F470282

General Info

Members Datasets Scaffolds Average Seq Length
624 302 599 277

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10269006|Ga0207428_102690061
Length 307
Sequence VARLWPPYARILDEGRGDEQEEEVAGRPVQTFEVVRSEQLAPHLVRVVLGGRGFDMFKPNDFTDAYVKLVFVEPDVDVAALPQPLTLDSFNGLPAERRPVVRTYTVRTVDTERREITIDFVVHGEHGVAGPWAAAATPGQPAYLMGPSGAYAPDPAADWHLLAGDEAALPAIGAALEALADDAVGKVFLEVGGPDDQIALTAPPGVEVTWVYRGGRADLVPEEKAGDNAPLITAVTEAAWLPGQVQVFIHGEAQTVMHNLRPYIRKERGVEAKWAASISGYWRRGRTEETFRQWKRELARAEEQPGN

Samples

Sample ID Description Type Environment
1 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
2 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
3 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
4 2643221692 Nocardia sp. Root136 Isolate Unclassified
5 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
6 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
7 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
8 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
9 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
10 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
11 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
12 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
13 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
14 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
15 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
16 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
17 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
18 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
19 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
20 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
21 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
22 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
23 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
24 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
25 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
26 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
27 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
28 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
29 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
30 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
197 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
198 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
199 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
200 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
201 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
202 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
203 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
204 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
205 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
206 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
207 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
285 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
286 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
287 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
288 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
289 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
290 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
293 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
294 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
295 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
296 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
297 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
298 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
299 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
300 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
302 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.99
Metatranscriptomes 0
Isolates 4.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.66
Nodule 0.16
Rhizoplane 11.54
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1011268 3300001977 Bacteria 1316
2 JGI24745J21846_1009453 3300002073 Bacteria 1105
3 JGI24745J21846_1012054 3300002073 Bacteria 991
4 JGI24749J21850_1001809 3300002076 Bacteria 3026
5 JGI24744J21845_10010692 3300002077 Bacteria 1879
6 JGI24034J26672_10012582 3300002239 Bacteria 1276
7 Ga0055540_1000029 3300003792 Bacteria 179894
8 Ga0055540_1002541 3300003792 Bacteria 9521
9 Ga0055540_1003267 3300003792 Bacteria 7927
10 Ga0055540_1004510 3300003792 Bacteria 6239
11 Ga0070676_10019431 3300005328 Bacteria 3780
12 Ga0070683_100092309 3300005329 Bacteria 2844
13 Ga0070683_100211327 3300005329 Bacteria 1843
14 Ga0070690_100034010 3300005330 Bacteria 3192
15 Ga0070670_100092554 3300005331 Bacteria 2600
16 Ga0068869_100044162 3300005334 Bacteria 3204
17 Ga0070666_10125445 3300005335 Bacteria 1782
18 Ga0070682_100012745 3300005337 Bacteria 4825
19 Ga0070682_100020030 3300005337 Bacteria 3931
20 Ga0068868_100012095 3300005338 Bacteria 6303
21 Ga0070660_100053721 3300005339 Bacteria 3108
22 Ga0070689_100178783 3300005340 Bacteria 1722
23 Ga0070689_100444973 3300005340 Bacteria 1102
24 Ga0070668_100027824 3300005347 Bacteria 4291
25 Ga0070668_100034956 3300005347 Bacteria 3830
26 Ga0070669_100001847 3300005353 Bacteria 15265
27 Ga0070671_100006018 3300005355 Bacteria 9669
28 Ga0070671_100069793 3300005355 Bacteria 2931
29 Ga0070671_100149893 3300005355 Bacteria 1969
30 Ga0070674_100006799 3300005356 Bacteria 6701
31 Ga0070674_100017309 3300005356 Bacteria 4531
32 Ga0070674_100065972 3300005356 Bacteria 2542
33 Ga0070688_100014710 3300005365 Bacteria 4438
34 Ga0070659_100063391 3300005366 Bacteria 2924
35 Ga0070659_100164909 3300005366 Bacteria 1812
36 Ga0070667_100000391 3300005367 Bacteria 47388
37 Ga0070667_100003100 3300005367 Bacteria 14303
38 Ga0070667_100003577 3300005367 Bacteria 13229
39 Ga0070667_100015262 3300005367 Bacteria 6348
40 Ga0070667_100084670 3300005367 Bacteria 2718
41 Ga0070667_100140469 3300005367 Bacteria 2115
42 Ga0070667_100529738 3300005367 Bacteria 1081
43 Ga0070709_10120023 3300005434 Bacteria 1780
44 Ga0070714_100033174 3300005435 Bacteria 4315
45 Ga0070714_100251271 3300005435 Bacteria 1635
46 Ga0070714_100252258 3300005435 Bacteria 1632
47 Ga0070710_10017522 3300005437 Bacteria 3667
48 Ga0070701_10007431 3300005438 Bacteria 4682
49 Ga0070711_100000375 3300005439 Bacteria 23132
50 Ga0070711_100027419 3300005439 Bacteria 3739
51 Ga0070705_100061875 3300005440 Bacteria 2226
52 Ga0070705_100079824 3300005440 Bacteria 2005
53 Ga0070700_100093028 3300005441 Bacteria 1971
54 Ga0070663_100028665 3300005455 Bacteria 3794
55 Ga0070678_100001259 3300005456 Bacteria 13431
56 Ga0070678_100117161 3300005456 Bacteria 2094
57 Ga0070662_100015363 3300005457 Bacteria 5126
58 Ga0070684_100108762 3300005535 Bacteria 2484
59 Ga0068853_100008592 3300005539 Bacteria 8211
60 Ga0068853_100059908 3300005539 Bacteria 3289
61 Ga0068853_100103731 3300005539 Bacteria 2517
62 Ga0070672_100085529 3300005543 Bacteria 2535
63 Ga0070686_100228465 3300005544 Bacteria 1349
64 Ga0070696_100001702 3300005546 Bacteria 14418
65 Ga0070696_100033682 3300005546 Bacteria 3521
66 Ga0070665_100018284 3300005548 Bacteria 7029
67 Ga0070665_100050045 3300005548 Bacteria 4193
68 Ga0070665_100141304 3300005548 Bacteria 2411
69 Ga0070665_100173278 3300005548 Bacteria 2158
70 Ga0070704_100001435 3300005549 Bacteria 12737
71 Ga0068855_100006164 3300005563 Bacteria 14621
72 Ga0068855_100038774 3300005563 Bacteria 5660
73 Ga0068854_100003064 3300005578 Bacteria 10404
74 Ga0068854_100010898 3300005578 Bacteria 5899
75 Ga0068856_100012671 3300005614 Bacteria 8164
76 Ga0070702_100032358 3300005615 Bacteria 2869
77 Ga0070702_100077581 3300005615 Bacteria 1980
78 Ga0070702_100152457 3300005615 Bacteria 1485
79 Ga0068852_100033270 3300005616 Bacteria 4278
80 Ga0068852_100089668 3300005616 Bacteria 2749
81 Ga0068859_100008118 3300005617 Bacteria 10645
82 Ga0068859_100032433 3300005617 Bacteria 5247
83 Ga0068864_100065747 3300005618 Bacteria 3146
84 Ga0068864_100094936 3300005618 Bacteria 2637
85 Ga0068864_100351267 3300005618 Bacteria 1391
86 Ga0068866_10000812 3300005718 Bacteria 13959
87 Ga0068866_10035513 3300005718 Bacteria 2435
88 Ga0068861_100009768 3300005719 Bacteria 6635
89 Ga0068863_100000992 3300005841 Bacteria 28496
90 Ga0068863_100011377 3300005841 Bacteria 8611
91 Ga0068863_100060458 3300005841 Bacteria 3583
92 Ga0068863_100483321 3300005841 Bacteria 1218
93 Ga0068858_100001306 3300005842 Bacteria 25730
94 Ga0068858_100029600 3300005842 Bacteria 5086
95 Ga0068860_100000065 3300005843 Bacteria 186634
96 Ga0068860_100235614 3300005843 Bacteria 1779
97 Ga0068862_100000028 3300005844 Bacteria 184197
98 Ga0081455_10210050 3300005937 Bacteria 1451
99 Ga0075365_10015167 3300006038 Bacteria 4655
100 Ga0075365_10033291 3300006038 Bacteria 3320
101 Ga0075365_10093120 3300006038 Bacteria 2055
102 Ga0075365_10160424 3300006038 Bacteria 1567
103 Ga0075363_100003126 3300006048 Bacteria 6954
104 Ga0075363_100014059 3300006048 Bacteria 3899
105 Ga0075363_100014862 3300006048 Bacteria 3816
106 Ga0075363_100095625 3300006048 Bacteria 1639
107 Ga0075364_10001383 3300006051 Bacteria 13095
108 Ga0075364_10006919 3300006051 Bacteria 6696
109 Ga0075364_10013609 3300006051 Bacteria 5007
110 Ga0075364_10060585 3300006051 Bacteria 2481
111 Ga0075364_10094436 3300006051 Bacteria 1987
112 Ga0075364_10118586 3300006051 Bacteria 1770
113 Ga0075364_10201295 3300006051 Bacteria 1350
114 Ga0070715_10001286 3300006163 Bacteria 7188
115 Ga0070715_10070106 3300006163 Bacteria 1564
116 Ga0070716_100003259 3300006173 Bacteria 7626
117 Ga0070716_100388212 3300006173 Bacteria 1000
118 Ga0070712_100008493 3300006175 Bacteria 6463
119 Ga0070712_100064828 3300006175 Bacteria 2591
120 Ga0075362_10010964 3300006177 Bacteria 3558
121 Ga0075362_10042022 3300006177 Bacteria 2019
122 Ga0075367_10008062 3300006178 Bacteria 5435
123 Ga0075367_10130491 3300006178 Bacteria 1553
124 Ga0075367_10255738 3300006178 Bacteria 1099
125 Ga0075369_10002341 3300006186 Bacteria 6748
126 Ga0075369_10010294 3300006186 Bacteria 3655
127 Ga0075369_10090683 3300006186 Bacteria 1364
128 Ga0075369_10101291 3300006186 Bacteria 1292
129 Ga0075366_10070125 3300006195 Bacteria 2087
130 Ga0097621_100149369 3300006237 Bacteria 2003
131 Ga0097621_100208351 3300006237 Bacteria 1700
132 Ga0075370_10012324 3300006353 Bacteria 4515
133 Ga0075370_10018620 3300006353 Bacteria 3768
134 Ga0075370_10019367 3300006353 Bacteria 3706
135 Ga0075370_10030301 3300006353 Bacteria 3018
136 Ga0075370_10043886 3300006353 Bacteria 2527
137 Ga0075370_10063273 3300006353 Bacteria 2109
138 Ga0075370_10071213 3300006353 Bacteria 1989
139 Ga0075428_100004253 3300006844 Bacteria 15752
140 Ga0068865_100167486 3300006881 Bacteria 1681
141 Ga0097620_100008118 3300006931 Bacteria 10645
142 Ga0097620_100032433 3300006931 Bacteria 5247
143 Ga0105250_10032624 3300009092 Bacteria 2091
144 Ga0105240_10064066 3300009093 Bacteria 4569
145 Ga0105245_10001029 3300009098 Bacteria 25345
