F470282
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 624 | 302 | 599 | 277 |
Family's Representative Sequence
| Representative Sequence | 3300027907|Ga0207428_10269006|Ga0207428_102690061 |
| Length | 307 |
| Sequence | VARLWPPYARILDEGRGDEQEEEVAGRPVQTFEVVRSEQLAPHLVRVVLGGRGFDMFKPNDFTDAYVKLVFVEPDVDVAALPQPLTLDSFNGLPAERRPVVRTYTVRTVDTERREITIDFVVHGEHGVAGPWAAAATPGQPAYLMGPSGAYAPDPAADWHLLAGDEAALPAIGAALEALADDAVGKVFLEVGGPDDQIALTAPPGVEVTWVYRGGRADLVPEEKAGDNAPLITAVTEAAWLPGQVQVFIHGEAQTVMHNLRPYIRKERGVEAKWAASISGYWRRGRTEETFRQWKRELARAEEQPGN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 2 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 3 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 4 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 5 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 6 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 7 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 8 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 9 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 10 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 11 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 12 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 13 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 14 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 15 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 16 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 17 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 18 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 19 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 20 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 21 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 22 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 23 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 24 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 25 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 26 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 27 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 28 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 29 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 30 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 31 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 181 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 187 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 188 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 192 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 193 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 196 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 197 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 198 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 202 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 203 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 204 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 205 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 206 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 207 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 208 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 209 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 210 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 211 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 212 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 213 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 216 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 217 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 257 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 258 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 259 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 260 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 261 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 262 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 263 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 264 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 265 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 266 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 267 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 285 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 286 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 287 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 288 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 289 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 290 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 291 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 293 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 294 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 295 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 296 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 297 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 298 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 299 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 300 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 301 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.99 |
| Metatranscriptomes | 0 |
| Isolates | 4.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.66 |
| Nodule | 0.16 |
| Rhizoplane | 11.54 |
| Rhizosphere | 66.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1011268 | 3300001977 | Bacteria | 1316 |
| 2 | JGI24745J21846_1009453 | 3300002073 | Bacteria | 1105 |
| 3 | JGI24745J21846_1012054 | 3300002073 | Bacteria | 991 |
| 4 | JGI24749J21850_1001809 | 3300002076 | Bacteria | 3026 |
| 5 | JGI24744J21845_10010692 | 3300002077 | Bacteria | 1879 |
| 6 | JGI24034J26672_10012582 | 3300002239 | Bacteria | 1276 |
| 7 | Ga0055540_1000029 | 3300003792 | Bacteria | 179894 |
| 8 | Ga0055540_1002541 | 3300003792 | Bacteria | 9521 |
| 9 | Ga0055540_1003267 | 3300003792 | Bacteria | 7927 |
| 10 | Ga0055540_1004510 | 3300003792 | Bacteria | 6239 |
| 11 | Ga0070676_10019431 | 3300005328 | Bacteria | 3780 |
| 12 | Ga0070683_100092309 | 3300005329 | Bacteria | 2844 |
| 13 | Ga0070683_100211327 | 3300005329 | Bacteria | 1843 |
| 14 | Ga0070690_100034010 | 3300005330 | Bacteria | 3192 |
| 15 | Ga0070670_100092554 | 3300005331 | Bacteria | 2600 |
| 16 | Ga0068869_100044162 | 3300005334 | Bacteria | 3204 |
| 17 | Ga0070666_10125445 | 3300005335 | Bacteria | 1782 |
| 18 | Ga0070682_100012745 | 3300005337 | Bacteria | 4825 |
| 19 | Ga0070682_100020030 | 3300005337 | Bacteria | 3931 |
| 20 | Ga0068868_100012095 | 3300005338 | Bacteria | 6303 |
| 21 | Ga0070660_100053721 | 3300005339 | Bacteria | 3108 |
| 22 | Ga0070689_100178783 | 3300005340 | Bacteria | 1722 |
| 23 | Ga0070689_100444973 | 3300005340 | Bacteria | 1102 |
| 24 | Ga0070668_100027824 | 3300005347 | Bacteria | 4291 |
| 25 | Ga0070668_100034956 | 3300005347 | Bacteria | 3830 |
| 26 | Ga0070669_100001847 | 3300005353 | Bacteria | 15265 |
| 27 | Ga0070671_100006018 | 3300005355 | Bacteria | 9669 |
| 28 | Ga0070671_100069793 | 3300005355 | Bacteria | 2931 |
| 29 | Ga0070671_100149893 | 3300005355 | Bacteria | 1969 |
| 30 | Ga0070674_100006799 | 3300005356 | Bacteria | 6701 |
| 31 | Ga0070674_100017309 | 3300005356 | Bacteria | 4531 |
| 32 | Ga0070674_100065972 | 3300005356 | Bacteria | 2542 |
| 33 | Ga0070688_100014710 | 3300005365 | Bacteria | 4438 |
| 34 | Ga0070659_100063391 | 3300005366 | Bacteria | 2924 |
| 35 | Ga0070659_100164909 | 3300005366 | Bacteria | 1812 |
