019276 Ga0207693_100192761 305
479 3300025915 Ga0207693_10042627 Ga0207693_100426272 305
480 3300025915 Ga0207693_10070846 Ga0207693_100708463 305
481 3300025915 Ga0207693_10151393 Ga0207693_101513932 305
482 3300025916 Ga0207663_10000585 Ga0207663_1000058512 305
483 3300025916 Ga0207663_10010422 Ga0207663_100104222 305
484 3300025917 Ga0207660_10059211 Ga0207660_100592113 305
485 3300025917 Ga0207660_10104552 Ga0207660_101045521 305
486 3300025928 Ga0207700_10006418 Ga0207700_100064185 305
487 3300025928 Ga0207700_10015761 Ga0207700_100157614 305
488 3300025928 Ga0207700_10032364 Ga0207700_100323641 305
489 3300025928 Ga0207700_10110487 Ga0207700_101104873 305
490 3300025928 Ga0207700_10177181 Ga0207700_101771812 305
491 3300025929 Ga0207664_10024726 Ga0207664_100247264 305
492 3300025929 Ga0207664_10040064 Ga0207664_100400643 305
493 3300025929 Ga0207664_10216857 Ga0207664_102168572 305
494 3300025932 Ga0207690_10083060 Ga0207690_100830602 305
495 3300025939 Ga0207665_10002484 Ga0207665_1000248411 305
496 3300025939 Ga0207665_10012818 Ga0207665_100128183 305
497 3300025939 Ga0207665_10286208 Ga0207665_102862082 305
498 3300025944 Ga0207661_10001440 Ga0207661_1000144010 305
499 3300025949 Ga0207667_10176204 Ga0207667_101762043 305
500 3300026067 Ga0207678_10065918 Ga0207678_100659182 305
501 3300026067 Ga0207678_10072529 Ga0207678_100725292 305
502 3300026095 Ga0207676_10336466 Ga0207676_103364661 305
503 3300031235 Ga0265330_10026441 Ga0265330_100264411 305
504 3300031235 Ga0265330_10074102 Ga0265330_100741022 305
505 3300031247 Ga0265340_10026153 Ga0265340_100261533 305
506 3300031249 Ga0265339_10000681 Ga0265339_100006812 305
507 3300031249 Ga0265339_10034747 Ga0265339_100347472 305
508 3300031250 Ga0265331_10078360 Ga0265331_100783602 305
509 3300031711 Ga0265314_10028143 Ga0265314_100281432 305
510 3300033180 Ga0307510_10010850 Ga0307510_1001085012 305
511 3300035111 Ga0373923_0070385 Ga0373923_0070385_423_1340 305
512 3300035117 Ga0373953_0005731 Ga0373953_0005731_1971_2888 305
513 3300035118 Ga0373954_0001520 Ga0373954_0001520_6087_7004 305
514 3300035119 Ga0373956_0000581 Ga0373956_0000581_12237_13154 305
515 3300035120 Ga0373957_0000761 Ga0373957_0000761_3115_4032 305
516 3300035172 Ga0373955_0017496 Ga0373955_0017496_2373_3290 305
517 3300035695 Ga0373927_0040514 Ga0373927_0040514_1189_2106 305
518 3300035724 Ga0373933_0007007 Ga0373933_0007007_4874_5791 305
519 3300036401 Ga0373937_0053065 Ga0373937_0053065_2432_3349 305
520 3300037068 Ga0373925_0362462 Ga0373925_0362462_138_1055 305
521 3300037418 Ga0395900_0065463 Ga0395900_0065463_2170_3087 305
522 3300039437 Ga0436365_0402044 Ga0436365_0402044_191_1108 305
523 3300039450 Ga0436363_0949075 Ga0436363_0949075_385_1302 305
524 3300039453 Ga0436362_0843798 Ga0436362_0843798_1572_2489 305
525 3300044684 Ga0466966_0056011 Ga0466966_0056011_828_1745 305
526 3300044693 Ga0466961_0049755 Ga0466961_0049755_116_1033 305
527 3300044735 Ga0466968_0090692 Ga0466968_0090692_311_1228 305
528 3300044842 Ga0466957_0035928 Ga0466957_0035928_1097_2014 305
529 3300044842 Ga0466957_0056716 Ga0466957_0056716_824_1741 305
530 3300045836 Ga0466958_0238708 Ga0466958_0238708_114_1031 305
531 3300045976 Ga0466967_0627808 Ga0466967_0627808_76_993 305
532 3300046454 Ga0495592_0022218 Ga0495592_0022218_2376_3293 305
533 3300046459 Ga0495629_0007671 Ga0495629_0007671_291_1208 305
534 3300046460 Ga0495638_0232530 Ga0495638_0232530_74_994 305
535 3300046462 Ga0495651_0040036 Ga0495651_0040036_370_1287 305