146 Ga0105247_10000232 3300009101 Bacteria 53113
147 Ga0105247_10009458 3300009101 Bacteria 5914
148 Ga0114129_10043041 3300009147 Bacteria 6356
149 Ga0105243_10001000 3300009148 Bacteria 26146
150 Ga0105241_10062428 3300009174 Bacteria 2872
151 Ga0105242_10000759 3300009176 Bacteria 25113
152 Ga0105242_10226296 3300009176 Bacteria 1674
153 Ga0105248_10000074 3300009177 Bacteria 114554
154 Ga0105248_10003071 3300009177 Bacteria 18513
155 Ga0105248_10333447 3300009177 Bacteria 1708
156 Ga0105248_10421801 3300009177 Bacteria 1503
157 Ga0105237_10004825 3300009545 Bacteria 15489
158 Ga0105237_10010195 3300009545 Bacteria 10012
159 Ga0105237_10028762 3300009545 Bacteria 5656
160 Ga0105237_10107256 3300009545 Bacteria 2785
161 Ga0105237_10265098 3300009545 Bacteria 1721
162 Ga0105238_10005858 3300009551 Bacteria 12175
163 Ga0105238_10127461 3300009551 Bacteria 2524
164 Ga0105238_10252130 3300009551 Bacteria 1743
165 Ga0105249_10000011 3300009553 Bacteria 292812
166 Ga0105249_10005589 3300009553 Bacteria 10869
167 Ga0105249_10015924 3300009553 Bacteria 6664
168 Ga0105249_10313969 3300009553 Bacteria 1577
169 Ga0105239_10014422 3300010375 Bacteria 8771
170 Ga0105239_10016836 3300010375 Bacteria 8080
171 Ga0105239_10198895 3300010375 Bacteria 2245
172 Ga0105239_10267608 3300010375 Bacteria 1922
173 Ga0105246_10198502 3300011119 Bacteria 1558
174 Ga0157371_10159628 3300013102 Bacteria 1610
175 Ga0157369_10069364 3300013105 Bacteria 3787
176 Ga0157369_10435238 3300013105 Bacteria 1359
177 Ga0157374_10015721 3300013296 Bacteria 6645
178 Ga0157374_10175252 3300013296 Bacteria 2093
179 Ga0157378_10001038 3300013297 Bacteria 25353
180 Ga0163162_10018684 3300013306 Bacteria 6791
181 Ga0163162_10071077 3300013306 Bacteria 3533
182 Ga0157372_10011618 3300013307 Bacteria 9375
183 Ga0157372_10254023 3300013307 Bacteria 2041
184 Ga0157372_10701777 3300013307 Bacteria 1177
185 Ga0157375_10000838 3300013308 Bacteria 26885
186 Ga0157375_10228333 3300013308 Bacteria 2020
187 Ga0157375_10397655 3300013308 Bacteria 1545
188 Ga0163163_10046502 3300014325 Bacteria 4263
189 Ga0163163_10062712 3300014325 Bacteria 3684
190 Ga0163163_10468024 3300014325 Bacteria 1321
191 Ga0163163_10537656 3300014325 Bacteria 1231
192 Ga0157380_10001428 3300014326 Bacteria 15636
193 Ga0157377_10015647 3300014745 Bacteria 3887
194 Ga0157379_10016789 3300014968 Bacteria 6442
195 Ga0157379_10309819 3300014968 Bacteria 1440
196 Ga0157376_10049082 3300014969 Bacteria 3495
197 Ga0157376_10562289 3300014969 Bacteria 1130
198 Ga0163161_10003257 3300017792 Bacteria 11411
199 Ga0163161_10173713 3300017792 Bacteria 1649
200 Ga0213874_10089055 3300021377 Bacteria 1011
201 Ga0213876_10003552 3300021384 Bacteria 8886
202 Ga0213876_10018948 3300021384 Bacteria 3636
203 Ga0209673_1029315 3300025273 Bacteria 1754
204 Ga0209051_1000042 3300025303 Bacteria 308486
205 Ga0209051_1004157 3300025303 Bacteria 9049
206 Ga0209051_1008656 3300025303 Bacteria 5358
207 Ga0209051_1015862 3300025303 Bacteria 3448
208 Ga0207653_10002968 3300025885 Bacteria 5382
209 Ga0207692_10003952 3300025898 Bacteria 5820
210 Ga0207692_10026397 3300025898 Bacteria 2725
211 Ga0207692_10049291 3300025898 Bacteria 2125
212 Ga0207642_10000117 3300025899 Bacteria 21526
213 Ga0207710_10000022 3300025900 Bacteria 335632
214 Ga0207688_10005173 3300025901 Bacteria 7091
215 Ga0207688_10007002 3300025901 Bacteria 6133
216 Ga0207647_10037258 3300025904 Bacteria 3084
217 Ga0207647_10044118 3300025904 Bacteria 2787
218 Ga0207647_10122375 3300025904 Bacteria 1533
219 Ga0207685_10049609 3300025905 Bacteria 1613
220 Ga0207685_10089453 3300025905 Bacteria 1293
221 Ga0207643_10203479 3300025908 Bacteria 1206
222 Ga0207654_10033971 3300025911 Bacteria 2830
223 Ga0207695_10002792 3300025913 Bacteria 25412
224 Ga0207671_10001326 3300025914 Bacteria 28939
225 Ga0207671_10010122 3300025914 Bacteria 7814
226 Ga0207671_10041471 3300025914 Bacteria 3407
227 Ga0207693_10000930 3300025915 Bacteria 26312
228 Ga0207693_10001479 3300025915 Bacteria 20767
229 Ga0207693_10507156 3300025915 Bacteria 942
230 Ga0207663_10002583 3300025916 Bacteria 8711
231 Ga0207663_10073617 3300025916 Bacteria 2211
232 Ga0207681_10001802 3300025923 Bacteria 13741
233 Ga0207681_10027533 3300025923 Bacteria 3676
234 Ga0207694_10010486 3300025924 Bacteria 6990
235 Ga0207694_10366477 3300025924 Bacteria 1194
236 Ga0207650_10105386 3300025925 Bacteria 2177
237 Ga0207687_10001341 3300025927 Bacteria 16838
238 Ga0207700_10041267 3300025928 Bacteria 3375
239 Ga0207664_10104274 3300025929 Bacteria 2348
240 Ga0207664_10261936 3300025929 Bacteria 1512
241 Ga0207664_10450520 3300025929 Bacteria 1149
242 Ga0207644_10315948 3300025931 Bacteria 1262
243 Ga0207690_10018077 3300025932 Bacteria 4318
244 Ga0207690_10033766 3300025932 Bacteria 3292
245 Ga0207706_10010030 3300025933 Bacteria 8679
246 Ga0207706_10143832 3300025933 Bacteria 2098
247 Ga0207709_10021840 3300025935 Bacteria 3625
248 Ga0207709_10064292 3300025935 Bacteria 2303
249 Ga0207670_10137047 3300025936 Bacteria 1800
250 Ga0207670_10166116 3300025936 Bacteria 1651
251 Ga0207669_10000297 3300025937 Bacteria 22865
252 Ga0207669_10038390 3300025937 Bacteria 2757
253 Ga0207704_10007363 3300025938 Bacteria 5193
254 Ga0207704_10023526 3300025938 Bacteria 3322
255 Ga0207665_10008653 3300025939 Bacteria 6699
256 Ga0207665_10290570 3300025939 Bacteria 1219
257 Ga0207691_10061917 3300025940 Bacteria 3397
258 Ga0207711_10001226 3300025941 Bacteria 24313
259 Ga0207711_10014691 3300025941 Bacteria 6506
260 Ga0207711_10362162 3300025941 Bacteria 1344
261 Ga0207689_10032281 3300025942 Bacteria 4357
262 Ga0207661_10167397 3300025944 Bacteria 1911
263 Ga0207679_10331582 3300025945 Bacteria 1321
264 Ga0207667_10051635 3300025949 Bacteria 4333
265 Ga0207667_10068340 3300025949 Bacteria 3700
266 Ga0207651_10058995 3300025960 Bacteria 2655
267 Ga0207712_10000020 3300025961 Bacteria 292796
268 Ga0207712_10008422 3300025961 Bacteria 6516
269 Ga0207712_10011195 3300025961 Bacteria 5711
270 Ga0207712_10383786 3300025961 Bacteria 1177
271 Ga0207668_10029134 3300025972 Bacteria 3615
272 Ga0207668_10104725 3300025972 Bacteria 2110
273 Ga0207668_10320497 3300025972 Bacteria 1286
274 Ga0207640_10018643 3300025981 Bacteria 4082
275 Ga0207640_10026973 3300025981 Bacteria 3495
276 Ga0207658_10000284 3300025986 Bacteria 53042
277 Ga0207658_10001582 3300025986 Bacteria 17576
278 Ga0207658_10004009 3300025986 Bacteria 10307
279 Ga0207658_10015254 3300025986 Bacteria 5271
280 Ga0207658_10110492 3300025986 Bacteria 2172
281 Ga0207677_10002994 3300026023 Bacteria 8923
282 Ga0207703_10001189 3300026035 Bacteria 24483
283 Ga0207703_10040837 3300026035 Bacteria 3715
284 Ga0207639_10008929 3300026041 Bacteria 6896
285 Ga0207639_10178224 3300026041 Bacteria 1806
286 Ga0207678_10013971 3300026067 Bacteria 7057
287 Ga0207678_10061884 3300026067 Bacteria 3219
288 Ga0207708_10031691 3300026075 Bacteria 4014
289 Ga0207702_10136825 3300026078 Bacteria 2211
290 Ga0207702_10202743 3300026078 Bacteria 1840
291 Ga0207641_10001875 3300026088 Bacteria 20188
292 Ga0207641_10034263 3300026088 Bacteria 4223
293 Ga0207641_10120457 3300026088 Bacteria 2341
294 Ga0207641_10133498 3300026088 Bacteria 2232
295 Ga0207648_10001361 3300026089 Bacteria 27023
296 Ga0207648_10046867 3300026089 Bacteria 3789
297 Ga0207676_10048723 3300026095 Bacteria 3291
298 Ga0207676_10068225 3300026095 Bacteria 2844
299 Ga0207676_10125993 3300026095 Bacteria 2169
300 Ga0207676_10301592 3300026095 Bacteria 1463
301 Ga0207676_10356650 3300026095 Bacteria 1354
302 Ga0207675_100003845 3300026118 Bacteria 14607
303 Ga0207675_100825159 3300026118 Bacteria 941
304 Ga0207683_10002759 3300026121 Bacteria 15343
305 Ga0207683_10005268 3300026121 Bacteria 11099
306 Ga0207698_10168866 3300026142 Bacteria 1924
307 Ga0207428_10269006 3300027907 Bacteria 1267
308 Ga0268266_10004748 3300028379 Bacteria 12923
309 Ga0268266_10059256 3300028379 Bacteria 3298
310 Ga0268266_10074922 3300028379 Bacteria 2939
311 Ga0268266_10082710 3300028379 Bacteria 2801
312 Ga0268265_10000004 3300028380 Bacteria 648376
313 Ga0268265_10046780 3300028380 Bacteria 3236
314 Ga0268265_10549158 3300028380 Bacteria 1096
315 Ga0268264_10000024 3300028381 Bacteria 470081
316 Ga0268264_10004434 3300028381 Bacteria 11972
317 Ga0268264_10180557 3300028381 Bacteria 1916
318 Ga0265327_10000154 3300031251 Bacteria 148866
319 Ga0265327_10002914 3300031251 Bacteria 17140
320 Ga0265327_10027594 3300031251 Bacteria 3264
321 Ga0265327_10068663 3300031251 Bacteria 1782
322 Ga0316578_10065817 3300031728 Bacteria 2141
323 Ga0307413_10030289 3300031824 Bacteria 3039
324 Ga0307407_10117839 3300031903 Bacteria 1678
325 Ga0307409_100032573 3300031995 Bacteria 3781
326 Ga0307409_100331609 3300031995 Bacteria 1428
327 Ga0307416_100792870 3300032002 Bacteria 1043
328 Ga0307411_10177701 3300032005 Bacteria 1612
329 Ga0307415_100149364 3300032126 Bacteria 1796
330 Ga0373928_0011509 3300035084 Bacteria 1752
331 Ga0373941_0008988 3300035115 Bacteria 2504
332 Ga0373931_0140682 3300035691 Bacteria 1397
333 Ga0373931_0222767 3300035691 Bacteria 1136
334 Ga0373947_0097832 3300035725 Bacteria 1840
335 Ga0316584_0075517 3300036712 Bacteria 2526
336 Ga0436364_1121346 3300037853 Bacteria 3615
337 Ga0436365_0593663 3300039437 Bacteria 2111
338 Ga0436365_0865525 3300039437 Bacteria 17320
339 Ga0436365_0997910 3300039437 Bacteria 8476
340 Ga0436365_1378611 3300039437 Bacteria 178407
341 Ga0436363_0789807 3300039450 Bacteria 6812
342 Ga0439466_0012631 3300041411 Bacteria 3105
343 Ga0439466_0027199 3300041411 Bacteria 1982
344 Ga0439466_0028287 3300041411 Bacteria 1936
345 Ga0439465_0003815 3300041413 Bacteria 4915
346 Ga0439465_0006734 3300041413 Bacteria 3648
347 Ga0451793_0913039 3300041452 Bacteria 1850
348 Ga0451800_0666987 3300041459 Bacteria 1307
349 Ga0451802_0086339 3300041460 Bacteria 1213
350 Ga0451806_876685 3300041462 Bacteria 1488
351 Ga0439445_0003672 3300042004 Bacteria 3442
352 Ga0439445_0004053 3300042004 Bacteria 3308
353 Ga0439450_046751 3300042008 Bacteria 1019
354 Ga0439434_0028143 3300042435 Bacteria 1701
355 Ga0439434_0054856 3300042435 Bacteria 1240
356 Ga0466969_0031608 3300044656 Bacteria 2694
357 Ga0466969_0037463 3300044656 Bacteria 2446
358 Ga0466972_0011693 3300044658 Bacteria 4407
359 Ga0466972_0014121 3300044658 Bacteria 4002
360 Ga0466972_0041677 3300044658 Bacteria 2235
361 Ga0466965_0003164 3300044683 Bacteria 7183
362 Ga0466965_0004842 3300044683 Bacteria 6004
363 Ga0466965_0020463 3300044683 Bacteria 3181
364 Ga0466965_0108892 3300044683 Bacteria 1422
365 Ga0466965_0177783 3300044683 Bacteria 1122
366 Ga0466966_0005734 3300044684 Bacteria 8171
367 Ga0466966_0010087 3300044684 Bacteria 6265
368 Ga0466966_0021904 3300044684 Bacteria 4196
369 Ga0466966_0070523 3300044684 Bacteria 2191
370 Ga0466961_0009580 3300044693 Bacteria 6167
371 Ga0466961_0022594 3300044693 Bacteria 4046
372 Ga0466963_0044299 3300044694 Bacteria 2929