| 36 | Ga0070667_100000391 | 3300005367 | Bacteria | 47388 |
| 37 | Ga0070667_100003100 | 3300005367 | Bacteria | 14303 |
| 38 | Ga0070667_100003577 | 3300005367 | Bacteria | 13229 |
| 39 | Ga0070667_100015262 | 3300005367 | Bacteria | 6348 |
| 40 | Ga0070667_100084670 | 3300005367 | Bacteria | 2718 |
| 41 | Ga0070667_100140469 | 3300005367 | Bacteria | 2115 |
| 42 | Ga0070667_100529738 | 3300005367 | Bacteria | 1081 |
| 43 | Ga0070709_10120023 | 3300005434 | Bacteria | 1780 |
| 44 | Ga0070714_100033174 | 3300005435 | Bacteria | 4315 |
| 45 | Ga0070714_100251271 | 3300005435 | Bacteria | 1635 |
| 46 | Ga0070714_100252258 | 3300005435 | Bacteria | 1632 |
| 47 | Ga0070710_10017522 | 3300005437 | Bacteria | 3667 |
| 48 | Ga0070701_10007431 | 3300005438 | Bacteria | 4682 |
| 49 | Ga0070711_100000375 | 3300005439 | Bacteria | 23132 |
| 50 | Ga0070711_100027419 | 3300005439 | Bacteria | 3739 |
| 51 | Ga0070705_100061875 | 3300005440 | Bacteria | 2226 |
| 52 | Ga0070705_100079824 | 3300005440 | Bacteria | 2005 |
| 53 | Ga0070700_100093028 | 3300005441 | Bacteria | 1971 |
| 54 | Ga0070663_100028665 | 3300005455 | Bacteria | 3794 |
| 55 | Ga0070678_100001259 | 3300005456 | Bacteria | 13431 |
| 56 | Ga0070678_100117161 | 3300005456 | Bacteria | 2094 |
| 57 | Ga0070662_100015363 | 3300005457 | Bacteria | 5126 |
| 58 | Ga0070684_100108762 | 3300005535 | Bacteria | 2484 |
| 59 | Ga0068853_100008592 | 3300005539 | Bacteria | 8211 |
| 60 | Ga0068853_100059908 | 3300005539 | Bacteria | 3289 |
| 61 | Ga0068853_100103731 | 3300005539 | Bacteria | 2517 |
| 62 | Ga0070672_100085529 | 3300005543 | Bacteria | 2535 |
| 63 | Ga0070686_100228465 | 3300005544 | Bacteria | 1349 |
| 64 | Ga0070696_100001702 | 3300005546 | Bacteria | 14418 |
| 65 | Ga0070696_100033682 | 3300005546 | Bacteria | 3521 |
| 66 | Ga0070665_100018284 | 3300005548 | Bacteria | 7029 |
| 67 | Ga0070665_100050045 | 3300005548 | Bacteria | 4193 |
| 68 | Ga0070665_100141304 | 3300005548 | Bacteria | 2411 |
| 69 | Ga0070665_100173278 | 3300005548 | Bacteria | 2158 |
| 70 | Ga0070704_100001435 | 3300005549 | Bacteria | 12737 |
| 71 | Ga0068855_100006164 | 3300005563 | Bacteria | 14621 |
| 72 | Ga0068855_100038774 | 3300005563 | Bacteria | 5660 |
| 73 | Ga0068854_100003064 | 3300005578 | Bacteria | 10404 |
| 74 | Ga0068854_100010898 | 3300005578 | Bacteria | 5899 |
| 75 | Ga0068856_100012671 | 3300005614 | Bacteria | 8164 |
| 76 | Ga0070702_100032358 | 3300005615 | Bacteria | 2869 |
| 77 | Ga0070702_100077581 | 3300005615 | Bacteria | 1980 |
| 78 | Ga0070702_100152457 | 3300005615 | Bacteria | 1485 |
| 79 | Ga0068852_100033270 | 3300005616 | Bacteria | 4278 |
| 80 | Ga0068852_100089668 | 3300005616 | Bacteria | 2749 |
| 81 | Ga0068859_100008118 | 3300005617 | Bacteria | 10645 |
| 82 | Ga0068859_100032433 | 3300005617 | Bacteria | 5247 |
| 83 | Ga0068864_100065747 | 3300005618 | Bacteria | 3146 |
| 84 | Ga0068864_100094936 | 3300005618 | Bacteria | 2637 |
| 85 | Ga0068864_100351267 | 3300005618 | Bacteria | 1391 |
| 86 | Ga0068866_10000812 | 3300005718 | Bacteria | 13959 |
| 87 | Ga0068866_10035513 | 3300005718 | Bacteria | 2435 |
| 88 | Ga0068861_100009768 | 3300005719 | Bacteria | 6635 |
| 89 | Ga0068863_100000992 | 3300005841 | Bacteria | 28496 |
| 90 | Ga0068863_100011377 | 3300005841 | Bacteria | 8611 |
| 91 | Ga0068863_100060458 | 3300005841 | Bacteria | 3583 |
| 92 | Ga0068863_100483321 | 3300005841 | Bacteria | 1218 |
| 93 | Ga0068858_100001306 | 3300005842 | Bacteria | 25730 |
| 94 | Ga0068858_100029600 | 3300005842 | Bacteria | 5086 |
| 95 | Ga0068860_100000065 | 3300005843 | Bacteria | 186634 |
| 96 | Ga0068860_100235614 | 3300005843 | Bacteria | 1779 |
| 97 | Ga0068862_100000028 | 3300005844 | Bacteria | 184197 |
| 98 | Ga0081455_10210050 | 3300005937 | Bacteria | 1451 |
| 99 | Ga0075365_10015167 | 3300006038 | Bacteria | 4655 |
| 100 | Ga0075365_10033291 | 3300006038 | Bacteria | 3320 |
| 101 | Ga0075365_10093120 | 3300006038 | Bacteria | 2055 |
| 102 | Ga0075365_10160424 | 3300006038 | Bacteria | 1567 |
| 103 | Ga0075363_100003126 | 3300006048 | Bacteria | 6954 |
| 104 | Ga0075363_100014059 | 3300006048 | Bacteria | 3899 |
| 105 | Ga0075363_100014862 | 3300006048 | Bacteria | 3816 |
| 106 | Ga0075363_100095625 | 3300006048 | Bacteria | 1639 |
| 107 | Ga0075364_10001383 | 3300006051 | Bacteria | 13095 |
| 108 | Ga0075364_10006919 | 3300006051 | Bacteria | 6696 |
| 109 | Ga0075364_10013609 | 3300006051 | Bacteria | 5007 |
| 110 | Ga0075364_10060585 | 3300006051 | Bacteria | 2481 |
| 111 | Ga0075364_10094436 | 3300006051 | Bacteria | 1987 |
| 112 | Ga0075364_10118586 | 3300006051 | Bacteria | 1770 |
| 113 | Ga0075364_10201295 | 3300006051 | Bacteria | 1350 |
| 114 | Ga0070715_10001286 | 3300006163 | Bacteria | 7188 |
| 115 | Ga0070715_10070106 | 3300006163 | Bacteria | 1564 |
| 116 | Ga0070716_100003259 | 3300006173 | Bacteria | 7626 |
| 117 | Ga0070716_100388212 | 3300006173 | Bacteria | 1000 |
| 118 | Ga0070712_100008493 | 3300006175 | Bacteria | 6463 |
| 119 | Ga0070712_100064828 | 3300006175 | Bacteria | 2591 |
| 120 | Ga0075362_10010964 | 3300006177 | Bacteria | 3558 |
| 121 | Ga0075362_10042022 | 3300006177 | Bacteria | 2019 |
| 122 | Ga0075367_10008062 | 3300006178 | Bacteria | 5435 |
| 123 | Ga0075367_10130491 | 3300006178 | Bacteria | 1553 |
| 124 | Ga0075367_10255738 | 3300006178 | Bacteria | 1099 |
| 125 | Ga0075369_10002341 | 3300006186 | Bacteria | 6748 |
| 126 | Ga0075369_10010294 | 3300006186 | Bacteria | 3655 |
| 127 | Ga0075369_10090683 | 3300006186 | Bacteria | 1364 |
| 128 | Ga0075369_10101291 | 3300006186 | Bacteria | 1292 |
| 129 | Ga0075366_10070125 | 3300006195 | Bacteria | 2087 |
| 130 | Ga0097621_100149369 | 3300006237 | Bacteria | 2003 |
| 131 | Ga0097621_100208351 | 3300006237 | Bacteria | 1700 |
| 132 | Ga0075370_10012324 | 3300006353 | Bacteria | 4515 |
| 133 | Ga0075370_10018620 | 3300006353 | Bacteria | 3768 |
| 134 | Ga0075370_10019367 | 3300006353 | Bacteria | 3706 |
| 135 | Ga0075370_10030301 | 3300006353 | Bacteria | 3018 |
| 136 | Ga0075370_10043886 | 3300006353 | Bacteria | 2527 |
| 137 | Ga0075370_10063273 | 3300006353 | Bacteria | 2109 |
| 138 | Ga0075370_10071213 | 3300006353 | Bacteria | 1989 |
| 139 | Ga0075428_100004253 | 3300006844 | Bacteria | 15752 |
| 140 | Ga0068865_100167486 | 3300006881 | Bacteria | 1681 |
| 141 | Ga0097620_100008118 | 3300006931 | Bacteria | 10645 |
| 142 | Ga0097620_100032433 | 3300006931 | Bacteria | 5247 |
| 143 | Ga0105250_10032624 | 3300009092 | Bacteria | 2091 |
| 144 | Ga0105240_10064066 | 3300009093 | Bacteria | 4569 |
| 145 | Ga0105245_10001029 | 3300009098 | Bacteria | 25345 |
| 146 | Ga0105247_10000232 | 3300009101 | Bacteria | 53113 |
| 147 | Ga0105247_10009458 | 3300009101 | Bacteria | 5914 |
| 148 | Ga0114129_10043041 | 3300009147 | Bacteria | 6356 |
| 149 | Ga0105243_10001000 | 3300009148 | Bacteria | 26146 |
| 150 | Ga0105241_10062428 | 3300009174 | Bacteria | 2872 |
| 151 | Ga0105242_10000759 | 3300009176 | Bacteria | 25113 |
| 152 | Ga0105242_10226296 | 3300009176 | Bacteria | 1674 |
| 153 | Ga0105248_10000074 | 3300009177 | Bacteria | 114554 |
| 154 | Ga0105248_10003071 | 3300009177 | Bacteria | 18513 |
| 155 | Ga0105248_10333447 | 3300009177 | Bacteria | 1708 |
| 156 | Ga0105248_10421801 | 3300009177 | Bacteria | 1503 |
| 157 | Ga0105237_10004825 | 3300009545 | Bacteria | 15489 |
| 158 | Ga0105237_10010195 | 3300009545 | Bacteria | 10012 |
| 159 | Ga0105237_10028762 | 3300009545 | Bacteria | 5656 |