536 3300046477 Ga0495664_0027723 Ga0495664_0027723_118_1035 305
537 3300046511 Ga0495608_0006267 Ga0495608_0006267_520_1437 305
538 3300046516 Ga0495628_0112660 Ga0495628_0112660_693_1610 305
539 3300046524 Ga0495648_0001934 Ga0495648_0001934_3966_4886 305
540 3300046533 Ga0495640_0019643 Ga0495640_0019643_1704_2621 305
541 3300046536 Ga0495587_0008831 Ga0495587_0008831_3155_4072 305
542 3300046663 Ga0495635_0003485 Ga0495635_0003485_7191_8108 305
543 3300046675 Ga0495657_0003047 Ga0495657_0003047_2493_3410 305
544 3300046678 Ga0495599_0003206 Ga0495599_0003206_7192_8109 305
545 3300046680 Ga0495646_0015426 Ga0495646_0015426_2800_3717 305
546 3300046689 Ga0495613_0047346 Ga0495613_0047346_895_1812 305
547 3300046809 Ga0495600_0003090 Ga0495600_0003090_2383_3300 305
548 3300047317 Ga0495604_0006193 Ga0495604_0006193_2280_3197 305
549 3300047319 Ga0495674_0144674 Ga0495674_0144674_323_1240 305
550 3300047322 Ga0495680_0002817 Ga0495680_0002817_9906_10823 305
551 3300047444 Ga0495675_0004642 Ga0495675_0004642_695_1612 305
552 3300047471 Ga0495684_0011885 Ga0495684_0011885_283_1200 305
553 3300047472 Ga0495686_0194862 Ga0495686_0194862_46_966 305
554 3300047673 Ga0495593_0000740 Ga0495593_0000740_1894_2811 305
555 3300048088 Ga0495602_0014115 Ga0495602_0014115_664_1581 305
556 3300048904 Ga0496101_0080684 Ga0496101_0080684_233_1150 305
557 3300048905 Ga0496102_0110928 Ga0496102_0110928_1427_2344 305
558 3300048907 Ga0496104_0034297 Ga0496104_0034297_2108_3025 305
559 3300048909 Ga0496106_0002067 Ga0496106_0002067_10161_11078 305
560 3300048911 Ga0496108_0000160 Ga0496108_0000160_44970_45887 305
561 3300048911 Ga0496108_0022344 Ga0496108_0022344_4174_5091 305
562 3300048912 Ga0496109_0000245 Ga0496109_0000245_7250_8167 305
563 3300048912 Ga0496109_0069128 Ga0496109_0069128_1112_2029 305
564 3300048913 Ga0496110_0041787 Ga0496110_0041787_941_1858 305
565 3300048915 Ga0496112_0000018 Ga0496112_0000018_151858_152775 305
566 3300048915 Ga0496112_0003018 Ga0496112_0003018_1206_2123 305
567 3300048915 Ga0496112_0021930 Ga0496112_0021930_209_1126 305
568 3300048916 Ga0496113_0007747 Ga0496113_0007747_5371_6288 305
569 3300048921 Ga0496118_0019785 Ga0496118_0019785_4475_5392 305
570 3300048921 Ga0496118_0025690 Ga0496118_0025690_136_1056 305
571 3300048921 Ga0496118_0056754 Ga0496118_0056754_516_1433 305
572 3300048924 Ga0496121_0000754 Ga0496121_0000754_6928_7848 305
573 3300048924 Ga0496121_0028354 Ga0496121_0028354_1067_1984 305
574 3300048929 Ga0496126_0007899 Ga0496126_0007899_2703_3620 305
575 3300048929 Ga0496126_0047110 Ga0496126_0047110_1421_2338 305
576 3300048929 Ga0496126_0106636 Ga0496126_0106636_777_1859 305
577 3300049568 Ga0501031_0002803 Ga0501031_0002803_5005_5922 305
578 3300049569 Ga0501032_0001108 Ga0501032_0001108_2215_3132 305
579 3300049569 Ga0501032_0138326 Ga0501032_0138326_544_1464 305
580 3300049570 Ga0501033_0000082 Ga0501033_0000082_69967_70884 305
581 3300049571 Ga0501034_0000577 Ga0501034_0000577_27322_28239 305
582 3300049573 Ga0501037_0000636 Ga0501037_0000636_561_1478 305
583 3300049574 Ga0501038_0000234 Ga0501038_0000234_22995_23912 305
584 3300049574 Ga0501038_0075149 Ga0501038_0075149_1076_1996 305
585 3300049575 Ga0501039_0000123 Ga0501039_0000123_15766_16683 305
586 3300049578 Ga0501042_0059782 Ga0501042_0059782_40_957 305
587 3300049579 Ga0501043_0022481 Ga0501043_0022481_2403_3320 305
588 3300049580 Ga0501046_0021709 Ga0501046_0021709_3787_4704 305
589 3300049580 Ga0501046_0237333 Ga0501046_0237333_310_1227 305