373 Ga0466963_0073723 3300044694 Bacteria 2302
374 Ga0466963_0119194 3300044694 Bacteria 1815
375 Ga0466963_0194228 3300044694 Bacteria 1418
376 Ga0466963_0292415 3300044694 Bacteria 1145
377 Ga0466963_0398302 3300044694 Bacteria 971
378 Ga0466971_0001079 3300044719 Bacteria 11324
379 Ga0466971_0013433 3300044719 Bacteria 3598
380 Ga0466968_0001830 3300044735 Bacteria 7680
381 Ga0466968_0002156 3300044735 Bacteria 7180
382 Ga0466970_0004994 3300044765 Bacteria 6555
383 Ga0466970_0045119 3300044765 Bacteria 2346
384 Ga0466970_0096414 3300044765 Bacteria 1608
385 Ga0466957_0012567 3300044842 Bacteria 4901
386 Ga0466957_0028501 3300044842 Bacteria 3326
387 Ga0466957_0034553 3300044842 Bacteria 3033
388 Ga0466960_0000117 3300044901 Bacteria 26501
389 Ga0466960_0000905 3300044901 Bacteria 10511
390 Ga0466960_0003419 3300044901 Bacteria 6102
391 Ga0466959_0012610 3300045049 Bacteria 6113
392 Ga0466959_0064886 3300045049 Bacteria 2650
393 Ga0466958_0001238 3300045836 Bacteria 11971
394 Ga0466958_0054031 3300045836 Bacteria 2435
395 Ga0466958_0079579 3300045836 Bacteria 2015
396 Ga0466967_0020211 3300045976 Bacteria 5375
397 Ga0466967_0035544 3300045976 Bacteria 4243
398 Ga0466967_0079399 3300045976 Bacteria 2958
399 Ga0466967_0128776 3300045976 Bacteria 2347
400 Ga0466967_0338087 3300045976 Bacteria 1455
401 Ga0466967_0374162 3300045976 Bacteria 1382
402 Ga0466967_0421074 3300045976 Bacteria 1302
403 Ga0466967_0521960 3300045976 Bacteria 1167
404 Ga0495603_0035321 3300046455 Bacteria 3003
405 Ga0495638_0000404 3300046460 Bacteria 52857
406 Ga0495638_0060257 3300046460 Bacteria 2348
407 Ga0495651_0058527 3300046462 Bacteria 2956
408 Ga0495639_0111381 3300046475 Bacteria 1299
409 Ga0495662_0044921 3300046476 Bacteria 2133
410 Ga0495662_0090935 3300046476 Bacteria 1488
411 Ga0495628_0146898 3300046516 Bacteria 1797
412 Ga0495648_0004183 3300046524 Bacteria 12400
413 Ga0495652_0101414 3300046529 Bacteria 2333
414 Ga0495645_0046374 3300046543 Bacteria 3168
415 Ga0495588_0014059 3300046674 Bacteria 3825
416 Ga0495624_0082450 3300046690 Bacteria 1990
417 Ga0495649_0135016 3300046694 Bacteria 1301
418 Ga0495600_0028281 3300046809 Bacteria 3626
419 Ga0495581_0157259 3300047315 Bacteria 1328
420 Ga0495604_0042184 3300047317 Bacteria 3577
421 Ga0495674_0120535 3300047319 Bacteria 2216
422 Ga0495672_0003432 3300047320 Bacteria 13573
423 Ga0495672_0170829 3300047320 Bacteria 1109
424 Ga0495676_0117740 3300047321 Bacteria 1938
425 Ga0495673_0002291 3300047469 Bacteria 13712
426 Ga0495686_0002735 3300047472 Bacteria 16115
427 Ga0495593_0010681 3300047673 Bacteria 5294
428 Ga0496100_0000009 3300048903 Bacteria 225785
429 Ga0496100_0001047 3300048903 Bacteria 13366
430 Ga0496100_0040440 3300048903 Bacteria 2967
431 Ga0496100_0068760 3300048903 Bacteria 2356
432 Ga0496100_0190380 3300048903 Bacteria 1489
433 Ga0496100_0196940 3300048903 Bacteria 1466
434 Ga0496100_0496323 3300048903 Bacteria 940
435 Ga0496101_0000018 3300048904 Bacteria 236102
436 Ga0496101_0000102 3300048904 Bacteria 88779
437 Ga0496101_0000931 3300048904 Bacteria 17274
438 Ga0496101_0009266 3300048904 Bacteria 6464
439 Ga0496101_0026670 3300048904 Bacteria 4018
440 Ga0496101_0091404 3300048904 Bacteria 2265
441 Ga0496102_0000037 3300048905 Bacteria 199368
442 Ga0496102_0000256 3300048905 Bacteria 69381
443 Ga0496102_0012165 3300048905 Bacteria 7439
444 Ga0496102_0012619 3300048905 Bacteria 7318
445 Ga0496102_0045412 3300048905 Bacteria 3989
446 Ga0496102_0127309 3300048905 Bacteria 2381
447 Ga0496102_0132204 3300048905 Bacteria 2337
448 Ga0496103_0000004 3300048906 Bacteria 510080
449 Ga0496103_0000538 3300048906 Bacteria 30478
450 Ga0496103_0000989 3300048906 Bacteria 20043
451 Ga0496103_0001096 3300048906 Bacteria 18843
452 Ga0496103_0046381 3300048906 Bacteria 2683
453 Ga0496103_0159629 3300048906 Bacteria 1446
454 Ga0496104_0002403 3300048907 Bacteria 16120
455 Ga0496104_0017819 3300048907 Bacteria 6476
456 Ga0496104_0230975 3300048907 Bacteria 1762
457 Ga0496104_0341286 3300048907 Bacteria 1411
458 Ga0496104_0413151 3300048907 Bacteria 1262
459 Ga0496105_0008381 3300048908 Bacteria 8033
460 Ga0496105_0037799 3300048908 Bacteria 3976
461 Ga0496106_0001747 3300048909 Bacteria 16235
462 Ga0496106_0003068 3300048909 Bacteria 12455
463 Ga0496106_0020704 3300048909 Bacteria 4882
464 Ga0496106_0022182 3300048909 Bacteria 4715
465 Ga0496106_0171967 3300048909 Bacteria 1717
466 Ga0496107_0001670 3300048910 Bacteria 13874
467 Ga0496107_0003353 3300048910 Bacteria 10701
468 Ga0496107_0012063 3300048910 Bacteria 6026
469 Ga0496107_0012623 3300048910 Bacteria 5899
470 Ga0496107_0056165 3300048910 Bacteria 2844
471 Ga0496107_0090242 3300048910 Bacteria 2238
472 Ga0496108_0033508 3300048911 Bacteria 4267
473 Ga0496108_0094431 3300048911 Bacteria 2546
474 Ga0496109_0000434 3300048912 Bacteria 36428
475 Ga0496109_0001781 3300048912 Bacteria 17907
476 Ga0496109_0016900 3300048912 Bacteria 6385
477 Ga0496109_0321026 3300048912 Bacteria 1461
478 Ga0496110_0000204 3300048913 Bacteria 37863
479 Ga0496110_0005194 3300048913 Bacteria 10189
480 Ga0496110_0194231 3300048913 Bacteria 1843
481 Ga0496111_0012866 3300048914 Bacteria 5678
482 Ga0496111_0137687 3300048914 Bacteria 1809
483 Ga0496112_0009281 3300048915 Bacteria 8845
484 Ga0496112_0133510 3300048915 Bacteria 2453
485 Ga0496112_0169588 3300048915 Bacteria 2148
486 Ga0496112_0204597 3300048915 Bacteria 1932
487 Ga0496113_0077218 3300048916 Bacteria 2546
488 Ga0496113_0117552 3300048916 Bacteria 2076
489 Ga0496114_0000183 3300048917 Bacteria 44987
490 Ga0496114_0002431 3300048917 Bacteria 14203
491 Ga0496114_0008349 3300048917 Bacteria 8205
492 Ga0496115_0002353 3300048918 Bacteria 13559
493 Ga0496115_0008628 3300048918 Bacteria 7548
494 Ga0496115_0067705 3300048918 Bacteria 2889
495 Ga0496115_0210732 3300048918 Bacteria 1605
496 Ga0496116_0000276 3300048919 Bacteria 89506
497 Ga0496116_0033653 3300048919 Bacteria 3632
498 Ga0496116_0046987 3300048919 Bacteria 2909
499 Ga0496117_0000003 3300048920 Bacteria 1881097
500 Ga0496117_0006489 3300048920 Bacteria 11809
501 Ga0496117_0098204 3300048920 Bacteria 1862
502 Ga0496118_0000001 3300048921 Bacteria 1881100
503 Ga0496118_0000275 3300048921 Bacteria 90451
504 Ga0496118_0000341 3300048921 Bacteria 79469
505 Ga0496118_0162480 3300048921 Bacteria 1378
506 Ga0496119_0006561 3300048922 Bacteria 10729
507 Ga0496120_0025924 3300048923 Bacteria 3630
508 Ga0496120_0044917 3300048923 Bacteria 2563
509 Ga0496120_0109896 3300048923 Bacteria 1442
510 Ga0496121_0000023 3300048924 Bacteria 463448
511 Ga0496121_0000338 3300048924 Bacteria 97703
512 Ga0496121_0001738 3300048924 Bacteria 35590
513 Ga0496122_0000038 3300048925 Bacteria 295624
514 Ga0496122_0026405 3300048925 Bacteria 5007
515 Ga0496123_0002987 3300048926 Bacteria 19631
516 Ga0496124_0000014 3300048927 Bacteria 463448
517 Ga0496124_0030038 3300048927 Bacteria 4831
518 Ga0496125_0000020 3300048928 Bacteria 463448
519 Ga0496125_0008077 3300048928 Bacteria 11092
520 Ga0496126_0000023 3300048929 Bacteria 463448
521 Ga0496126_0000551 3300048929 Bacteria 72093
522 Ga0496126_0008401 3300048929 Bacteria 11143
523 Ga0496126_0008647 3300048929 Bacteria 10943
524 Ga0496126_0010005 3300048929 Bacteria 10007
525 Ga0501032_0006716 3300049569 Bacteria 8448
526 Ga0501032_0009164 3300049569 Bacteria 7180
527 Ga0501033_0009441 3300049570 Bacteria 7511
528 Ga0501033_0028977 3300049570 Bacteria 4160
529 Ga0501033_0247261 3300049570 Bacteria 1265
530 Ga0501034_0002114 3300049571 Bacteria 24741
531 Ga0501036_0015314 3300049572 Bacteria 6403
532 Ga0501036_0027890 3300049572 Bacteria 4774
533 Ga0501036_0199295 3300049572 Bacteria 1684
534 Ga0501037_0000663 3300049573 Bacteria 26405
535 Ga0501037_0007033 3300049573 Bacteria 8218
536 Ga0501038_0004859 3300049574 Bacteria 12487
537 Ga0501038_0137370 3300049574 Bacteria 2002
538 Ga0501046_0002698 3300049580 Bacteria 16521
539 Ga0501046_0323907 3300049580 Bacteria 1123
540 Ga0501047_0005652 3300049581 Bacteria 11774
541 Ga0501047_0010238 3300049581 Bacteria 8870
542 Ga0501047_0072608 3300049581 Bacteria 3312
543 Ga0501048_0005199 3300049582 Bacteria 9916
544 Ga0501067_0091701 3300049583 Bacteria 1687
545 Ga0501069_0226164 3300049585 Bacteria 1088
546 Ga0501070_0000944 3300049586 Bacteria 26242
547 Ga0501070_0002391 3300049586 Bacteria 16459
548 Ga0501073_0053589 3300049589 Bacteria 2824
549 Ga0501080_0025955 3300049742 Bacteria 5443
550 Ga0501083_0128629 3300049744 Bacteria 1660
551 Ga0501035_0007347 3300049822 Bacteria 10297
552 Ga0501035_0014536 3300049822 Bacteria 7267
553 Ga0501035_0112493 3300049822 Bacteria 2386
554 Ga0501035_0342283 3300049822 Bacteria 1253
555 Ga0501044_0002147 3300049823 Bacteria 22617
556 Ga0501044_0002237 3300049823 Bacteria 22151
557 Ga0501044_0004046 3300049823 Bacteria 16449
558 Ga0501044_0030431 3300049823 Bacteria 5690
559 nmdc:mga03683_23831_c1 3300050489 Bacteria 2388
560 nmdc:mga03n38_117970_c1 3300050490 Bacteria 1301
561 nmdc:mga03n38_1904_c2 3300050490 Bacteria 1171
562 nmdc:mga03n38_40200_c1 3300050490 Bacteria 2032
563 nmdc:mga03n38_58591_c1 3300050490 Bacteria 1746
564 nmdc:mga00v17_15545_c1 3300050491 Bacteria 4272
565 nmdc:mga00v17_1631_c1 3300050491 Bacteria 11734
566 nmdc:mga00v17_181726_c1 3300050491 Bacteria 1357
567 nmdc:mga00v17_181928_c1 3300050491 Bacteria 1356
568 nmdc:mga00v17_42542_c1 3300050491 Bacteria 2733
569 nmdc:mga00v17_6388_c1 3300050491 Bacteria 6252
570 nmdc:mga00v17_65428_c1 3300050491 Bacteria 2243
571 nmdc:mga00v17_7327_c1 3300050491 Bacteria 5880
572 nmdc:mga0yw44_130559_c1 3300050492 Bacteria 1626
573 nmdc:mga0yw44_21851_c1 3300050492 Bacteria 3577
574 nmdc:mga0yw44_33112_c1 3300050492 Bacteria 3017
575 nmdc:mga0yw44_62629_c1 3300050492 Bacteria 2285
576 nmdc:mga0yw44_95983_c1 3300050492 Bacteria 1881
577 nmdc:mga06z11_151469_c1 3300050494 Bacteria 1319
578 nmdc:mga06z11_171378_c1 3300050494 Bacteria 1246
579 nmdc:mga06z11_221929_c1 3300050494 Bacteria 1105
580 nmdc:mga04h51_76722_c1 3300050495 Bacteria 1178
581 nmdc:mga07m45_13765_c1 3300050496 Bacteria 4296
582 nmdc:mga07m45_35234_c1 3300050496 Bacteria 2783
583 nmdc:mga07m45_57610_c1 3300050496 Bacteria 2197
584 nmdc:mga05p37_46015_c1 3300050507 Bacteria 5366
585 nmdc:mga0sz30_13696_c1 3300050516 Bacteria 3180
586 nmdc:mga0sz30_32403_c1 3300050516 Bacteria 2168
587 nmdc:mga0sz30_7569_c1 3300050516 Bacteria 4077
588 Ga0500610_0001927 3300053079 Bacteria 7382
589 Ga0500635_0003792 3300053080 Bacteria 3832
590 Ga0500643_008054 3300053087 Bacteria 4176
591 Ga0500556_0002820 3300053104 Bacteria 5318
592 Ga0500652_002710 3300053131 Bacteria 5348
593 Ga0500616_0101423 3300053153 Bacteria 1406
594 Ga0500616_0117672 3300053153 Bacteria 1274
595 Ga0500627_0057884 3300053158 Bacteria 1701
596 Ga0500627_0113044 3300053158 Bacteria 1223
597 Ga0500645_000195 3300053730 Bacteria 47101
598 Ga0501082_0279302 3300060353 Bacteria 1454
599 Ga0466962_0131362 3300061719 Bacteria 1210