| 160 | Ga0105237_10107256 | 3300009545 | Bacteria | 2785 |
| 161 | Ga0105237_10265098 | 3300009545 | Bacteria | 1721 |
| 162 | Ga0105238_10005858 | 3300009551 | Bacteria | 12175 |
| 163 | Ga0105238_10127461 | 3300009551 | Bacteria | 2524 |
| 164 | Ga0105238_10252130 | 3300009551 | Bacteria | 1743 |
| 165 | Ga0105249_10000011 | 3300009553 | Bacteria | 292812 |
| 166 | Ga0105249_10005589 | 3300009553 | Bacteria | 10869 |
| 167 | Ga0105249_10015924 | 3300009553 | Bacteria | 6664 |
| 168 | Ga0105249_10313969 | 3300009553 | Bacteria | 1577 |
| 169 | Ga0105239_10014422 | 3300010375 | Bacteria | 8771 |
| 170 | Ga0105239_10016836 | 3300010375 | Bacteria | 8080 |
| 171 | Ga0105239_10198895 | 3300010375 | Bacteria | 2245 |
| 172 | Ga0105239_10267608 | 3300010375 | Bacteria | 1922 |
| 173 | Ga0105246_10198502 | 3300011119 | Bacteria | 1558 |
| 174 | Ga0157371_10159628 | 3300013102 | Bacteria | 1610 |
| 175 | Ga0157369_10069364 | 3300013105 | Bacteria | 3787 |
| 176 | Ga0157369_10435238 | 3300013105 | Bacteria | 1359 |
| 177 | Ga0157374_10015721 | 3300013296 | Bacteria | 6645 |
| 178 | Ga0157374_10175252 | 3300013296 | Bacteria | 2093 |
| 179 | Ga0157378_10001038 | 3300013297 | Bacteria | 25353 |
| 180 | Ga0163162_10018684 | 3300013306 | Bacteria | 6791 |
| 181 | Ga0163162_10071077 | 3300013306 | Bacteria | 3533 |
| 182 | Ga0157372_10011618 | 3300013307 | Bacteria | 9375 |
| 183 | Ga0157372_10254023 | 3300013307 | Bacteria | 2041 |
| 184 | Ga0157372_10701777 | 3300013307 | Bacteria | 1177 |
| 185 | Ga0157375_10000838 | 3300013308 | Bacteria | 26885 |
| 186 | Ga0157375_10228333 | 3300013308 | Bacteria | 2020 |
| 187 | Ga0157375_10397655 | 3300013308 | Bacteria | 1545 |
| 188 | Ga0163163_10046502 | 3300014325 | Bacteria | 4263 |
| 189 | Ga0163163_10062712 | 3300014325 | Bacteria | 3684 |
| 190 | Ga0163163_10468024 | 3300014325 | Bacteria | 1321 |
| 191 | Ga0163163_10537656 | 3300014325 | Bacteria | 1231 |
| 192 | Ga0157380_10001428 | 3300014326 | Bacteria | 15636 |
| 193 | Ga0157377_10015647 | 3300014745 | Bacteria | 3887 |
| 194 | Ga0157379_10016789 | 3300014968 | Bacteria | 6442 |
| 195 | Ga0157379_10309819 | 3300014968 | Bacteria | 1440 |
| 196 | Ga0157376_10049082 | 3300014969 | Bacteria | 3495 |
| 197 | Ga0157376_10562289 | 3300014969 | Bacteria | 1130 |
| 198 | Ga0163161_10003257 | 3300017792 | Bacteria | 11411 |
| 199 | Ga0163161_10173713 | 3300017792 | Bacteria | 1649 |
| 200 | Ga0213874_10089055 | 3300021377 | Bacteria | 1011 |
| 201 | Ga0213876_10003552 | 3300021384 | Bacteria | 8886 |
| 202 | Ga0213876_10018948 | 3300021384 | Bacteria | 3636 |
| 203 | Ga0209673_1029315 | 3300025273 | Bacteria | 1754 |
| 204 | Ga0209051_1000042 | 3300025303 | Bacteria | 308486 |
| 205 | Ga0209051_1004157 | 3300025303 | Bacteria | 9049 |
| 206 | Ga0209051_1008656 | 3300025303 | Bacteria | 5358 |
| 207 | Ga0209051_1015862 | 3300025303 | Bacteria | 3448 |
| 208 | Ga0207653_10002968 | 3300025885 | Bacteria | 5382 |
| 209 | Ga0207692_10003952 | 3300025898 | Bacteria | 5820 |
| 210 | Ga0207692_10026397 | 3300025898 | Bacteria | 2725 |
| 211 | Ga0207692_10049291 | 3300025898 | Bacteria | 2125 |
| 212 | Ga0207642_10000117 | 3300025899 | Bacteria | 21526 |
| 213 | Ga0207710_10000022 | 3300025900 | Bacteria | 335632 |
| 214 | Ga0207688_10005173 | 3300025901 | Bacteria | 7091 |
| 215 | Ga0207688_10007002 | 3300025901 | Bacteria | 6133 |
| 216 | Ga0207647_10037258 | 3300025904 | Bacteria | 3084 |
| 217 | Ga0207647_10044118 | 3300025904 | Bacteria | 2787 |
| 218 | Ga0207647_10122375 | 3300025904 | Bacteria | 1533 |
| 219 | Ga0207685_10049609 | 3300025905 | Bacteria | 1613 |
| 220 | Ga0207685_10089453 | 3300025905 | Bacteria | 1293 |
| 221 | Ga0207643_10203479 | 3300025908 | Bacteria | 1206 |
| 222 | Ga0207654_10033971 | 3300025911 | Bacteria | 2830 |
| 223 | Ga0207695_10002792 | 3300025913 | Bacteria | 25412 |
| 224 | Ga0207671_10001326 | 3300025914 | Bacteria | 28939 |
| 225 | Ga0207671_10010122 | 3300025914 | Bacteria | 7814 |
| 226 | Ga0207671_10041471 | 3300025914 | Bacteria | 3407 |
| 227 | Ga0207693_10000930 | 3300025915 | Bacteria | 26312 |
| 228 | Ga0207693_10001479 | 3300025915 | Bacteria | 20767 |
| 229 | Ga0207693_10507156 | 3300025915 | Bacteria | 942 |
| 230 | Ga0207663_10002583 | 3300025916 | Bacteria | 8711 |
| 231 | Ga0207663_10073617 | 3300025916 | Bacteria | 2211 |
| 232 | Ga0207681_10001802 | 3300025923 | Bacteria | 13741 |
| 233 | Ga0207681_10027533 | 3300025923 | Bacteria | 3676 |
| 234 | Ga0207694_10010486 | 3300025924 | Bacteria | 6990 |
| 235 | Ga0207694_10366477 | 3300025924 | Bacteria | 1194 |
| 236 | Ga0207650_10105386 | 3300025925 | Bacteria | 2177 |
| 237 | Ga0207687_10001341 | 3300025927 | Bacteria | 16838 |
| 238 | Ga0207700_10041267 | 3300025928 | Bacteria | 3375 |
| 239 | Ga0207664_10104274 | 3300025929 | Bacteria | 2348 |
| 240 | Ga0207664_10261936 | 3300025929 | Bacteria | 1512 |
| 241 | Ga0207664_10450520 | 3300025929 | Bacteria | 1149 |
| 242 | Ga0207644_10315948 | 3300025931 | Bacteria | 1262 |
| 243 | Ga0207690_10018077 | 3300025932 | Bacteria | 4318 |
| 244 | Ga0207690_10033766 | 3300025932 | Bacteria | 3292 |
| 245 | Ga0207706_10010030 | 3300025933 | Bacteria | 8679 |
| 246 | Ga0207706_10143832 | 3300025933 | Bacteria | 2098 |
| 247 | Ga0207709_10021840 | 3300025935 | Bacteria | 3625 |
| 248 | Ga0207709_10064292 | 3300025935 | Bacteria | 2303 |
| 249 | Ga0207670_10137047 | 3300025936 | Bacteria | 1800 |
| 250 | Ga0207670_10166116 | 3300025936 | Bacteria | 1651 |
| 251 | Ga0207669_10000297 | 3300025937 | Bacteria | 22865 |
| 252 | Ga0207669_10038390 | 3300025937 | Bacteria | 2757 |
| 253 | Ga0207704_10007363 | 3300025938 | Bacteria | 5193 |
| 254 | Ga0207704_10023526 | 3300025938 | Bacteria | 3322 |
| 255 | Ga0207665_10008653 | 3300025939 | Bacteria | 6699 |
| 256 | Ga0207665_10290570 | 3300025939 | Bacteria | 1219 |
| 257 | Ga0207691_10061917 | 3300025940 | Bacteria | 3397 |
| 258 | Ga0207711_10001226 | 3300025941 | Bacteria | 24313 |
| 259 | Ga0207711_10014691 | 3300025941 | Bacteria | 6506 |
| 260 | Ga0207711_10362162 | 3300025941 | Bacteria | 1344 |
| 261 | Ga0207689_10032281 | 3300025942 | Bacteria | 4357 |
| 262 | Ga0207661_10167397 | 3300025944 | Bacteria | 1911 |
| 263 | Ga0207679_10331582 | 3300025945 | Bacteria | 1321 |
| 264 | Ga0207667_10051635 | 3300025949 | Bacteria | 4333 |
| 265 | Ga0207667_10068340 | 3300025949 | Bacteria | 3700 |
| 266 | Ga0207651_10058995 | 3300025960 | Bacteria | 2655 |
| 267 | Ga0207712_10000020 | 3300025961 | Bacteria | 292796 |
| 268 | Ga0207712_10008422 | 3300025961 | Bacteria | 6516 |
| 269 | Ga0207712_10011195 | 3300025961 | Bacteria | 5711 |
| 270 | Ga0207712_10383786 | 3300025961 | Bacteria | 1177 |
| 271 | Ga0207668_10029134 | 3300025972 | Bacteria | 3615 |
| 272 | Ga0207668_10104725 | 3300025972 | Bacteria | 2110 |
| 273 | Ga0207668_10320497 | 3300025972 | Bacteria | 1286 |
| 274 | Ga0207640_10018643 | 3300025981 | Bacteria | 4082 |
| 275 | Ga0207640_10026973 | 3300025981 | Bacteria | 3495 |
| 276 | Ga0207658_10000284 | 3300025986 | Bacteria | 53042 |
| 277 | Ga0207658_10001582 | 3300025986 | Bacteria | 17576 |
| 278 | Ga0207658_10004009 | 3300025986 | Bacteria | 10307 |
| 279 | Ga0207658_10015254 | 3300025986 | Bacteria | 5271 |
| 280 | Ga0207658_10110492 | 3300025986 | Bacteria | 2172 |
| 281 | Ga0207677_10002994 | 3300026023 | Bacteria | 8923 |
| 282 | Ga0207703_10001189 | 3300026035 | Bacteria | 24483 |
| 283 | Ga0207703_10040837 | 3300026035 | Bacteria | 3715 |