590 3300049581 Ga0501047_0000131 Ga0501047_0000131_77639_78556 305
591 3300049581 Ga0501047_0023892 Ga0501047_0023892_4370_5287 305
592 3300049582 Ga0501048_0000170 Ga0501048_0000170_22987_23904 305
593 3300049584 Ga0501068_0001508 Ga0501068_0001508_8409_9326 305
594 3300049586 Ga0501070_0026223 Ga0501070_0026223_2360_3277 305
595 3300049586 Ga0501070_0042209 Ga0501070_0042209_1961_2878 305
596 3300049586 Ga0501070_0444179 Ga0501070_0444179_27_944 305
597 3300049587 Ga0501071_0016663 Ga0501071_0016663_171_1088 305
598 3300049587 Ga0501071_0316469 Ga0501071_0316469_132_1052 305
599 3300049588 Ga0501072_0000393 Ga0501072_0000393_13226_14143 305
600 3300049589 Ga0501073_0000062 Ga0501073_0000062_23272_24189 305
601 3300049589 Ga0501073_0105659 Ga0501073_0105659_821_1741 305
602 3300049590 Ga0501074_0000055 Ga0501074_0000055_43004_43921 305
603 3300049590 Ga0501074_0023981 Ga0501074_0023981_1469_2386 305
604 3300049590 Ga0501074_0067492 Ga0501074_0067492_766_1686 305
605 3300049741 Ga0501079_0000344 Ga0501079_0000344_18779_19696 305
606 3300049742 Ga0501080_0009294 Ga0501080_0009294_2740_3657 305
607 3300049742 Ga0501080_0229900 Ga0501080_0229900_179_1099 305
608 3300049744 Ga0501083_0000199 Ga0501083_0000199_6630_7547 305
609 3300049822 Ga0501035_0000123 Ga0501035_0000123_37932_38849 305
610 3300049823 Ga0501044_0000329 Ga0501044_0000329_4799_5716 305
611 3300049823 Ga0501044_0017585 Ga0501044_0017585_6418_7335 305
612 3300053077 Ga0495601_0004083 Ga0495601_0004083_5176_6093 305
613 3300053080 Ga0500635_0001630 Ga0500635_0001630_3591_4508 305
614 3300053084 Ga0495595_0001468 Ga0495595_0001468_1720_2637 305
615 3300053085 Ga0495619_0002627 Ga0495619_0002627_1206_2123 305
616 3300053093 Ga0500651_0098602 Ga0500651_0098602_555_1472 305
617 3300053119 Ga0500595_020565 Ga0500595_020565_196_1116 305
618 3300053119 Ga0500595_039159 Ga0500595_039159_183_1100 305
619 3300053154 Ga0500619_074693 Ga0500619_074693_34_951 305
620 3300053177 Ga0500636_0049762 Ga0500636_0049762_276_1205 305
621 3300053178 Ga0500637_0007260 Ga0500637_0007260_3649_4566 305
622 3300053735 Ga0500596_001422 Ga0500596_001422_3706_4623 305
623 3300054114 Ga0501084_0019273 Ga0501084_0019273_4616_5533 305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

73

206

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.6963 14 294
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.6942 21 288
5i20-assembly2.cif.gz_B crystal structure of protein 0.6906 15 290
7b0k-assembly1.cif.gz_A membrane protein structure 0.6869 12 289
7b0k-assembly1.cif.gz_A membrane protein structure 0.6824 12 289
ID Description Score Start End Superfamily
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8386 25 290 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7369 25 290 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7291 16 298 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6815 16 298 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6769 19 294 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A2M7Y9C9-F1-model_v4 EamA domain-containing protein 0.9671 25 297 GO:0016020
AF-A0A2U1YGE9-F1-model_v4 EamA domain-containing protein 0.9594 25 299 GO:0016020
AF-S9QIR0-F1-model_v4 Membrane protein, putative 0.9588 12 296 GO:0016020
AF-A0A2M7Y9C9-F1-model_v4 EamA domain-containing protein 0.9568 25 297 GO:0016020
AF-A0A2S6SYH1-F1-model_v4 Riboflavin transporter 0.9551 17 296 GO:0016020

Feature Viewer

pLDDT pTM Quality
85.35 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map