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046809 Ga0495600_0028281 Ga0495600_0028281_2226_2927 226
2 3300050494 nmdc:mga06z11_171378_c1 nmdc:mga06z11_171378_c1_258_971 236
3 3300050494 nmdc:mga06z11_221929_c1 nmdc:mga06z11_221929_c1_345_1070 238
4 iso_pu_bacteria 2551306166 2552107817 243
5 3300014325 Ga0163163_10468024 Ga0163163_104680242 247
6 3300044765 Ga0466970_0004994 Ga0466970_0004994_3157_3927 247
7 3300046462 Ga0495651_0058527 Ga0495651_0058527_741_1505 247
8 3300046516 Ga0495628_0146898 Ga0495628_0146898_204_968 247
9 3300046529 Ga0495652_0101414 Ga0495652_0101414_637_1401 247
10 3300046543 Ga0495645_0046374 Ga0495645_0046374_1037_1801 247
11 3300047317 Ga0495604_0042184 Ga0495604_0042184_2292_3056 247
12 3300005539 Ga0068853_100103731 Ga0068853_1001037313 248
13 3300005548 Ga0070665_100173278 Ga0070665_1001732781 248
14 3300005563 Ga0068855_100006164 Ga0068855_1000061645 248
15 3300005578 Ga0068854_100010898 Ga0068854_1000108983 248
16 3300005614 Ga0068856_100012671 Ga0068856_1000126713 248
17 3300005616 Ga0068852_100033270 Ga0068852_1000332704 248
18 3300009093 Ga0105240_10064066 Ga0105240_100640663 248
19 3300009174 Ga0105241_10062428 Ga0105241_100624282 248
20 3300009545 Ga0105237_10028762 Ga0105237_100287621 248
21 3300009551 Ga0105238_10005858 Ga0105238_100058589 248
22 3300010375 Ga0105239_10014422 Ga0105239_100144228 248
23 3300013296 Ga0157374_10015721 Ga0157374_100157214 248
24 3300013307 Ga0157372_10701777 Ga0157372_107017771 248
25 3300025904 Ga0207647_10037258 Ga0207647_100372583 248
26 3300025911 Ga0207654_10033971 Ga0207654_100339712 248
27 3300025913 Ga0207695_10002792 Ga0207695_1000279211 248
28 3300025914 Ga0207671_10001326 Ga0207671_1000132611 248
29 3300025924 Ga0207694_10010486 Ga0207694_100104864 248
30 3300025949 Ga0207667_10068340 Ga0207667_100683402 248
31 3300025981 Ga0207640_10018643 Ga0207640_100186433 248
32 3300026041 Ga0207639_10178224 Ga0207639_101782242 248
33 3300026078 Ga0207702_10136825 Ga0207702_101368253 248
34 3300026142 Ga0207698_10168866 Ga0207698_101688662 248
35 3300028379 Ga0268266_10059256 Ga0268266_100592563 248
36 iso_pu_bacteria 2565956761 2566996442 251
37 iso_pu_bacteria 2738541308 2738889977 251
38 iso_pu_bacteria 2904535858 2904538956 251
39 iso_pu_bacteria 2738543005 2739205345 253
40 iso_pu_bacteria 2738543034 2739362189 253
41 iso_pu_bacteria 2904765812 2904770097 253
42 iso_pu_bacteria 2904770941 2904771054 253
43 iso_pu_bacteria 2908811453 2908815098 253
44 iso_pu_bacteria 2919420072 2919424419 253
45 iso_pu_bacteria 2919432681 2919436812 253
46 iso_pu_bacteria 2928142448 2928144949 253
47 3300006353 Ga0075370_10043886 Ga0075370_100438862 255
48 3300014325 Ga0163163_10537656 Ga0163163_105376562 256
49 iso_pu_bacteria 2738541264 2738666574 256
50 iso_pu_bacteria 2738541356 2739145418 256
51 3300006178 Ga0075367_10130491 Ga0075367_101304912 257
52 3300045976 Ga0466967_0521960 Ga0466967_0521960_371_1156 258
53 3300046476 Ga0495662_0090935 Ga0495662_0090935_560_1345 258
54 3300046674 Ga0495588_0014059 Ga0495588_0014059_1851_2636 258
55 3300047315 Ga0495581_0157259 Ga0495581_0157259_29_814 258
56 3300003792 Ga0055540_1000029 Ga0055540_1000029172 260
57 3300005335 Ga0070666_10125445 Ga0070666_101254452 260
58 3300005367 Ga0070667_100003577 Ga0070667_10000357710 260
59 3300009545 Ga0105237_10004825 Ga0105237_1000482511 260
60 3300010375 Ga0105239_10267608 Ga0105239_102676082 260
61 3300025303 Ga0209051_1000042 Ga0209051_1000042316 260
62 3300025914 Ga0207671_10010122 Ga0207671_100101227 260
63 3300025986 Ga0207658_10001582 Ga0207658_1000158215 260
64 3300031251 Ga0265327_10002914 Ga0265327_1000291411 260
65 3300031251 Ga0265327_10068663 Ga0265327_100686632 260
66 3300044683 Ga0466965_0020463 Ga0466965_0020463_417_1202 260
67 3300048903 Ga0496100_0000009 Ga0496100_0000009_161028_161813 260
68 3300048904 Ga0496101_0000018 Ga0496101_0000018_222754_223539 260
69 3300048905 Ga0496102_0127309 Ga0496102_0127309_1563_2348 260
70 3300048906 Ga0496103_0001096 Ga0496103_0001096_16994_17779 260
71 3300048909 Ga0496106_0020704 Ga0496106_0020704_2745_3530 260
72 3300048910 Ga0496107_0003353 Ga0496107_0003353_1715_2500 260
73 3300048912 Ga0496109_0000434 Ga0496109_0000434_9487_10272 260
74 3300048913 Ga0496110_0000204 Ga0496110_0000204_34848_35633 260
75 3300048914 Ga0496111_0012866 Ga0496111_0012866_3847_4632 260
76 3300048917 Ga0496114_0002431 Ga0496114_0002431_10507_11292 260
77 3300048918 Ga0496115_0067705 Ga0496115_0067705_740_1525 260
78 3300048919 Ga0496116_0033653 Ga0496116_0033653_1984_2769 260
79 3300048920 Ga0496117_0098204 Ga0496117_0098204_815_1600 260
80 3300048921 Ga0496118_0162480 Ga0496118_0162480_331_1116 260
81 3300048924 Ga0496121_0000023 Ga0496121_0000023_229951_230736 260
82 3300048925 Ga0496122_0000038 Ga0496122_0000038_229951_230736 260
83 3300048926 Ga0496123_0002987 Ga0496123_0002987_2009_2794 260
84 3300048927 Ga0496124_0000014 Ga0496124_0000014_229951_230736 260
85 3300048928 Ga0496125_0000020 Ga0496125_0000020_232713_233498 260
86 3300048929 Ga0496126_0000023 Ga0496126_0000023_229951_230736 260
87 3300005937 Ga0081455_10210050 Ga0081455_102100502 261
88 3300026118 Ga0207675_100825159 Ga0207675_1008251591 261
89 3300036712 Ga0316584_0075517 Ga0316584_0075517_1600_2388 261
90 3300044658 Ga0466972_0014121 Ga0466972_0014121_2139_2942 261
91 3300044683 Ga0466965_0004842 Ga0466965_0004842_2029_2832 261
92 3300044694 Ga0466963_0398302 Ga0466963_0398302_49_858 261
93 3300044735 Ga0466968_0002156 Ga0466968_0002156_4954_5757 261
94 3300044842 Ga0466957_0012567 Ga0466957_0012567_3897_4700 261
95 3300044901 Ga0466960_0003419 Ga0466960_0003419_3759_4562 261
96 3300045836 Ga0466958_0054031 Ga0466958_0054031_440_1243 261
97 3300045976 Ga0466967_0020211 Ga0466967_0020211_4039_4842 261
98 3300045976 Ga0466967_0421074 Ga0466967_0421074_71_880 261
99 3300046460 Ga0495638_0060257 Ga0495638_0060257_83_880 261
100 3300048925 Ga0496122_0026405 Ga0496122_0026405_3898_4701 261
101 3300048929 Ga0496126_0008401 Ga0496126_0008401_9874_10677 261
102 3300049581 Ga0501047_0072608 Ga0501047_0072608_1447_2247 261
103 3300049822 Ga0501035_0342283 Ga0501035_0342283_260_1060 261
104 3300050492 nmdc:mga0yw44_21851_c1 nmdc:mga0yw44_21851_c1_2394_3191 261
105 3300053087 Ga0500643_008054 Ga0500643_008054_2811_3608 261
106 3300053158 Ga0500627_0057884 Ga0500627_0057884_90_887 261
107 3300053730 Ga0500645_000195 Ga0500645_000195_13210_14007 261
108 3300039437 Ga0436365_0865525 Ga0436365_0865525_4472_5263 262
109 3300039437 Ga0436365_0997910 Ga0436365_0997910_3541_4335 262
110 3300039437 Ga0436365_1378611 Ga0436365_1378611_35002_35790 262
111 3300044683 Ga0466965_0177783 Ga0466965_0177783_129_929 262
112 3300044694 Ga0466963_0044299 Ga0466963_0044299_691_1482 262
113 3300044694 Ga0466963_0119194 Ga0466963_0119194_486_1283 262
114 3300044694 Ga0466963_0194228 Ga0466963_0194228_595_1392 262
115 3300044694 Ga0466963_0292415 Ga0466963_0292415_326_1123 262
116 3300044719 Ga0466971_0013433 Ga0466971_0013433_2380_3171 262
117 3300044901 Ga0466960_0000117 Ga0466960_0000117_12153_12962 262
118 3300045976 Ga0466967_0035544 Ga0466967_0035544_3406_4197 262
119 3300045976 Ga0466967_0128776 Ga0466967_0128776_81_878 262
120 3300048905 Ga0496102_0132204 Ga0496102_0132204_220_1008 262
121 3300048921 Ga0496118_0000341 Ga0496118_0000341_65232_66020 262
122 3300048929 Ga0496126_0008647 Ga0496126_0008647_8332_9129 262
123 3300049569 Ga0501032_0006716 Ga0501032_0006716_4559_5356 262
124 3300049570 Ga0501033_0028977 Ga0501033_0028977_1486_2283 262
125 3300049570 Ga0501033_0247261 Ga0501033_0247261_402_1196 262
126 3300049571 Ga0501034_0002114 Ga0501034_0002114_2518_3315 262
127 3300049572 Ga0501036_0027890 Ga0501036_0027890_284_1081 262
128 3300049573 Ga0501037_0007033 Ga0501037_0007033_2067_2864 262
129 3300049580 Ga0501046_0002698 Ga0501046_0002698_7574_8371 262
130 3300049580 Ga0501046_0323907 Ga0501046_0323907_121_915 262
131 3300049581 Ga0501047_0010238 Ga0501047_0010238_2068_2865 262
132 3300049582 Ga0501048_0005199 Ga0501048_0005199_430_1227 262
133 3300049585 Ga0501069_0226164 Ga0501069_0226164_204_1001 262
134 3300049586 Ga0501070_0002391 Ga0501070_0002391_4546_5343 262
135 3300049742 Ga0501080_0025955 Ga0501080_0025955_176_973 262
136 3300049744 Ga0501083_0128629 Ga0501083_0128629_767_1564 262
137 3300049822 Ga0501035_0014536 Ga0501035_0014536_3906_4703 262
138 3300049822 Ga0501035_0112493 Ga0501035_0112493_527_1318 262
139 3300049823 Ga0501044_0004046 Ga0501044_0004046_8477_9274 262
140 3300060353 Ga0501082_0279302 Ga0501082_0279302_313_1110 262
141 3300025915 Ga0207693_10507156 Ga0207693_105071561 264
142 3300035691 Ga0373931_0140682 Ga0373931_0140682_14_814 266
143 3300031251 Ga0265327_10027594 Ga0265327_100275943 267
144 iso_pu_bacteria 2643221692 2644512508 267
145 3300053153 Ga0500616_0101423 Ga0500616_0101423_194_1045 269
146 3300044684 Ga0466966_0070523 Ga0466966_0070523_477_1301 270
147 3300047320 Ga0495672_0003432 Ga0495672_0003432_2151_2972 271
148 3300049823 Ga0501044_0030431 Ga0501044_0030431_4743_5561 271
149 3300009176 Ga0105242_10226296 Ga0105242_102262962 272
150 3300009177 Ga0105248_10421801 Ga0105248_104218012 272
151 3300009545 Ga0105237_10265098 Ga0105237_102650981 272
152 3300013307 Ga0157372_10254023 Ga0157372_102540232 272
153 3300014969 Ga0157376_10562289 Ga0157376_105622892 272
154 3300035084 Ga0373928_0011509 Ga0373928_0011509_367_1185 272
155 3300035115 Ga0373941_0008988 Ga0373941_0008988_150_968 272
156 3300044694 Ga0466963_0073723 Ga0466963_0073723_521_1342 272
157 3300048903 Ga0496100_0190380 Ga0496100_0190380_647_1465 272