| 284 | Ga0207639_10008929 | 3300026041 | Bacteria | 6896 |
| 285 | Ga0207639_10178224 | 3300026041 | Bacteria | 1806 |
| 286 | Ga0207678_10013971 | 3300026067 | Bacteria | 7057 |
| 287 | Ga0207678_10061884 | 3300026067 | Bacteria | 3219 |
| 288 | Ga0207708_10031691 | 3300026075 | Bacteria | 4014 |
| 289 | Ga0207702_10136825 | 3300026078 | Bacteria | 2211 |
| 290 | Ga0207702_10202743 | 3300026078 | Bacteria | 1840 |
| 291 | Ga0207641_10001875 | 3300026088 | Bacteria | 20188 |
| 292 | Ga0207641_10034263 | 3300026088 | Bacteria | 4223 |
| 293 | Ga0207641_10120457 | 3300026088 | Bacteria | 2341 |
| 294 | Ga0207641_10133498 | 3300026088 | Bacteria | 2232 |
| 295 | Ga0207648_10001361 | 3300026089 | Bacteria | 27023 |
| 296 | Ga0207648_10046867 | 3300026089 | Bacteria | 3789 |
| 297 | Ga0207676_10048723 | 3300026095 | Bacteria | 3291 |
| 298 | Ga0207676_10068225 | 3300026095 | Bacteria | 2844 |
| 299 | Ga0207676_10125993 | 3300026095 | Bacteria | 2169 |
| 300 | Ga0207676_10301592 | 3300026095 | Bacteria | 1463 |
| 301 | Ga0207676_10356650 | 3300026095 | Bacteria | 1354 |
| 302 | Ga0207675_100003845 | 3300026118 | Bacteria | 14607 |
| 303 | Ga0207675_100825159 | 3300026118 | Bacteria | 941 |
| 304 | Ga0207683_10002759 | 3300026121 | Bacteria | 15343 |
| 305 | Ga0207683_10005268 | 3300026121 | Bacteria | 11099 |
| 306 | Ga0207698_10168866 | 3300026142 | Bacteria | 1924 |
| 307 | Ga0207428_10269006 | 3300027907 | Bacteria | 1267 |
| 308 | Ga0268266_10004748 | 3300028379 | Bacteria | 12923 |
| 309 | Ga0268266_10059256 | 3300028379 | Bacteria | 3298 |
| 310 | Ga0268266_10074922 | 3300028379 | Bacteria | 2939 |
| 311 | Ga0268266_10082710 | 3300028379 | Bacteria | 2801 |
| 312 | Ga0268265_10000004 | 3300028380 | Bacteria | 648376 |
| 313 | Ga0268265_10046780 | 3300028380 | Bacteria | 3236 |
| 314 | Ga0268265_10549158 | 3300028380 | Bacteria | 1096 |
| 315 | Ga0268264_10000024 | 3300028381 | Bacteria | 470081 |
| 316 | Ga0268264_10004434 | 3300028381 | Bacteria | 11972 |
| 317 | Ga0268264_10180557 | 3300028381 | Bacteria | 1916 |
| 318 | Ga0265327_10000154 | 3300031251 | Bacteria | 148866 |
| 319 | Ga0265327_10002914 | 3300031251 | Bacteria | 17140 |
| 320 | Ga0265327_10027594 | 3300031251 | Bacteria | 3264 |
| 321 | Ga0265327_10068663 | 3300031251 | Bacteria | 1782 |
| 322 | Ga0316578_10065817 | 3300031728 | Bacteria | 2141 |
| 323 | Ga0307413_10030289 | 3300031824 | Bacteria | 3039 |
| 324 | Ga0307407_10117839 | 3300031903 | Bacteria | 1678 |
| 325 | Ga0307409_100032573 | 3300031995 | Bacteria | 3781 |
| 326 | Ga0307409_100331609 | 3300031995 | Bacteria | 1428 |
| 327 | Ga0307416_100792870 | 3300032002 | Bacteria | 1043 |
| 328 | Ga0307411_10177701 | 3300032005 | Bacteria | 1612 |
| 329 | Ga0307415_100149364 | 3300032126 | Bacteria | 1796 |
| 330 | Ga0373928_0011509 | 3300035084 | Bacteria | 1752 |
| 331 | Ga0373941_0008988 | 3300035115 | Bacteria | 2504 |
| 332 | Ga0373931_0140682 | 3300035691 | Bacteria | 1397 |
| 333 | Ga0373931_0222767 | 3300035691 | Bacteria | 1136 |
| 334 | Ga0373947_0097832 | 3300035725 | Bacteria | 1840 |
| 335 | Ga0316584_0075517 | 3300036712 | Bacteria | 2526 |
| 336 | Ga0436364_1121346 | 3300037853 | Bacteria | 3615 |
| 337 | Ga0436365_0593663 | 3300039437 | Bacteria | 2111 |
| 338 | Ga0436365_0865525 | 3300039437 | Bacteria | 17320 |
| 339 | Ga0436365_0997910 | 3300039437 | Bacteria | 8476 |
| 340 | Ga0436365_1378611 | 3300039437 | Bacteria | 178407 |
| 341 | Ga0436363_0789807 | 3300039450 | Bacteria | 6812 |
| 342 | Ga0439466_0012631 | 3300041411 | Bacteria | 3105 |
| 343 | Ga0439466_0027199 | 3300041411 | Bacteria | 1982 |
| 344 | Ga0439466_0028287 | 3300041411 | Bacteria | 1936 |
| 345 | Ga0439465_0003815 | 3300041413 | Bacteria | 4915 |
| 346 | Ga0439465_0006734 | 3300041413 | Bacteria | 3648 |
| 347 | Ga0451793_0913039 | 3300041452 | Bacteria | 1850 |
| 348 | Ga0451800_0666987 | 3300041459 | Bacteria | 1307 |
| 349 | Ga0451802_0086339 | 3300041460 | Bacteria | 1213 |
| 350 | Ga0451806_876685 | 3300041462 | Bacteria | 1488 |
| 351 | Ga0439445_0003672 | 3300042004 | Bacteria | 3442 |
| 352 | Ga0439445_0004053 | 3300042004 | Bacteria | 3308 |
| 353 | Ga0439450_046751 | 3300042008 | Bacteria | 1019 |
| 354 | Ga0439434_0028143 | 3300042435 | Bacteria | 1701 |
| 355 | Ga0439434_0054856 | 3300042435 | Bacteria | 1240 |
| 356 | Ga0466969_0031608 | 3300044656 | Bacteria | 2694 |
| 357 | Ga0466969_0037463 | 3300044656 | Bacteria | 2446 |
| 358 | Ga0466972_0011693 | 3300044658 | Bacteria | 4407 |
| 359 | Ga0466972_0014121 | 3300044658 | Bacteria | 4002 |
| 360 | Ga0466972_0041677 | 3300044658 | Bacteria | 2235 |
| 361 | Ga0466965_0003164 | 3300044683 | Bacteria | 7183 |
| 362 | Ga0466965_0004842 | 3300044683 | Bacteria | 6004 |
| 363 | Ga0466965_0020463 | 3300044683 | Bacteria | 3181 |
| 364 | Ga0466965_0108892 | 3300044683 | Bacteria | 1422 |
| 365 | Ga0466965_0177783 | 3300044683 | Bacteria | 1122 |
| 366 | Ga0466966_0005734 | 3300044684 | Bacteria | 8171 |
| 367 | Ga0466966_0010087 | 3300044684 | Bacteria | 6265 |
| 368 | Ga0466966_0021904 | 3300044684 | Bacteria | 4196 |
| 369 | Ga0466966_0070523 | 3300044684 | Bacteria | 2191 |
| 370 | Ga0466961_0009580 | 3300044693 | Bacteria | 6167 |
| 371 | Ga0466961_0022594 | 3300044693 | Bacteria | 4046 |
| 372 | Ga0466963_0044299 | 3300044694 | Bacteria | 2929 |
| 373 | Ga0466963_0073723 | 3300044694 | Bacteria | 2302 |
| 374 | Ga0466963_0119194 | 3300044694 | Bacteria | 1815 |
| 375 | Ga0466963_0194228 | 3300044694 | Bacteria | 1418 |
| 376 | Ga0466963_0292415 | 3300044694 | Bacteria | 1145 |
| 377 | Ga0466963_0398302 | 3300044694 | Bacteria | 971 |
| 378 | Ga0466971_0001079 | 3300044719 | Bacteria | 11324 |
| 379 | Ga0466971_0013433 | 3300044719 | Bacteria | 3598 |
| 380 | Ga0466968_0001830 | 3300044735 | Bacteria | 7680 |
| 381 | Ga0466968_0002156 | 3300044735 | Bacteria | 7180 |
| 382 | Ga0466970_0004994 | 3300044765 | Bacteria | 6555 |
| 383 | Ga0466970_0045119 | 3300044765 | Bacteria | 2346 |
| 384 | Ga0466970_0096414 | 3300044765 | Bacteria | 1608 |
| 385 | Ga0466957_0012567 | 3300044842 | Bacteria | 4901 |
| 386 | Ga0466957_0028501 | 3300044842 | Bacteria | 3326 |
| 387 | Ga0466957_0034553 | 3300044842 | Bacteria | 3033 |
| 388 | Ga0466960_0000117 | 3300044901 | Bacteria | 26501 |
| 389 | Ga0466960_0000905 | 3300044901 | Bacteria | 10511 |
| 390 | Ga0466960_0003419 | 3300044901 | Bacteria | 6102 |
| 391 | Ga0466959_0012610 | 3300045049 | Bacteria | 6113 |
| 392 | Ga0466959_0064886 | 3300045049 | Bacteria | 2650 |
| 393 | Ga0466958_0001238 | 3300045836 | Bacteria | 11971 |
| 394 | Ga0466958_0054031 | 3300045836 | Bacteria | 2435 |
| 395 | Ga0466958_0079579 | 3300045836 | Bacteria | 2015 |
| 396 | Ga0466967_0020211 | 3300045976 | Bacteria | 5375 |
| 397 | Ga0466967_0035544 | 3300045976 | Bacteria | 4243 |
| 398 | Ga0466967_0079399 | 3300045976 | Bacteria | 2958 |
| 399 | Ga0466967_0128776 | 3300045976 | Bacteria | 2347 |
| 400 | Ga0466967_0338087 | 3300045976 | Bacteria | 1455 |
| 401 | Ga0466967_0374162 | 3300045976 | Bacteria | 1382 |
| 402 | Ga0466967_0421074 | 3300045976 | Bacteria | 1302 |
| 403 | Ga0466967_0521960 | 3300045976 | Bacteria | 1167 |
| 404 | Ga0495603_0035321 | 3300046455 | Bacteria | 3003 |
| 405 | Ga0495638_0000404 | 3300046460 | Bacteria | 52857 |
| 406 | Ga0495638_0060257 | 3300046460 | Bacteria | 2348 |
| 407 | Ga0495651_0058527 | 3300046462 | Bacteria | 2956 |
| 408 | Ga0495639_0111381 | 3300046475 | Bacteria | 1299 |