158 3300048906 Ga0496103_0046381 Ga0496103_0046381_25_843 272
159 3300048909 Ga0496106_0171967 Ga0496106_0171967_439_1257 272
160 3300048910 Ga0496107_0056165 Ga0496107_0056165_380_1198 272
161 3300048911 Ga0496108_0033508 Ga0496108_0033508_141_965 272
162 3300048918 Ga0496115_0210732 Ga0496115_0210732_551_1369 272
163 3300049589 Ga0501073_0053589 Ga0501073_0053589_1962_2807 272
164 3300050491 nmdc:mga00v17_15545_c1 nmdc:mga00v17_15545_c1_2787_3608 272
165 iso_pu_bacteria 2751185725 2753035223 272
166 iso_pu_bacteria 2751185792 2753323740 272
167 3300031251 Ga0265327_10000154 Ga0265327_1000015466 273
168 3300044658 Ga0466972_0041677 Ga0466972_0041677_205_1032 275
169 3300050492 nmdc:mga0yw44_130559_c1 nmdc:mga0yw44_130559_c1_131_970 275
170 3300006051 Ga0075364_10201295 Ga0075364_102012952 276
171 3300013105 Ga0157369_10069364 Ga0157369_100693642 276
172 3300037853 Ga0436364_1121346 Ga0436364_1121346_1677_2516 276
173 3300039437 Ga0436365_0593663 Ga0436365_0593663_319_1164 276
174 3300041460 Ga0451802_0086339 Ga0451802_0086339_321_1151 276
175 3300044656 Ga0466969_0031608 Ga0466969_0031608_1082_1936 276
176 3300044683 Ga0466965_0108892 Ga0466965_0108892_492_1331 276
177 3300044684 Ga0466966_0005734 Ga0466966_0005734_2371_3210 276
178 3300044684 Ga0466966_0010087 Ga0466966_0010087_3288_4142 276
179 3300044693 Ga0466961_0022594 Ga0466961_0022594_2380_3219 276
180 3300044735 Ga0466968_0001830 Ga0466968_0001830_6352_7206 276
181 3300044765 Ga0466970_0096414 Ga0466970_0096414_418_1272 276
182 3300044842 Ga0466957_0034553 Ga0466957_0034553_304_1143 276
183 3300045049 Ga0466959_0012610 Ga0466959_0012610_2325_3179 276
184 3300045049 Ga0466959_0064886 Ga0466959_0064886_632_1471 276
185 3300045836 Ga0466958_0001238 Ga0466958_0001238_2217_3056 276
186 3300045836 Ga0466958_0079579 Ga0466958_0079579_554_1408 276
187 3300045976 Ga0466967_0079399 Ga0466967_0079399_2056_2886 276
188 3300045976 Ga0466967_0338087 Ga0466967_0338087_258_1097 276
189 3300049570 Ga0501033_0009441 Ga0501033_0009441_4028_4861 276
190 3300049572 Ga0501036_0199295 Ga0501036_0199295_318_1151 276
191 3300049574 Ga0501038_0137370 Ga0501038_0137370_377_1210 276
192 3300049581 Ga0501047_0005652 Ga0501047_0005652_5049_5882 276
193 3300049822 Ga0501035_0007347 Ga0501035_0007347_2800_3633 276
194 3300049823 Ga0501044_0002147 Ga0501044_0002147_6566_7399 276
195 3300050491 nmdc:mga00v17_181928_c1 nmdc:mga00v17_181928_c1_108_947 276
196 3300050491 nmdc:mga00v17_42542_c1 nmdc:mga00v17_42542_c1_1840_2673 276
197 3300061719 Ga0466962_0131362 Ga0466962_0131362_296_1150 276
198 iso_pu_bacteria 2643221687 2644486430 276
199 iso_pu_bacteria 2902837492 2902840153 276
200 3300009092 Ga0105250_10032624 Ga0105250_100326242 277
201 3300009098 Ga0105245_10001029 Ga0105245_1000102922 277
202 3300009101 Ga0105247_10009458 Ga0105247_100094586 277
203 3300009147 Ga0114129_10043041 Ga0114129_100430412 277
204 3300009148 Ga0105243_10001000 Ga0105243_1000100022 277
205 3300009176 Ga0105242_10000759 Ga0105242_100007592 277
206 3300009177 Ga0105248_10003071 Ga0105248_100030715 277
207 3300009177 Ga0105248_10333447 Ga0105248_103334472 277
208 3300009545 Ga0105237_10107256 Ga0105237_101072563 277
209 3300009551 Ga0105238_10127461 Ga0105238_101274612 277
210 3300009553 Ga0105249_10005589 Ga0105249_100055899 277
211 3300009553 Ga0105249_10015924 Ga0105249_100159242 277
212 3300009553 Ga0105249_10313969 Ga0105249_103139692 277
213 3300010375 Ga0105239_10016836 Ga0105239_100168369 277
214 3300013296 Ga0157374_10175252 Ga0157374_101752522 277
215 3300013297 Ga0157378_10001038 Ga0157378_100010382 277
216 3300013306 Ga0163162_10018684 Ga0163162_100186842 277
217 3300013306 Ga0163162_10071077 Ga0163162_100710773 277
218 3300013307 Ga0157372_10011618 Ga0157372_100116182 277
219 3300013308 Ga0157375_10000838 Ga0157375_100008382 277
220 3300013308 Ga0157375_10397655 Ga0157375_103976552 277
221 3300014325 Ga0163163_10062712 Ga0163163_100627122 277
222 3300014326 Ga0157380_10001428 Ga0157380_1000142815 277
223 3300014968 Ga0157379_10016789 Ga0157379_100167898 277
224 3300014969 Ga0157376_10049082 Ga0157376_100490823 277
225 3300035691 Ga0373931_0222767 Ga0373931_0222767_34_867 277
226 3300041411 Ga0439466_0012631 Ga0439466_0012631_1218_2051 277
227 3300041411 Ga0439466_0027199 Ga0439466_0027199_64_900 277
228 3300041411 Ga0439466_0028287 Ga0439466_0028287_766_1599 277
229 3300041413 Ga0439465_0003815 Ga0439465_0003815_211_1044 277
230 3300041413 Ga0439465_0006734 Ga0439465_0006734_908_1741 277
231 3300041459 Ga0451800_0666987 Ga0451800_0666987_272_1111 277
232 3300042004 Ga0439445_0003672 Ga0439445_0003672_2145_2981 277
233 3300042004 Ga0439445_0004053 Ga0439445_0004053_1369_2202 277
234 3300042008 Ga0439450_046751 Ga0439450_046751_161_1000 277
235 3300042435 Ga0439434_0028143 Ga0439434_0028143_232_1068 277
236 3300042435 Ga0439434_0054856 Ga0439434_0054856_388_1221 277
237 3300044656 Ga0466969_0037463 Ga0466969_0037463_139_972 277
238 3300044658 Ga0466972_0011693 Ga0466972_0011693_632_1465 277
239 3300044683 Ga0466965_0003164 Ga0466965_0003164_2097_2930 277
240 3300044684 Ga0466966_0021904 Ga0466966_0021904_757_1590 277
241 3300044693 Ga0466961_0009580 Ga0466961_0009580_4594_5427 277
242 3300044719 Ga0466971_0001079 Ga0466971_0001079_8676_9509 277
243 3300044765 Ga0466970_0045119 Ga0466970_0045119_938_1771 277
244 3300045976 Ga0466967_0374162 Ga0466967_0374162_123_962 277
245 3300046475 Ga0495639_0111381 Ga0495639_0111381_179_1018 277
246 3300046476 Ga0495662_0044921 Ga0495662_0044921_897_1736 277
247 3300046690 Ga0495624_0082450 Ga0495624_0082450_343_1182 277
248 3300047319 Ga0495674_0120535 Ga0495674_0120535_1168_2007 277
249 3300047320 Ga0495672_0170829 Ga0495672_0170829_235_1068 277
250 3300047321 Ga0495676_0117740 Ga0495676_0117740_340_1179 277
251 3300047673 Ga0495593_0010681 Ga0495593_0010681_175_1014 277
252 3300048903 Ga0496100_0068760 Ga0496100_0068760_557_1390 277
253 3300048903 Ga0496100_0196940 Ga0496100_0196940_183_1016 277
254 3300048903 Ga0496100_0496323 Ga0496100_0496323_73_906 277
255 3300048904 Ga0496101_0026670 Ga0496101_0026670_1878_2711 277
256 3300048904 Ga0496101_0091404 Ga0496101_0091404_1196_2029 277
257 3300048905 Ga0496102_0012165 Ga0496102_0012165_1408_2241 277
258 3300048905 Ga0496102_0012619 Ga0496102_0012619_5626_6459 277
259 3300048906 Ga0496103_0000538 Ga0496103_0000538_24526_25359 277
260 3300048906 Ga0496103_0159629 Ga0496103_0159629_573_1409 277
261 3300048907 Ga0496104_0017819 Ga0496104_0017819_209_1042 277
262 3300048907 Ga0496104_0230975 Ga0496104_0230975_164_997 277
263 3300048907 Ga0496104_0341286 Ga0496104_0341286_231_1082 277
264 3300048908 Ga0496105_0037799 Ga0496105_0037799_2156_2989 277
265 3300048909 Ga0496106_0003068 Ga0496106_0003068_2684_3517 277
266 3300048910 Ga0496107_0001670 Ga0496107_0001670_4776_5609 277
267 3300048911 Ga0496108_0094431 Ga0496108_0094431_1024_1866 277
268 3300048912 Ga0496109_0016900 Ga0496109_0016900_757_1590 277
269 3300048912 Ga0496109_0321026 Ga0496109_0321026_527_1360 277
270 3300048913 Ga0496110_0005194 Ga0496110_0005194_2922_3755 277
271 3300048913 Ga0496110_0194231 Ga0496110_0194231_62_895 277
272 3300048914 Ga0496111_0137687 Ga0496111_0137687_141_974 277
273 3300048915 Ga0496112_0009281 Ga0496112_0009281_6840_7679 277
274 3300048915 Ga0496112_0204597 Ga0496112_0204597_200_1033 277
275 3300048916 Ga0496113_0117552 Ga0496113_0117552_310_1143 277
276 3300048917 Ga0496114_0000183 Ga0496114_0000183_32048_32881 277
277 3300048918 Ga0496115_0008628 Ga0496115_0008628_1512_2345 277
278 3300050489 nmdc:mga03683_23831_c1 nmdc:mga03683_23831_c1_789_1622 277
279 3300050490 nmdc:mga03n38_117970_c1 nmdc:mga03n38_117970_c1_418_1254 277
280 3300050490 nmdc:mga03n38_1904_c2 nmdc:mga03n38_1904_c2_297_1133 277
281 3300050491 nmdc:mga00v17_1631_c1 nmdc:mga00v17_1631_c1_10223_11056 277
282 3300050491 nmdc:mga00v17_6388_c1 nmdc:mga00v17_6388_c1_1468_2301 277
283 3300050491 nmdc:mga00v17_65428_c1 nmdc:mga00v17_65428_c1_1292_2128 277
284 3300050492 nmdc:mga0yw44_33112_c1 nmdc:mga0yw44_33112_c1_2088_2921 277
285 3300050492 nmdc:mga0yw44_62629_c1 nmdc:mga0yw44_62629_c1_1285_2121 277
286 3300050492 nmdc:mga0yw44_95983_c1 nmdc:mga0yw44_95983_c1_342_1178 277
287 3300050494 nmdc:mga06z11_151469_c1 nmdc:mga06z11_151469_c1_36_872 277
288 3300050495 nmdc:mga04h51_76722_c1 nmdc:mga04h51_76722_c1_43_879 277
289 3300050496 nmdc:mga07m45_57610_c1 nmdc:mga07m45_57610_c1_1215_2051 277
290 3300050507 nmdc:mga05p37_46015_c1 nmdc:mga05p37_46015_c1_3808_4641 277
291 3300050516 nmdc:mga0sz30_7569_c1 nmdc:mga0sz30_7569_c1_2725_3558 277
292 iso_pu_bacteria 2738541274 2738706098 277
293 iso_pu_bacteria 2738543028 2739333002 277
294 iso_pu_bacteria 2842134933 2842138452 277
295 iso_pu_bacteria 2902792274 2902798447 277
296 iso_pu_bacteria 2902799365 2902801608 277
297 3300048907 Ga0496104_0413151 Ga0496104_0413151_215_1066 278
298 iso_pu_bacteria 2929212328 2929214917 278
299 3300003792 Ga0055540_1002541 Ga0055540_10025413 280
300 3300003792 Ga0055540_1003267 Ga0055540_10032675 280
301 3300003792 Ga0055540_1004510 Ga0055540_10045102 280
302 3300005539 Ga0068853_100008592 Ga0068853_1000085923 280
303 3300006038 Ga0075365_10033291 Ga0075365_100332914 280
304 3300006038 Ga0075365_10093120 Ga0075365_100931202 280
305 3300006186 Ga0075369_10090683 Ga0075369_100906832 280
306 3300025273 Ga0209673_1029315 Ga0209673_10293153 280
307 3300025303 Ga0209051_1004157 Ga0209051_10041576 280
308 3300025303 Ga0209051_1008656 Ga0209051_10086562 280
309 3300025303 Ga0209051_1015862 Ga0209051_10158624 280
310 3300026041 Ga0207639_10008929 Ga0207639_100089296 280
311 3300041452 Ga0451793_0913039 Ga0451793_0913039_862_1710 280
312 3300041462 Ga0451806_876685 Ga0451806_876685_373_1221 280
313 3300047472 Ga0495686_0002735 Ga0495686_0002735_13127_13975 280
314 3300050491 nmdc:mga00v17_181726_c1 nmdc:mga00v17_181726_c1_428_1282 280
315 3300005347 Ga0070668_100034956 Ga0070668_1000349562 281
316 3300005353 Ga0070669_100001847 Ga0070669_10000184711 281
317 3300005355 Ga0070671_100149893 Ga0070671_1001498931 281
318 3300005356 Ga0070674_100017309 Ga0070674_1000173094 281
319 3300005367 Ga0070667_100000391 Ga0070667_10000039134 281
320 3300005435 Ga0070714_100033174 Ga0070714_1000331743 281
321 3300005615 Ga0070702_100152457 Ga0070702_1001524572 281
322 3300005617 Ga0068859_100032433 Ga0068859_1000324335 281
323 3300005618 Ga0068864_100351267 Ga0068864_1003512672 281
324 3300005841 Ga0068863_100000992 Ga0068863_1000009923 281
325 3300005841 Ga0068863_100483321 Ga0068863_1004833212 281
326 3300005842 Ga0068858_100029600 Ga0068858_1000296005 281
327 3300005843 Ga0068860_100000065 Ga0068860_100000065173 281
328 3300005844 Ga0068862_100000028 Ga0068862_100000028167 281
329 3300006051 Ga0075364_10060585 Ga0075364_100605852 281
330 3300006186 Ga0075369_10010294 Ga0075369_100102943 281
331 3300006931 Ga0097620_100032433 Ga0097620_1000324335 281
332 3300009101 Ga0105247_10000232 Ga0105247_1000023224 281
333 3300009177 Ga0105248_10000074 Ga0105248_1000007424 281
334 3300009545 Ga0105237_10010195 Ga0105237_100101953 281
335 3300009553 Ga0105249_10000011 Ga0105249_10000011255 281
336 3300014325 Ga0163163_10046502 Ga0163163_100465025 281
337 3300021377 Ga0213874_10089055 Ga0213874_100890551 281
338 3300025898 Ga0207692_10049291 Ga0207692_100492912 281
339 3300025900 Ga0207710_10000022 Ga0207710_10000022288 281
340 3300025914 Ga0207671_10041471 Ga0207671_100414712 281
341 3300025923 Ga0207681_10001802 Ga0207681_100018027 281
342 3300025928 Ga0207700_10041267 Ga0207700_100412672 281
343 3300025929 Ga0207664_10261936 Ga0207664_102619362 281
344 3300025929 Ga0207664_10450520 Ga0207664_104505201 281
345 3300025931 Ga0207644_10315948 Ga0207644_103159482 281
346 3300025937 Ga0207669_10038390 Ga0207669_100383902 281
347 3300025941 Ga0207711_10001226 Ga0207711_100012268 281
348 3300025941 Ga0207711_10014691 Ga0207711_100146916 281
349 3300025961 Ga0207712_10000020 Ga0207712_1000002023 281
350 3300025986 Ga0207658_10000284 Ga0207658_1000028423 281
351 3300026035 Ga0207703_10040837 Ga0207703_100408372 281
352 3300026088 Ga0207641_10001875 Ga0207641_1000187510 281
353 3300026088 Ga0207641_10120457 Ga0207641_101204572 281
354 3300026095 Ga0207676_10068225 Ga0207676_100682252 281
355 3300026095 Ga0207676_10301592 Ga0207676_103015922 281
356 3300028380 Ga0268265_10000004 Ga0268265_10000004433 281
357 3300028381 Ga0268264_10000024 Ga0268264_10000024443 281
358 3300031728 Ga0316578_10065817 Ga0316578_100658172 281
359 3300046460 Ga0495638_0000404 Ga0495638_0000404_14824_15675 281
360 3300046524 Ga0495648_0004183 Ga0495648_0004183_9967_10836 281
361 3300046694 Ga0495649_0135016 Ga0495649_0135016_111_986 281
362 3300047469 Ga0495673_0002291 Ga0495673_0002291_10554_11423 281
363 3300048903 Ga0496100_0001047 Ga0496100_0001047_8724_9599 281
364 3300048904 Ga0496101_0000102 Ga0496101_0000102_2428_3279 281
365 3300048904 Ga0496101_0000931 Ga0496101_0000931_11885_12760 281
366 3300048904 Ga0496101_0009266 Ga0496101_0009266_3006_3857 281
367 3300048905 Ga0496102_0000037 Ga0496102_0000037_85526_86377 281
368 3300048905 Ga0496102_0000256 Ga0496102_0000256_17819_18670 281
369 3300048906 Ga0496103_0000004 Ga0496103_0000004_396238_397089 281
370 3300048906 Ga0496103_0000989 Ga0496103_0000989_2402_3253 281
371 3300048907 Ga0496104_0002403 Ga0496104_0002403_5718_6593 281
372 3300048908 Ga0496105_0008381 Ga0496105_0008381_4845_5720 281
373 3300048909 Ga0496106_0001747 Ga0496106_0001747_7251_8126 281
374 3300048909 Ga0496106_0022182 Ga0496106_0022182_1276_2127 281
375 3300048910 Ga0496107_0012063 Ga0496107_0012063_3781_4632 281
376 3300048910 Ga0496107_0012623 Ga0496107_0012623_2359_3234 281
377 3300048910 Ga0496107_0090242 Ga0496107_0090242_327_1178 281
378 3300048917 Ga0496114_0008349 Ga0496114_0008349_4728_5603 281
379 3300048918 Ga0496115_0002353 Ga0496115_0002353_5117_5992 281
380 3300048919 Ga0496116_0000276 Ga0496116_0000276_85500_86351 281
381 3300048919 Ga0496116_0046987 Ga0496116_0046987_1624_2475 281
382 3300048920 Ga0496117_0000003 Ga0496117_0000003_1594641_1595492 281
383 3300048920 Ga0496117_0006489 Ga0496117_0006489_435_1286 281
384 3300048921 Ga0496118_0000001 Ga0496118_0000001_1594644_1595495 281
385 3300048921 Ga0496118_0000275 Ga0496118_0000275_20486_21337 281
386 3300048922 Ga0496119_0006561 Ga0496119_0006561_7171_8022 281
387 3300048923 Ga0496120_0025924 Ga0496120_0025924_589_1440 281
388 3300048923 Ga0496120_0044917 Ga0496120_0044917_46_897 281
389 3300048923 Ga0496120_0109896 Ga0496120_0109896_199_1062 281
390 3300048924 Ga0496121_0000338 Ga0496121_0000338_94425_95276 281
391 3300048924 Ga0496121_0001738 Ga0496121_0001738_3608_4459 281
392 3300048927 Ga0496124_0030038 Ga0496124_0030038_1624_2475 281
393 3300048928 Ga0496125_0008077 Ga0496125_0008077_1379_2230 281
394 3300048929 Ga0496126_0000551 Ga0496126_0000551_68068_68919 281
395 3300048929 Ga0496126_0010005 Ga0496126_0010005_5198_6049 281
396 3300053079 Ga0500610_0001927 Ga0500610_0001927_1396_2271 281
397 3300053080 Ga0500635_0003792 Ga0500635_0003792_2370_3218 281
398 3300053104 Ga0500556_0002820 Ga0500556_0002820_3575_4426 281
399 3300053131 Ga0500652_002710 Ga0500652_002710_3572_4420 281
400 3300053153 Ga0500616_0117672 Ga0500616_0117672_371_1246 281
401 3300053158 Ga0500627_0113044 Ga0500627_0113044_354_1205 281
402 3300001977 JGI24746J21847_1011268 JGI24746J21847_10112682 282
403 3300002073 JGI24745J21846_1009453 JGI24745J21846_10094531 282
404 3300002073 JGI24745J21846_1012054 JGI24745J21846_10120541 282
405 3300002076 JGI24749J21850_1001809 JGI24749J21850_10018092 282
406 3300002077 JGI24744J21845_10010692 JGI24744J21845_100106922 282
407 3300002239 JGI24034J26672_10012582 JGI24034J26672_100125822 282
408 3300005328 Ga0070676_10019431 Ga0070676_100194313 282
409 3300005329 Ga0070683_100092309 Ga0070683_1000923093 282
410 3300005329 Ga0070683_100211327 Ga0070683_1002113272 282
411 3300005330 Ga0070690_100034010 Ga0070690_1000340102 282
412 3300005331 Ga0070670_100092554 Ga0070670_1000925542 282
413 3300005334 Ga0068869_100044162 Ga0068869_1000441622 282
414 3300005337 Ga0070682_100012745 Ga0070682_1000127454 282
415 3300005337 Ga0070682_100020030 Ga0070682_1000200303 282
416 3300005338 Ga0068868_100012095 Ga0068868_1000120957 282
417 3300005339 Ga0070660_100053721 Ga0070660_1000537213 282
418 3300005340 Ga0070689_100178783 Ga0070689_1001787831 282
419 3300005340 Ga0070689_100444973 Ga0070689_1004449731 282
420 3300005347 Ga0070668_100027824 Ga0070668_1000278244 282
421 3300005355 Ga0070671_100006018 Ga0070671_1000060187 282
422 3300005355 Ga0070671_100069793 Ga0070671_1000697933 282
423 3300005356 Ga0070674_100006799 Ga0070674_1000067992 282
424 3300005356 Ga0070674_100065972 Ga0070674_1000659722 282
425 3300005365 Ga0070688_100014710 Ga0070688_1000147103 282
426 3300005366 Ga0070659_100063391 Ga0070659_1000633912 282
427 3300005366 Ga0070659_100164909 Ga0070659_1001649093 282
428 3300005367 Ga0070667_100003100 Ga0070667_1000031002 282
429 3300005367 Ga0070667_100015262 Ga0070667_1000152622 282
430 3300005367 Ga0070667_100084670 Ga0070667_1000846702 282
431 3300005367 Ga0070667_100140469 Ga0070667_1001404691 282
432 3300005367 Ga0070667_100529738 Ga0070667_1005297381 282
433 3300005434 Ga0070709_10120023 Ga0070709_101200231 282
434 3300005435 Ga0070714_100251271 Ga0070714_1002512712 282
435 3300005435 Ga0070714_100252258 Ga0070714_1002522582 282
436 3300005437 Ga0070710_10017522 Ga0070710_100175224 282
437 3300005438 Ga0070701_10007431 Ga0070701_100074314 282
438 3300005439 Ga0070711_100000375 Ga0070711_10000037519 282
439 3300005439 Ga0070711_100027419 Ga0070711_1000274194 282
440 3300005440 Ga0070705_100061875 Ga0070705_1000618752 282
441 3300005440 Ga0070705_100079824 Ga0070705_1000798241 282
442 3300005441 Ga0070700_100093028 Ga0070700_1000930282 282
443 3300005455 Ga0070663_100028665 Ga0070663_1000286653 282
444 3300005456 Ga0070678_100001259 Ga0070678_10000125913 282
445 3300005456 Ga0070678_100117161 Ga0070678_1001171612 282
446 3300005457 Ga0070662_100015363 Ga0070662_1000153632 282
447 3300005535 Ga0070684_100108762 Ga0070684_1001087621 282
448 3300005539 Ga0068853_100059908 Ga0068853_1000599083 282
449 3300005543 Ga0070672_100085529 Ga0070672_1000855292 282
450 3300005544 Ga0070686_100228465 Ga0070686_1002284652 282
451 3300005546 Ga0070696_100001702 Ga0070696_1000017022 282
452 3300005546 Ga0070696_100033682 Ga0070696_1000336824 282
453 3300005548 Ga0070665_100018284 Ga0070665_1000182842 282
454 3300005548 Ga0070665_100050045 Ga0070665_1000500452 282
455 3300005548 Ga0070665_100141304 Ga0070665_1001413042 282
456 3300005549 Ga0070704_100001435 Ga0070704_1000014352 282
457 3300005563 Ga0068855_100038774 Ga0068855_1000387745 282
458 3300005578 Ga0068854_100003064 Ga0068854_1000030642 282
459 3300005615 Ga0070702_100032358 Ga0070702_1000323582 282
460 3300005615 Ga0070702_100077581 Ga0070702_1000775812 282
461 3300005616 Ga0068852_100089668 Ga0068852_1000896682 282
462 3300005617 Ga0068859_100008118 Ga0068859_10000811811 282
463 3300005618 Ga0068864_100065747 Ga0068864_1000657472 282
464 3300005618 Ga0068864_100094936 Ga0068864_1000949362 282
465 3300005718 Ga0068866_10000812 Ga0068866_1000081213 282