| 409 | Ga0495662_0044921 | 3300046476 | Bacteria | 2133 |
| 410 | Ga0495662_0090935 | 3300046476 | Bacteria | 1488 |
| 411 | Ga0495628_0146898 | 3300046516 | Bacteria | 1797 |
| 412 | Ga0495648_0004183 | 3300046524 | Bacteria | 12400 |
| 413 | Ga0495652_0101414 | 3300046529 | Bacteria | 2333 |
| 414 | Ga0495645_0046374 | 3300046543 | Bacteria | 3168 |
| 415 | Ga0495588_0014059 | 3300046674 | Bacteria | 3825 |
| 416 | Ga0495624_0082450 | 3300046690 | Bacteria | 1990 |
| 417 | Ga0495649_0135016 | 3300046694 | Bacteria | 1301 |
| 418 | Ga0495600_0028281 | 3300046809 | Bacteria | 3626 |
| 419 | Ga0495581_0157259 | 3300047315 | Bacteria | 1328 |
| 420 | Ga0495604_0042184 | 3300047317 | Bacteria | 3577 |
| 421 | Ga0495674_0120535 | 3300047319 | Bacteria | 2216 |
| 422 | Ga0495672_0003432 | 3300047320 | Bacteria | 13573 |
| 423 | Ga0495672_0170829 | 3300047320 | Bacteria | 1109 |
| 424 | Ga0495676_0117740 | 3300047321 | Bacteria | 1938 |
| 425 | Ga0495673_0002291 | 3300047469 | Bacteria | 13712 |
| 426 | Ga0495686_0002735 | 3300047472 | Bacteria | 16115 |
| 427 | Ga0495593_0010681 | 3300047673 | Bacteria | 5294 |
| 428 | Ga0496100_0000009 | 3300048903 | Bacteria | 225785 |
| 429 | Ga0496100_0001047 | 3300048903 | Bacteria | 13366 |
| 430 | Ga0496100_0040440 | 3300048903 | Bacteria | 2967 |
| 431 | Ga0496100_0068760 | 3300048903 | Bacteria | 2356 |
| 432 | Ga0496100_0190380 | 3300048903 | Bacteria | 1489 |
| 433 | Ga0496100_0196940 | 3300048903 | Bacteria | 1466 |
| 434 | Ga0496100_0496323 | 3300048903 | Bacteria | 940 |
| 435 | Ga0496101_0000018 | 3300048904 | Bacteria | 236102 |
| 436 | Ga0496101_0000102 | 3300048904 | Bacteria | 88779 |
| 437 | Ga0496101_0000931 | 3300048904 | Bacteria | 17274 |
| 438 | Ga0496101_0009266 | 3300048904 | Bacteria | 6464 |
| 439 | Ga0496101_0026670 | 3300048904 | Bacteria | 4018 |
| 440 | Ga0496101_0091404 | 3300048904 | Bacteria | 2265 |
| 441 | Ga0496102_0000037 | 3300048905 | Bacteria | 199368 |
| 442 | Ga0496102_0000256 | 3300048905 | Bacteria | 69381 |
| 443 | Ga0496102_0012165 | 3300048905 | Bacteria | 7439 |
| 444 | Ga0496102_0012619 | 3300048905 | Bacteria | 7318 |
| 445 | Ga0496102_0045412 | 3300048905 | Bacteria | 3989 |
| 446 | Ga0496102_0127309 | 3300048905 | Bacteria | 2381 |
| 447 | Ga0496102_0132204 | 3300048905 | Bacteria | 2337 |
| 448 | Ga0496103_0000004 | 3300048906 | Bacteria | 510080 |
| 449 | Ga0496103_0000538 | 3300048906 | Bacteria | 30478 |
| 450 | Ga0496103_0000989 | 3300048906 | Bacteria | 20043 |
| 451 | Ga0496103_0001096 | 3300048906 | Bacteria | 18843 |
| 452 | Ga0496103_0046381 | 3300048906 | Bacteria | 2683 |
| 453 | Ga0496103_0159629 | 3300048906 | Bacteria | 1446 |
| 454 | Ga0496104_0002403 | 3300048907 | Bacteria | 16120 |
| 455 | Ga0496104_0017819 | 3300048907 | Bacteria | 6476 |
| 456 | Ga0496104_0230975 | 3300048907 | Bacteria | 1762 |
| 457 | Ga0496104_0341286 | 3300048907 | Bacteria | 1411 |
| 458 | Ga0496104_0413151 | 3300048907 | Bacteria | 1262 |
| 459 | Ga0496105_0008381 | 3300048908 | Bacteria | 8033 |
| 460 | Ga0496105_0037799 | 3300048908 | Bacteria | 3976 |
| 461 | Ga0496106_0001747 | 3300048909 | Bacteria | 16235 |
| 462 | Ga0496106_0003068 | 3300048909 | Bacteria | 12455 |
| 463 | Ga0496106_0020704 | 3300048909 | Bacteria | 4882 |
| 464 | Ga0496106_0022182 | 3300048909 | Bacteria | 4715 |
| 465 | Ga0496106_0171967 | 3300048909 | Bacteria | 1717 |
| 466 | Ga0496107_0001670 | 3300048910 | Bacteria | 13874 |
| 467 | Ga0496107_0003353 | 3300048910 | Bacteria | 10701 |
| 468 | Ga0496107_0012063 | 3300048910 | Bacteria | 6026 |
| 469 | Ga0496107_0012623 | 3300048910 | Bacteria | 5899 |
| 470 | Ga0496107_0056165 | 3300048910 | Bacteria | 2844 |
| 471 | Ga0496107_0090242 | 3300048910 | Bacteria | 2238 |
| 472 | Ga0496108_0033508 | 3300048911 | Bacteria | 4267 |
| 473 | Ga0496108_0094431 | 3300048911 | Bacteria | 2546 |
| 474 | Ga0496109_0000434 | 3300048912 | Bacteria | 36428 |
| 475 | Ga0496109_0001781 | 3300048912 | Bacteria | 17907 |
| 476 | Ga0496109_0016900 | 3300048912 | Bacteria | 6385 |
| 477 | Ga0496109_0321026 | 3300048912 | Bacteria | 1461 |
| 478 | Ga0496110_0000204 | 3300048913 | Bacteria | 37863 |
| 479 | Ga0496110_0005194 | 3300048913 | Bacteria | 10189 |
| 480 | Ga0496110_0194231 | 3300048913 | Bacteria | 1843 |
| 481 | Ga0496111_0012866 | 3300048914 | Bacteria | 5678 |
| 482 | Ga0496111_0137687 | 3300048914 | Bacteria | 1809 |
| 483 | Ga0496112_0009281 | 3300048915 | Bacteria | 8845 |
| 484 | Ga0496112_0133510 | 3300048915 | Bacteria | 2453 |
| 485 | Ga0496112_0169588 | 3300048915 | Bacteria | 2148 |
| 486 | Ga0496112_0204597 | 3300048915 | Bacteria | 1932 |
| 487 | Ga0496113_0077218 | 3300048916 | Bacteria | 2546 |
| 488 | Ga0496113_0117552 | 3300048916 | Bacteria | 2076 |
| 489 | Ga0496114_0000183 | 3300048917 | Bacteria | 44987 |
| 490 | Ga0496114_0002431 | 3300048917 | Bacteria | 14203 |
| 491 | Ga0496114_0008349 | 3300048917 | Bacteria | 8205 |
| 492 | Ga0496115_0002353 | 3300048918 | Bacteria | 13559 |
| 493 | Ga0496115_0008628 | 3300048918 | Bacteria | 7548 |
| 494 | Ga0496115_0067705 | 3300048918 | Bacteria | 2889 |
| 495 | Ga0496115_0210732 | 3300048918 | Bacteria | 1605 |
| 496 | Ga0496116_0000276 | 3300048919 | Bacteria | 89506 |
| 497 | Ga0496116_0033653 | 3300048919 | Bacteria | 3632 |
| 498 | Ga0496116_0046987 | 3300048919 | Bacteria | 2909 |
| 499 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 500 | Ga0496117_0006489 | 3300048920 | Bacteria | 11809 |
| 501 | Ga0496117_0098204 | 3300048920 | Bacteria | 1862 |
| 502 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 503 | Ga0496118_0000275 | 3300048921 | Bacteria | 90451 |
| 504 | Ga0496118_0000341 | 3300048921 | Bacteria | 79469 |
| 505 | Ga0496118_0162480 | 3300048921 | Bacteria | 1378 |
| 506 | Ga0496119_0006561 | 3300048922 | Bacteria | 10729 |
| 507 | Ga0496120_0025924 | 3300048923 | Bacteria | 3630 |
| 508 | Ga0496120_0044917 | 3300048923 | Bacteria | 2563 |
| 509 | Ga0496120_0109896 | 3300048923 | Bacteria | 1442 |
| 510 | Ga0496121_0000023 | 3300048924 | Bacteria | 463448 |
| 511 | Ga0496121_0000338 | 3300048924 | Bacteria | 97703 |
| 512 | Ga0496121_0001738 | 3300048924 | Bacteria | 35590 |
| 513 | Ga0496122_0000038 | 3300048925 | Bacteria | 295624 |
| 514 | Ga0496122_0026405 | 3300048925 | Bacteria | 5007 |
| 515 | Ga0496123_0002987 | 3300048926 | Bacteria | 19631 |
| 516 | Ga0496124_0000014 | 3300048927 | Bacteria | 463448 |
| 517 | Ga0496124_0030038 | 3300048927 | Bacteria | 4831 |
| 518 | Ga0496125_0000020 | 3300048928 | Bacteria | 463448 |
| 519 | Ga0496125_0008077 | 3300048928 | Bacteria | 11092 |
| 520 | Ga0496126_0000023 | 3300048929 | Bacteria | 463448 |
| 521 | Ga0496126_0000551 | 3300048929 | Bacteria | 72093 |
| 522 | Ga0496126_0008401 | 3300048929 | Bacteria | 11143 |
| 523 | Ga0496126_0008647 | 3300048929 | Bacteria | 10943 |
| 524 | Ga0496126_0010005 | 3300048929 | Bacteria | 10007 |
| 525 | Ga0501032_0006716 | 3300049569 | Bacteria | 8448 |
| 526 | Ga0501032_0009164 | 3300049569 | Bacteria | 7180 |
| 527 | Ga0501033_0009441 | 3300049570 | Bacteria | 7511 |
| 528 | Ga0501033_0028977 | 3300049570 | Bacteria | 4160 |
| 529 | Ga0501033_0247261 | 3300049570 | Bacteria | 1265 |
| 530 | Ga0501034_0002114 | 3300049571 | Bacteria | 24741 |
| 531 | Ga0501036_0015314 | 3300049572 | Bacteria | 6403 |
| 532 | Ga0501036_0027890 | 3300049572 | Bacteria | 4774 |
| 533 | Ga0501036_0199295 | 3300049572 | Bacteria | 1684 |
| 534 | Ga0501037_0000663 | 3300049573 | Bacteria | 26405 |
| 535 | Ga0501037_0007033 | 3300049573 | Bacteria | 8218 |
| 536 | Ga0501038_0004859 | 3300049574 | Bacteria | 12487 |
| 537 | Ga0501038_0137370 | 3300049574 | Bacteria | 2002 |
| 538 | Ga0501046_0002698 | 3300049580 | Bacteria | 16521 |
| 539 | Ga0501046_0323907 | 3300049580 | Bacteria | 1123 |
| 540 | Ga0501047_0005652 | 3300049581 | Bacteria | 11774 |
| 541 | Ga0501047_0010238 | 3300049581 | Bacteria | 8870 |
| 542 | Ga0501047_0072608 | 3300049581 | Bacteria | 3312 |
| 543 | Ga0501048_0005199 | 3300049582 | Bacteria | 9916 |
| 544 | Ga0501067_0091701 | 3300049583 | Bacteria | 1687 |
| 545 | Ga0501069_0226164 | 3300049585 | Bacteria | 1088 |
| 546 | Ga0501070_0000944 | 3300049586 | Bacteria | 26242 |
| 547 | Ga0501070_0002391 | 3300049586 | Bacteria | 16459 |
| 548 | Ga0501073_0053589 | 3300049589 | Bacteria | 2824 |
| 549 | Ga0501080_0025955 | 3300049742 | Bacteria | 5443 |
| 550 | Ga0501083_0128629 | 3300049744 | Bacteria | 1660 |
| 551 | Ga0501035_0007347 | 3300049822 | Bacteria | 10297 |
| 552 | Ga0501035_0014536 | 3300049822 | Bacteria | 7267 |
| 553 | Ga0501035_0112493 | 3300049822 | Bacteria | 2386 |
| 554 | Ga0501035_0342283 | 3300049822 | Bacteria | 1253 |
| 555 | Ga0501044_0002147 | 3300049823 | Bacteria | 22617 |
| 556 | Ga0501044_0002237 | 3300049823 | Bacteria | 22151 |
| 557 | Ga0501044_0004046 | 3300049823 | Bacteria | 16449 |
| 558 | Ga0501044_0030431 | 3300049823 | Bacteria | 5690 |
| 559 | nmdc:mga03683_23831_c1 | 3300050489 | Bacteria | 2388 |
| 560 | nmdc:mga03n38_117970_c1 | 3300050490 | Bacteria | 1301 |
| 561 | nmdc:mga03n38_1904_c2 | 3300050490 | Bacteria | 1171 |
| 562 | nmdc:mga03n38_40200_c1 | 3300050490 | Bacteria | 2032 |
| 563 | nmdc:mga03n38_58591_c1 | 3300050490 | Bacteria | 1746 |
| 564 | nmdc:mga00v17_15545_c1 | 3300050491 | Bacteria | 4272 |
| 565 | nmdc:mga00v17_1631_c1 | 3300050491 | Bacteria | 11734 |
| 566 | nmdc:mga00v17_181726_c1 | 3300050491 | Bacteria | 1357 |
| 567 | nmdc:mga00v17_181928_c1 | 3300050491 | Bacteria | 1356 |
| 568 | nmdc:mga00v17_42542_c1 | 3300050491 | Bacteria | 2733 |
| 569 | nmdc:mga00v17_6388_c1 | 3300050491 | Bacteria | 6252 |
| 570 | nmdc:mga00v17_65428_c1 | 3300050491 | Bacteria | 2243 |
| 571 | nmdc:mga00v17_7327_c1 | 3300050491 | Bacteria | 5880 |
| 572 | nmdc:mga0yw44_130559_c1 | 3300050492 | Bacteria | 1626 |
| 573 | nmdc:mga0yw44_21851_c1 | 3300050492 | Bacteria | 3577 |
| 574 | nmdc:mga0yw44_33112_c1 | 3300050492 | Bacteria | 3017 |
| 575 | nmdc:mga0yw44_62629_c1 | 3300050492 | Bacteria | 2285 |
| 576 | nmdc:mga0yw44_95983_c1 | 3300050492 | Bacteria | 1881 |
| 577 | nmdc:mga06z11_151469_c1 | 3300050494 | Bacteria | 1319 |
| 578 | nmdc:mga06z11_171378_c1 | 3300050494 | Bacteria | 1246 |
| 579 | nmdc:mga06z11_221929_c1 | 3300050494 | Bacteria | 1105 |
| 580 | nmdc:mga04h51_76722_c1 | 3300050495 | Bacteria | 1178 |
| 581 | nmdc:mga07m45_13765_c1 | 3300050496 | Bacteria | 4296 |
| 582 | nmdc:mga07m45_35234_c1 | 3300050496 | Bacteria | 2783 |
| 583 | nmdc:mga07m45_57610_c1 | 3300050496 | Bacteria | 2197 |
| 584 | nmdc:mga05p37_46015_c1 | 3300050507 | Bacteria | 5366 |
| 585 | nmdc:mga0sz30_13696_c1 | 3300050516 | Bacteria | 3180 |
| 586 | nmdc:mga0sz30_32403_c1 | 3300050516 | Bacteria | 2168 |
| 587 | nmdc:mga0sz30_7569_c1 | 3300050516 | Bacteria | 4077 |
| 588 | Ga0500610_0001927 | 3300053079 | Bacteria | 7382 |
| 589 | Ga0500635_0003792 | 3300053080 | Bacteria | 3832 |
| 590 | Ga0500643_008054 | 3300053087 | Bacteria | 4176 |
| 591 | Ga0500556_0002820 | 3300053104 | Bacteria | 5318 |
| 592 | Ga0500652_002710 | 3300053131 | Bacteria | 5348 |
| 593 | Ga0500616_0101423 | 3300053153 | Bacteria | 1406 |
| 594 | Ga0500616_0117672 | 3300053153 | Bacteria | 1274 |
| 595 | Ga0500627_0057884 | 3300053158 | Bacteria | 1701 |
| 596 | Ga0500627_0113044 | 3300053158 | Bacteria | 1223 |
| 597 | Ga0500645_000195 | 3300053730 | Bacteria | 47101 |
| 598 | Ga0501082_0279302 | 3300060353 | Bacteria | 1454 |
| 599 | Ga0466962_0131362 | 3300061719 | Bacteria | 1210 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046809 | Ga0495600_0028281 | Ga0495600_0028281_2226_2927 | 226 |
| 2 | 3300050494 | nmdc:mga06z11_171378_c1 | nmdc:mga06z11_171378_c1_258_971 | 236 |
| 3 | 3300050494 | nmdc:mga06z11_221929_c1 | nmdc:mga06z11_221929_c1_345_1070 | 238 |
| 4 | iso_pu_bacteria | 2551306166 | 2552107817 | 243 |
| 5 | 3300014325 | Ga0163163_10468024 | Ga0163163_104680242 | 247 |
| 6 | 3300044765 | Ga0466970_0004994 | Ga0466970_0004994_3157_3927 | 247 |
| 7 | 3300046462 | Ga0495651_0058527 | Ga0495651_0058527_741_1505 | 247 |
| 8 | 3300046516 | Ga0495628_0146898 | Ga0495628_0146898_204_968 | 247 |
| 9 | 3300046529 | Ga0495652_0101414 | Ga0495652_0101414_637_1401 | 247 |
| 10 | 3300046543 | Ga0495645_0046374 | Ga0495645_0046374_1037_1801 | 247 |
| 11 | 3300047317 | Ga0495604_0042184 | Ga0495604_0042184_2292_3056 | 247 |
| 12 | 3300005539 | Ga0068853_100103731 | Ga0068853_1001037313 | 248 |
| 13 | 3300005548 | Ga0070665_100173278 | Ga0070665_1001732781 | 248 |
| 14 | 3300005563 | Ga0068855_100006164 | Ga0068855_1000061645 | 248 |
| 15 | 3300005578 | Ga0068854_100010898 | Ga0068854_1000108983 | 248 |
| 16 | 3300005614 | Ga0068856_100012671 | Ga0068856_1000126713 | 248 |
| 17 | 3300005616 | Ga0068852_100033270 | Ga0068852_1000332704 | 248 |
| 18 | 3300009093 | Ga0105240_10064066 | Ga0105240_100640663 | 248 |
| 19 | 3300009174 | Ga0105241_10062428 | Ga0105241_100624282 | 248 |
| 20 | 3300009545 | Ga0105237_10028762 | Ga0105237_100287621 | 248 |
| 21 | 3300009551 | Ga0105238_10005858 | Ga0105238_100058589 | 248 |
| 22 | 3300010375 | Ga0105239_10014422 | Ga0105239_100144228 | 248 |
| 23 | 3300013296 | Ga0157374_10015721 | Ga0157374_100157214 | 248 |
| 24 | 3300013307 | Ga0157372_10701777 | Ga0157372_107017771 | 248 |
| 25 | 3300025904 | Ga0207647_10037258 | Ga0207647_100372583 | 248 |
| 26 | 3300025911 | Ga0207654_10033971 | Ga0207654_100339712 | 248 |
| 27 | 3300025913 | Ga0207695_10002792 | Ga0207695_1000279211 | 248 |
| 28 | 3300025914 | Ga0207671_10001326 | Ga0207671_1000132611 | 248 |
| 29 | 3300025924 | Ga0207694_10010486 | Ga0207694_100104864 | 248 |
| 30 | 3300025949 | Ga0207667_10068340 | Ga0207667_100683402 | 248 |
| 31 | 3300025981 | Ga0207640_10018643 | Ga0207640_100186433 | 248 |
| 32 | 3300026041 | Ga0207639_10178224 | Ga0207639_101782242 | 248 |
| 33 | 3300026078 | Ga0207702_10136825 | Ga0207702_101368253 | 248 |
| 34 | 3300026142 | Ga0207698_10168866 | Ga0207698_101688662 | 248 |
| 35 | 3300028379 | Ga0268266_10059256 | Ga0268266_100592563 | 248 |
| 36 | iso_pu_bacteria | 2565956761 | 2566996442 | 251 |
| 37 | iso_pu_bacteria | 2738541308 | 2738889977 | 251 |
| 38 | iso_pu_bacteria | 2904535858 | 2904538956 | 251 |
| 39 | iso_pu_bacteria | 2738543005 | 2739205345 | 253 |
| 40 | iso_pu_bacteria | 2738543034 | 2739362189 | 253 |
| 41 | iso_pu_bacteria | 2904765812 | 2904770097 | 253 |
| 42 | iso_pu_bacteria | 2904770941 | 2904771054 | 253 |
| 43 | iso_pu_bacteria | 2908811453 | 2908815098 | 253 |
| 44 | iso_pu_bacteria | 2919420072 | 2919424419 | 253 |
| 45 | iso_pu_bacteria | 2919432681 | 2919436812 | 253 |
| 46 | iso_pu_bacteria | 2928142448 | 2928144949 | 253 |
| 47 | 3300006353 | Ga0075370_10043886 | Ga0075370_100438862 | 255 |
| 48 | 3300014325 | Ga0163163_10537656 | Ga0163163_105376562 | 256 |
| 49 | iso_pu_bacteria | 2738541264 | 2738666574 | 256 |
| 50 | iso_pu_bacteria | 2738541356 | 2739145418 | 256 |