466 3300005718 Ga0068866_10035513 Ga0068866_100355132 282
467 3300005719 Ga0068861_100009768 Ga0068861_1000097682 282
468 3300005841 Ga0068863_100011377 Ga0068863_1000113776 282
469 3300005841 Ga0068863_100060458 Ga0068863_1000604583 282
470 3300005842 Ga0068858_100001306 Ga0068858_10000130621 282
471 3300005843 Ga0068860_100235614 Ga0068860_1002356141 282
472 3300006038 Ga0075365_10015167 Ga0075365_100151672 282
473 3300006038 Ga0075365_10160424 Ga0075365_101604242 282
474 3300006048 Ga0075363_100003126 Ga0075363_1000031266 282
475 3300006048 Ga0075363_100014059 Ga0075363_1000140592 282
476 3300006048 Ga0075363_100014862 Ga0075363_1000148623 282
477 3300006048 Ga0075363_100095625 Ga0075363_1000956252 282
478 3300006051 Ga0075364_10001383 Ga0075364_100013832 282
479 3300006051 Ga0075364_10006919 Ga0075364_100069197 282
480 3300006051 Ga0075364_10013609 Ga0075364_100136094 282
481 3300006051 Ga0075364_10094436 Ga0075364_100944362 282
482 3300006051 Ga0075364_10118586 Ga0075364_101185862 282
483 3300006163 Ga0070715_10001286 Ga0070715_100012862 282
484 3300006163 Ga0070715_10070106 Ga0070715_100701062 282
485 3300006173 Ga0070716_100003259 Ga0070716_1000032599 282
486 3300006173 Ga0070716_100388212 Ga0070716_1003882121 282
487 3300006175 Ga0070712_100008493 Ga0070712_1000084932 282
488 3300006175 Ga0070712_100064828 Ga0070712_1000648282 282
489 3300006177 Ga0075362_10010964 Ga0075362_100109642 282
490 3300006177 Ga0075362_10042022 Ga0075362_100420222 282
491 3300006178 Ga0075367_10008062 Ga0075367_100080625 282
492 3300006178 Ga0075367_10255738 Ga0075367_102557381 282
493 3300006186 Ga0075369_10002341 Ga0075369_100023412 282
494 3300006186 Ga0075369_10101291 Ga0075369_101012912 282
495 3300006195 Ga0075366_10070125 Ga0075366_100701252 282
496 3300006237 Ga0097621_100149369 Ga0097621_1001493692 282
497 3300006237 Ga0097621_100208351 Ga0097621_1002083512 282
498 3300006353 Ga0075370_10012324 Ga0075370_100123243 282
499 3300006353 Ga0075370_10018620 Ga0075370_100186202 282
500 3300006353 Ga0075370_10019367 Ga0075370_100193672 282
501 3300006353 Ga0075370_10030301 Ga0075370_100303012 282
502 3300006353 Ga0075370_10063273 Ga0075370_100632732 282
503 3300006353 Ga0075370_10071213 Ga0075370_100712132 282
504 3300006844 Ga0075428_100004253 Ga0075428_10000425313 282
505 3300006881 Ga0068865_100167486 Ga0068865_1001674862 282
506 3300006931 Ga0097620_100008118 Ga0097620_10000811811 282
507 3300009551 Ga0105238_10252130 Ga0105238_102521302 282
508 3300010375 Ga0105239_10198895 Ga0105239_101988952 282
509 3300011119 Ga0105246_10198502 Ga0105246_101985023 282
510 3300013102 Ga0157371_10159628 Ga0157371_101596282 282
511 3300013105 Ga0157369_10435238 Ga0157369_104352382 282
512 3300013308 Ga0157375_10228333 Ga0157375_102283332 282
513 3300014745 Ga0157377_10015647 Ga0157377_100156472 282
514 3300014968 Ga0157379_10309819 Ga0157379_103098192 282
515 3300017792 Ga0163161_10003257 Ga0163161_100032572 282
516 3300017792 Ga0163161_10173713 Ga0163161_101737132 282
517 3300021384 Ga0213876_10003552 Ga0213876_100035528 282
518 3300021384 Ga0213876_10018948 Ga0213876_100189482 282
519 3300025885 Ga0207653_10002968 Ga0207653_100029681 282
520 3300025898 Ga0207692_10003952 Ga0207692_100039526 282
521 3300025898 Ga0207692_10026397 Ga0207692_100263973 282
522 3300025899 Ga0207642_10000117 Ga0207642_100001175 282
523 3300025901 Ga0207688_10005173 Ga0207688_100051731 282
524 3300025901 Ga0207688_10007002 Ga0207688_100070025 282
525 3300025904 Ga0207647_10044118 Ga0207647_100441182 282
526 3300025904 Ga0207647_10122375 Ga0207647_101223752 282
527 3300025905 Ga0207685_10049609 Ga0207685_100496092 282
528 3300025905 Ga0207685_10089453 Ga0207685_100894532 282
529 3300025908 Ga0207643_10203479 Ga0207643_102034792 282
530 3300025915 Ga0207693_10000930 Ga0207693_1000093022 282
531 3300025915 Ga0207693_10001479 Ga0207693_100014792 282
532 3300025916 Ga0207663_10002583 Ga0207663_100025834 282
533 3300025916 Ga0207663_10073617 Ga0207663_100736173 282
534 3300025923 Ga0207681_10027533 Ga0207681_100275332 282
535 3300025924 Ga0207694_10366477 Ga0207694_103664771 282
536 3300025925 Ga0207650_10105386 Ga0207650_101053861 282
537 3300025927 Ga0207687_10001341 Ga0207687_1000134112 282
538 3300025929 Ga0207664_10104274 Ga0207664_101042742 282
539 3300025932 Ga0207690_10018077 Ga0207690_100180774 282
540 3300025932 Ga0207690_10033766 Ga0207690_100337662 282
541 3300025933 Ga0207706_10010030 Ga0207706_100100308 282
542 3300025933 Ga0207706_10143832 Ga0207706_101438321 282
543 3300025935 Ga0207709_10021840 Ga0207709_100218402 282
544 3300025935 Ga0207709_10064292 Ga0207709_100642922 282
545 3300025936 Ga0207670_10137047 Ga0207670_101370472 282
546 3300025936 Ga0207670_10166116 Ga0207670_101661162 282
547 3300025937 Ga0207669_10000297 Ga0207669_100002977 282
548 3300025938 Ga0207704_10007363 Ga0207704_100073633 282
549 3300025938 Ga0207704_10023526 Ga0207704_100235263 282
550 3300025939 Ga0207665_10008653 Ga0207665_100086535 282
551 3300025939 Ga0207665_10290570 Ga0207665_102905702 282
552 3300025940 Ga0207691_10061917 Ga0207691_100619173 282
553 3300025941 Ga0207711_10362162 Ga0207711_103621622 282
554 3300025942 Ga0207689_10032281 Ga0207689_100322813 282
555 3300025944 Ga0207661_10167397 Ga0207661_101673972 282
556 3300025945 Ga0207679_10331582 Ga0207679_103315822 282
557 3300025949 Ga0207667_10051635 Ga0207667_100516353 282
558 3300025960 Ga0207651_10058995 Ga0207651_100589951 282
559 3300025961 Ga0207712_10008422 Ga0207712_100084224 282
560 3300025961 Ga0207712_10011195 Ga0207712_100111952 282
561 3300025961 Ga0207712_10383786 Ga0207712_103837862 282
562 3300025972 Ga0207668_10029134 Ga0207668_100291343 282
563 3300025972 Ga0207668_10104725 Ga0207668_101047251 282
564 3300025972 Ga0207668_10320497 Ga0207668_103204971 282
565 3300025981 Ga0207640_10026973 Ga0207640_100269732 282
566 3300025986 Ga0207658_10004009 Ga0207658_100040098 282
567 3300025986 Ga0207658_10015254 Ga0207658_100152544 282
568 3300025986 Ga0207658_10110492 Ga0207658_101104922 282
569 3300026023 Ga0207677_10002994 Ga0207677_100029943 282
570 3300026035 Ga0207703_10001189 Ga0207703_1000118922 282
571 3300026067 Ga0207678_10013971 Ga0207678_100139719 282
572 3300026067 Ga0207678_10061884 Ga0207678_100618842 282
573 3300026075 Ga0207708_10031691 Ga0207708_100316912 282
574 3300026078 Ga0207702_10202743 Ga0207702_102027432 282
575 3300026088 Ga0207641_10034263 Ga0207641_100342632 282
576 3300026088 Ga0207641_10133498 Ga0207641_101334982 282
577 3300026089 Ga0207648_10001361 Ga0207648_100013614 282
578 3300026089 Ga0207648_10046867 Ga0207648_100468673 282
579 3300026095 Ga0207676_10048723 Ga0207676_100487232 282
580 3300026095 Ga0207676_10125993 Ga0207676_101259932 282
581 3300026095 Ga0207676_10356650 Ga0207676_103566502 282
582 3300026118 Ga0207675_100003845 Ga0207675_10000384513 282
583 3300026121 Ga0207683_10002759 Ga0207683_100027592 282
584 3300026121 Ga0207683_10005268 Ga0207683_1000526812 282
585 3300027907 Ga0207428_10269006 Ga0207428_102690061 282
586 3300028379 Ga0268266_10004748 Ga0268266_100047487 282
587 3300028379 Ga0268266_10074922 Ga0268266_100749222 282
588 3300028379 Ga0268266_10082710 Ga0268266_100827102 282
589 3300028380 Ga0268265_10046780 Ga0268265_100467802 282
590 3300028380 Ga0268265_10549158 Ga0268265_105491582 282
591 3300028381 Ga0268264_10004434 Ga0268264_100044342 282
592 3300028381 Ga0268264_10180557 Ga0268264_101805572 282
593 3300031824 Ga0307413_10030289 Ga0307413_100302892 282
594 3300031903 Ga0307407_10117839 Ga0307407_101178392 282
595 3300031995 Ga0307409_100032573 Ga0307409_1000325731 282
596 3300031995 Ga0307409_100331609 Ga0307409_1003316092 282
597 3300032002 Ga0307416_100792870 Ga0307416_1007928701 282
598 3300032005 Ga0307411_10177701 Ga0307411_101777012 282
599 3300032126 Ga0307415_100149364 Ga0307415_1001493642 282
600 3300035725 Ga0373947_0097832 Ga0373947_0097832_677_1531 282
601 3300039450 Ga0436363_0789807 Ga0436363_0789807_5794_6657 282
602 3300044842 Ga0466957_0028501 Ga0466957_0028501_287_1144 282
603 3300044901 Ga0466960_0000905 Ga0466960_0000905_2188_3045 282
604 3300046455 Ga0495603_0035321 Ga0495603_0035321_1255_2109 282
605 3300048903 Ga0496100_0040440 Ga0496100_0040440_1363_2217 282
606 3300048905 Ga0496102_0045412 Ga0496102_0045412_1255_2178 282
607 3300048912 Ga0496109_0001781 Ga0496109_0001781_2524_3372 282
608 3300048915 Ga0496112_0133510 Ga0496112_0133510_1301_2167 282
609 3300048915 Ga0496112_0169588 Ga0496112_0169588_67_915 282
610 3300048916 Ga0496113_0077218 Ga0496113_0077218_1238_2092 282
611 3300049569 Ga0501032_0009164 Ga0501032_0009164_2138_3004 282
612 3300049572 Ga0501036_0015314 Ga0501036_0015314_3570_4436 282
613 3300049573 Ga0501037_0000663 Ga0501037_0000663_25410_26276 282
614 3300049574 Ga0501038_0004859 Ga0501038_0004859_5323_6189 282
615 3300049583 Ga0501067_0091701 Ga0501067_0091701_204_1070 282
616 3300049586 Ga0501070_0000944 Ga0501070_0000944_1969_2835 282
617 3300049823 Ga0501044_0002237 Ga0501044_0002237_20869_21735 282
618 3300050490 nmdc:mga03n38_40200_c1 nmdc:mga03n38_40200_c1_789_1667 282
619 3300050490 nmdc:mga03n38_58591_c1 nmdc:mga03n38_58591_c1_767_1645 282
620 3300050491 nmdc:mga00v17_7327_c1 nmdc:mga00v17_7327_c1_3862_4740 282
621 3300050496 nmdc:mga07m45_13765_c1 nmdc:mga07m45_13765_c1_3009_3887 282
622 3300050496 nmdc:mga07m45_35234_c1 nmdc:mga07m45_35234_c1_251_1108 282
623 3300050516 nmdc:mga0sz30_13696_c1 nmdc:mga0sz30_13696_c1_206_1063 282
624 3300050516 nmdc:mga0sz30_32403_c1 nmdc:mga0sz30_32403_c1_1040_1894 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04954