| 51 | 3300006178 | Ga0075367_10130491 | Ga0075367_101304912 | 257 |
| 52 | 3300045976 | Ga0466967_0521960 | Ga0466967_0521960_371_1156 | 258 |
| 53 | 3300046476 | Ga0495662_0090935 | Ga0495662_0090935_560_1345 | 258 |
| 54 | 3300046674 | Ga0495588_0014059 | Ga0495588_0014059_1851_2636 | 258 |
| 55 | 3300047315 | Ga0495581_0157259 | Ga0495581_0157259_29_814 | 258 |
| 56 | 3300003792 | Ga0055540_1000029 | Ga0055540_1000029172 | 260 |
| 57 | 3300005335 | Ga0070666_10125445 | Ga0070666_101254452 | 260 |
| 58 | 3300005367 | Ga0070667_100003577 | Ga0070667_10000357710 | 260 |
| 59 | 3300009545 | Ga0105237_10004825 | Ga0105237_1000482511 | 260 |
| 60 | 3300010375 | Ga0105239_10267608 | Ga0105239_102676082 | 260 |
| 61 | 3300025303 | Ga0209051_1000042 | Ga0209051_1000042316 | 260 |
| 62 | 3300025914 | Ga0207671_10010122 | Ga0207671_100101227 | 260 |
| 63 | 3300025986 | Ga0207658_10001582 | Ga0207658_1000158215 | 260 |
| 64 | 3300031251 | Ga0265327_10002914 | Ga0265327_1000291411 | 260 |
| 65 | 3300031251 | Ga0265327_10068663 | Ga0265327_100686632 | 260 |
| 66 | 3300044683 | Ga0466965_0020463 | Ga0466965_0020463_417_1202 | 260 |
| 67 | 3300048903 | Ga0496100_0000009 | Ga0496100_0000009_161028_161813 | 260 |
| 68 | 3300048904 | Ga0496101_0000018 | Ga0496101_0000018_222754_223539 | 260 |
| 69 | 3300048905 | Ga0496102_0127309 | Ga0496102_0127309_1563_2348 | 260 |
| 70 | 3300048906 | Ga0496103_0001096 | Ga0496103_0001096_16994_17779 | 260 |
| 71 | 3300048909 | Ga0496106_0020704 | Ga0496106_0020704_2745_3530 | 260 |
| 72 | 3300048910 | Ga0496107_0003353 | Ga0496107_0003353_1715_2500 | 260 |
| 73 | 3300048912 | Ga0496109_0000434 | Ga0496109_0000434_9487_10272 | 260 |
| 74 | 3300048913 | Ga0496110_0000204 | Ga0496110_0000204_34848_35633 | 260 |
| 75 | 3300048914 | Ga0496111_0012866 | Ga0496111_0012866_3847_4632 | 260 |
| 76 | 3300048917 | Ga0496114_0002431 | Ga0496114_0002431_10507_11292 | 260 |
| 77 | 3300048918 | Ga0496115_0067705 | Ga0496115_0067705_740_1525 | 260 |
| 78 | 3300048919 | Ga0496116_0033653 | Ga0496116_0033653_1984_2769 | 260 |
| 79 | 3300048920 | Ga0496117_0098204 | Ga0496117_0098204_815_1600 | 260 |
| 80 | 3300048921 | Ga0496118_0162480 | Ga0496118_0162480_331_1116 | 260 |
| 81 | 3300048924 | Ga0496121_0000023 | Ga0496121_0000023_229951_230736 | 260 |
| 82 | 3300048925 | Ga0496122_0000038 | Ga0496122_0000038_229951_230736 | 260 |
| 83 | 3300048926 | Ga0496123_0002987 | Ga0496123_0002987_2009_2794 | 260 |
| 84 | 3300048927 | Ga0496124_0000014 | Ga0496124_0000014_229951_230736 | 260 |
| 85 | 3300048928 | Ga0496125_0000020 | Ga0496125_0000020_232713_233498 | 260 |
| 86 | 3300048929 | Ga0496126_0000023 | Ga0496126_0000023_229951_230736 | 260 |
| 87 | 3300005937 | Ga0081455_10210050 | Ga0081455_102100502 | 261 |
| 88 | 3300026118 | Ga0207675_100825159 | Ga0207675_1008251591 | 261 |
| 89 | 3300036712 | Ga0316584_0075517 | Ga0316584_0075517_1600_2388 | 261 |
| 90 | 3300044658 | Ga0466972_0014121 | Ga0466972_0014121_2139_2942 | 261 |
| 91 | 3300044683 | Ga0466965_0004842 | Ga0466965_0004842_2029_2832 | 261 |
| 92 | 3300044694 | Ga0466963_0398302 | Ga0466963_0398302_49_858 | 261 |
| 93 | 3300044735 | Ga0466968_0002156 | Ga0466968_0002156_4954_5757 | 261 |
| 94 | 3300044842 | Ga0466957_0012567 | Ga0466957_0012567_3897_4700 | 261 |
| 95 | 3300044901 | Ga0466960_0003419 | Ga0466960_0003419_3759_4562 | 261 |
| 96 | 3300045836 | Ga0466958_0054031 | Ga0466958_0054031_440_1243 | 261 |
| 97 | 3300045976 | Ga0466967_0020211 | Ga0466967_0020211_4039_4842 | 261 |
| 98 | 3300045976 | Ga0466967_0421074 | Ga0466967_0421074_71_880 | 261 |
| 99 | 3300046460 | Ga0495638_0060257 | Ga0495638_0060257_83_880 | 261 |
| 100 | 3300048925 | Ga0496122_0026405 | Ga0496122_0026405_3898_4701 | 261 |
| 101 | 3300048929 | Ga0496126_0008401 | Ga0496126_0008401_9874_10677 | 261 |
| 102 | 3300049581 | Ga0501047_0072608 | Ga0501047_0072608_1447_2247 | 261 |
| 103 | 3300049822 | Ga0501035_0342283 | Ga0501035_0342283_260_1060 | 261 |
| 104 | 3300050492 | nmdc:mga0yw44_21851_c1 | nmdc:mga0yw44_21851_c1_2394_3191 | 261 |
| 105 | 3300053087 | Ga0500643_008054 | Ga0500643_008054_2811_3608 | 261 |
| 106 | 3300053158 | Ga0500627_0057884 | Ga0500627_0057884_90_887 | 261 |
| 107 | 3300053730 | Ga0500645_000195 | Ga0500645_000195_13210_14007 | 261 |
| 108 | 3300039437 | Ga0436365_0865525 | Ga0436365_0865525_4472_5263 | 262 |
| 109 | 3300039437 | Ga0436365_0997910 | Ga0436365_0997910_3541_4335 | 262 |
| 110 | 3300039437 | Ga0436365_1378611 | Ga0436365_1378611_35002_35790 | 262 |
| 111 | 3300044683 | Ga0466965_0177783 | Ga0466965_0177783_129_929 | 262 |
| 112 | 3300044694 | Ga0466963_0044299 | Ga0466963_0044299_691_1482 | 262 |
| 113 | 3300044694 | Ga0466963_0119194 | Ga0466963_0119194_486_1283 | 262 |
| 114 | 3300044694 | Ga0466963_0194228 | Ga0466963_0194228_595_1392 | 262 |
| 115 | 3300044694 | Ga0466963_0292415 | Ga0466963_0292415_326_1123 | 262 |
| 116 | 3300044719 | Ga0466971_0013433 | Ga0466971_0013433_2380_3171 | 262 |
| 117 | 3300044901 | Ga0466960_0000117 | Ga0466960_0000117_12153_12962 | 262 |
| 118 | 3300045976 | Ga0466967_0035544 | Ga0466967_0035544_3406_4197 | 262 |
| 119 | 3300045976 | Ga0466967_0128776 | Ga0466967_0128776_81_878 | 262 |
| 120 | 3300048905 | Ga0496102_0132204 | Ga0496102_0132204_220_1008 | 262 |
| 121 | 3300048921 | Ga0496118_0000341 | Ga0496118_0000341_65232_66020 | 262 |
| 122 | 3300048929 | Ga0496126_0008647 | Ga0496126_0008647_8332_9129 | 262 |
| 123 | 3300049569 | Ga0501032_0006716 | Ga0501032_0006716_4559_5356 | 262 |
| 124 | 3300049570 | Ga0501033_0028977 | Ga0501033_0028977_1486_2283 | 262 |
| 125 | 3300049570 | Ga0501033_0247261 | Ga0501033_0247261_402_1196 | 262 |
| 126 | 3300049571 | Ga0501034_0002114 | Ga0501034_0002114_2518_3315 | 262 |
| 127 | 3300049572 | Ga0501036_0027890 | Ga0501036_0027890_284_1081 | 262 |
| 128 | 3300049573 | Ga0501037_0007033 | Ga0501037_0007033_2067_2864 | 262 |
| 129 | 3300049580 | Ga0501046_0002698 | Ga0501046_0002698_7574_8371 | 262 |
| 130 | 3300049580 | Ga0501046_0323907 | Ga0501046_0323907_121_915 | 262 |
| 131 | 3300049581 | Ga0501047_0010238 | Ga0501047_0010238_2068_2865 | 262 |
| 132 | 3300049582 | Ga0501048_0005199 | Ga0501048_0005199_430_1227 | 262 |
| 133 | 3300049585 | Ga0501069_0226164 | Ga0501069_0226164_204_1001 | 262 |
| 134 | 3300049586 | Ga0501070_0002391 | Ga0501070_0002391_4546_5343 | 262 |
| 135 | 3300049742 | Ga0501080_0025955 | Ga0501080_0025955_176_973 | 262 |
| 136 | 3300049744 | Ga0501083_0128629 | Ga0501083_0128629_767_1564 | 262 |
| 137 | 3300049822 | Ga0501035_0014536 | Ga0501035_0014536_3906_4703 | 262 |
| 138 | 3300049822 | Ga0501035_0112493 | Ga0501035_0112493_527_1318 | 262 |
| 139 | 3300049823 | Ga0501044_0004046 | Ga0501044_0004046_8477_9274 | 262 |
| 140 | 3300060353 | Ga0501082_0279302 | Ga0501082_0279302_313_1110 | 262 |
| 141 | 3300025915 | Ga0207693_10507156 | Ga0207693_105071561 | 264 |
| 142 | 3300035691 | Ga0373931_0140682 | Ga0373931_0140682_14_814 | 266 |
| 143 | 3300031251 | Ga0265327_10027594 | Ga0265327_100275943 | 267 |
| 144 | iso_pu_bacteria | 2643221692 | 2644512508 | 267 |
| 145 | 3300053153 | Ga0500616_0101423 | Ga0500616_0101423_194_1045 | 269 |
| 146 | 3300044684 | Ga0466966_0070523 | Ga0466966_0070523_477_1301 | 270 |
| 147 | 3300047320 | Ga0495672_0003432 | Ga0495672_0003432_2151_2972 | 271 |
| 148 | 3300049823 | Ga0501044_0030431 | Ga0501044_0030431_4743_5561 | 271 |
| 149 | 3300009176 | Ga0105242_10226296 | Ga0105242_102262962 | 272 |