SIP

Siderophore-interacting protein

157

285

0.96

PF08021

FAD_binding_9

Siderophore-interacting FAD-binding domain

33

151

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gpj-assembly1.cif.gz_A crystal structure of a siderophore-interacting protein (sputcn32_0076) from shewanella putrefaciens cn-32 at 2.20 a resolution 0.8901 5 280
2gpj-assembly1.cif.gz_A crystal structure of a siderophore-interacting protein (sputcn32_0076) from shewanella putrefaciens cn-32 at 2.20 a resolution 0.8799 5 280
7xlz-assembly1.cif.gz_A structure of siderophore-interacting protein from vibrio anguillarum 0.8731 6 277
6k2l-assembly1.cif.gz_B crystal structure of the siderophore-interacting protein sips from aeromonas hydrophila 0.8717 4 259
6k2l-assembly1.cif.gz_A crystal structure of the siderophore-interacting protein sips from aeromonas hydrophila 0.8708 4 277
ID Description Score Start End Superfamily
af_P9WL31_2_128_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9735 2 128 2.40.30.10
af_P9WL31_2_128_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.966 2 128 2.40.30.10
af_P9WL31_130_283_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.92 130 281 3.40.50.80
af_P9WL31_130_283_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.903 130 281 3.40.50.80
2gpjA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8724 5 127 2.40.30.10
ID Description Score Start End GO Terms
AF-A0A1A3CD11-F1-model_v4 NADPH-dependent ferric siderophore reductase 0.969 1 193 GO:0016491
AF-A0A1A3CD11-F1-model_v4 NADPH-dependent ferric siderophore reductase 0.9641 1 193 GO:0016491
AF-E6TGH7-F1-model_v4 Siderophore-interacting protein 0.9628 1 280 GO:0016491
AF-A0A652YI41-F1-model_v4 NADPH-dependent ferric siderophore reductase 0.9597 4 279 GO:0016491
AF-A0A2S9FNF2-F1-model_v4 NADPH-dependent ferric siderophore reductase 0.9593 122 246

Feature Viewer

pLDDT pTM Quality
91.92 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map