| 150 | 3300009177 | Ga0105248_10421801 | Ga0105248_104218012 | 272 |
| 151 | 3300009545 | Ga0105237_10265098 | Ga0105237_102650981 | 272 |
| 152 | 3300013307 | Ga0157372_10254023 | Ga0157372_102540232 | 272 |
| 153 | 3300014969 | Ga0157376_10562289 | Ga0157376_105622892 | 272 |
| 154 | 3300035084 | Ga0373928_0011509 | Ga0373928_0011509_367_1185 | 272 |
| 155 | 3300035115 | Ga0373941_0008988 | Ga0373941_0008988_150_968 | 272 |
| 156 | 3300044694 | Ga0466963_0073723 | Ga0466963_0073723_521_1342 | 272 |
| 157 | 3300048903 | Ga0496100_0190380 | Ga0496100_0190380_647_1465 | 272 |
| 158 | 3300048906 | Ga0496103_0046381 | Ga0496103_0046381_25_843 | 272 |
| 159 | 3300048909 | Ga0496106_0171967 | Ga0496106_0171967_439_1257 | 272 |
| 160 | 3300048910 | Ga0496107_0056165 | Ga0496107_0056165_380_1198 | 272 |
| 161 | 3300048911 | Ga0496108_0033508 | Ga0496108_0033508_141_965 | 272 |
| 162 | 3300048918 | Ga0496115_0210732 | Ga0496115_0210732_551_1369 | 272 |
| 163 | 3300049589 | Ga0501073_0053589 | Ga0501073_0053589_1962_2807 | 272 |
| 164 | 3300050491 | nmdc:mga00v17_15545_c1 | nmdc:mga00v17_15545_c1_2787_3608 | 272 |
| 165 | iso_pu_bacteria | 2751185725 | 2753035223 | 272 |
| 166 | iso_pu_bacteria | 2751185792 | 2753323740 | 272 |
| 167 | 3300031251 | Ga0265327_10000154 | Ga0265327_1000015466 | 273 |
| 168 | 3300044658 | Ga0466972_0041677 | Ga0466972_0041677_205_1032 | 275 |
| 169 | 3300050492 | nmdc:mga0yw44_130559_c1 | nmdc:mga0yw44_130559_c1_131_970 | 275 |
| 170 | 3300006051 | Ga0075364_10201295 | Ga0075364_102012952 | 276 |
| 171 | 3300013105 | Ga0157369_10069364 | Ga0157369_100693642 | 276 |
| 172 | 3300037853 | Ga0436364_1121346 | Ga0436364_1121346_1677_2516 | 276 |
| 173 | 3300039437 | Ga0436365_0593663 | Ga0436365_0593663_319_1164 | 276 |
| 174 | 3300041460 | Ga0451802_0086339 | Ga0451802_0086339_321_1151 | 276 |
| 175 | 3300044656 | Ga0466969_0031608 | Ga0466969_0031608_1082_1936 | 276 |
| 176 | 3300044683 | Ga0466965_0108892 | Ga0466965_0108892_492_1331 | 276 |
| 177 | 3300044684 | Ga0466966_0005734 | Ga0466966_0005734_2371_3210 | 276 |
| 178 | 3300044684 | Ga0466966_0010087 | Ga0466966_0010087_3288_4142 | 276 |
| 179 | 3300044693 | Ga0466961_0022594 | Ga0466961_0022594_2380_3219 | 276 |
| 180 | 3300044735 | Ga0466968_0001830 | Ga0466968_0001830_6352_7206 | 276 |
| 181 | 3300044765 | Ga0466970_0096414 | Ga0466970_0096414_418_1272 | 276 |
| 182 | 3300044842 | Ga0466957_0034553 | Ga0466957_0034553_304_1143 | 276 |
| 183 | 3300045049 | Ga0466959_0012610 | Ga0466959_0012610_2325_3179 | 276 |
| 184 | 3300045049 | Ga0466959_0064886 | Ga0466959_0064886_632_1471 | 276 |
| 185 | 3300045836 | Ga0466958_0001238 | Ga0466958_0001238_2217_3056 | 276 |
| 186 | 3300045836 | Ga0466958_0079579 | Ga0466958_0079579_554_1408 | 276 |
| 187 | 3300045976 | Ga0466967_0079399 | Ga0466967_0079399_2056_2886 | 276 |
| 188 | 3300045976 | Ga0466967_0338087 | Ga0466967_0338087_258_1097 | 276 |
| 189 | 3300049570 | Ga0501033_0009441 | Ga0501033_0009441_4028_4861 | 276 |
| 190 | 3300049572 | Ga0501036_0199295 | Ga0501036_0199295_318_1151 | 276 |
| 191 | 3300049574 | Ga0501038_0137370 | Ga0501038_0137370_377_1210 | 276 |
| 192 | 3300049581 | Ga0501047_0005652 | Ga0501047_0005652_5049_5882 | 276 |
| 193 | 3300049822 | Ga0501035_0007347 | Ga0501035_0007347_2800_3633 | 276 |
| 194 | 3300049823 | Ga0501044_0002147 | Ga0501044_0002147_6566_7399 | 276 |
| 195 | 3300050491 | nmdc:mga00v17_181928_c1 | nmdc:mga00v17_181928_c1_108_947 | 276 |
| 196 | 3300050491 | nmdc:mga00v17_42542_c1 | nmdc:mga00v17_42542_c1_1840_2673 | 276 |
| 197 | 3300061719 | Ga0466962_0131362 | Ga0466962_0131362_296_1150 | 276 |
| 198 | iso_pu_bacteria | 2643221687 | 2644486430 | 276 |
| 199 | iso_pu_bacteria | 2902837492 | 2902840153 | 276 |
| 200 | 3300009092 | Ga0105250_10032624 | Ga0105250_100326242 | 277 |
| 201 | 3300009098 | Ga0105245_10001029 | Ga0105245_1000102922 | 277 |
| 202 | 3300009101 | Ga0105247_10009458 | Ga0105247_100094586 | 277 |
| 203 | 3300009147 | Ga0114129_10043041 | Ga0114129_100430412 | 277 |
| 204 | 3300009148 | Ga0105243_10001000 | Ga0105243_1000100022 | 277 |
| 205 | 3300009176 | Ga0105242_10000759 | Ga0105242_100007592 | 277 |
| 206 | 3300009177 | Ga0105248_10003071 | Ga0105248_100030715 | 277 |
| 207 | 3300009177 | Ga0105248_10333447 | Ga0105248_103334472 | 277 |
| 208 | 3300009545 | Ga0105237_10107256 | Ga0105237_101072563 | 277 |
| 209 | 3300009551 | Ga0105238_10127461 | Ga0105238_101274612 | 277 |
| 210 | 3300009553 | Ga0105249_10005589 | Ga0105249_100055899 | 277 |
| 211 | 3300009553 | Ga0105249_10015924 | Ga0105249_100159242 | 277 |
| 212 | 3300009553 | Ga0105249_10313969 | Ga0105249_103139692 | 277 |
| 213 | 3300010375 | Ga0105239_10016836 | Ga0105239_100168369 | 277 |
| 214 | 3300013296 | Ga0157374_10175252 | Ga0157374_101752522 | 277 |
| 215 | 3300013297 | Ga0157378_10001038 | Ga0157378_100010382 | 277 |
| 216 | 3300013306 | Ga0163162_10018684 | Ga0163162_100186842 | 277 |
| 217 | 3300013306 | Ga0163162_10071077 | Ga0163162_100710773 | 277 |
| 218 | 3300013307 | Ga0157372_10011618 | Ga0157372_100116182 | 277 |
| 219 | 3300013308 | Ga0157375_10000838 | Ga0157375_100008382 | 277 |
| 220 | 3300013308 | Ga0157375_10397655 | Ga0157375_103976552 | 277 |
| 221 | 3300014325 | Ga0163163_10062712 | Ga0163163_100627122 | 277 |
| 222 | 3300014326 | Ga0157380_10001428 | Ga0157380_1000142815 | 277 |
| 223 | 3300014968 | Ga0157379_10016789 | Ga0157379_100167898 | 277 |
| 224 | 3300014969 | Ga0157376_10049082 | Ga0157376_100490823 | 277 |
| 225 | 3300035691 | Ga0373931_0222767 | Ga0373931_0222767_34_867 | 277 |
| 226 | 3300041411 | Ga0439466_0012631 | Ga0439466_0012631_1218_2051 | 277 |
| 227 | 3300041411 | Ga0439466_0027199 | Ga0439466_0027199_64_900 | 277 |
| 228 | 3300041411 | Ga0439466_0028287 | Ga0439466_0028287_766_1599 | 277 |
| 229 | 3300041413 | Ga0439465_0003815 | Ga0439465_0003815_211_1044 | 277 |
| 230 | 3300041413 | Ga0439465_0006734 | Ga0439465_0006734_908_1741 | 277 |
| 231 | 3300041459 | Ga0451800_0666987 | Ga0451800_0666987_272_1111 | 277 |
| 232 | 3300042004 | Ga0439445_0003672 | Ga0439445_0003672_2145_2981 | 277 |
| 233 | 3300042004 | Ga0439445_0004053 | Ga0439445_0004053_1369_2202 | 277 |
| 234 | 3300042008 | Ga0439450_046751 | Ga0439450_046751_161_1000 | 277 |
| 235 | 3300042435 | Ga0439434_0028143 | Ga0439434_0028143_232_1068 | 277 |
| 236 | 3300042435 | Ga0439434_0054856 | Ga0439434_0054856_388_1221 | 277 |
| 237 | 3300044656 | Ga0466969_0037463 | Ga0466969_0037463_139_972 | 277 |
| 238 | 3300044658 | Ga0466972_0011693 | Ga0466972_0011693_632_1465 | 277 |
| 239 | 3300044683 | Ga0466965_0003164 | Ga0466965_0003164_2097_2930 | 277 |
| 240 | 3300044684 | Ga0466966_0021904 | Ga0466966_0021904_757_1590 | 277 |
| 241 | 3300044693 | Ga0466961_0009580 | Ga0466961_0009580_4594_5427 | 277 |
| 242 | 3300044719 | Ga0466971_0001079 | Ga0466971_0001079_8676_9509 | 277 |
| 243 | 3300044765 | Ga0466970_0045119 | Ga0466970_0045119_938_1771 | 277 |
| 244 | 3300045976 | Ga0466967_0374162 | Ga0466967_0374162_123_962 | 277 |
| 245 | 3300046475 | Ga0495639_0111381 | Ga0495639_0111381_179_1018 | 277 |
| 246 | 3300046476 | Ga0495662_0044921 | Ga0495662_0044921_897_1736 | 277 |
| 247 | 3300046690 | Ga0495624_0082450 | Ga0495624_0082450_343_1182 | 277 |
| 248 | 3300047319 | Ga0495674_0120535 | Ga0495674_0120535_1168_2007 | 277 |
| 249 | 3300047320 | Ga0495672_0170829 | Ga0495672_0170829_235_1068 | 277 |
| 250 | 3300047321 | Ga0495676_0117740 | Ga0495676_0117740_340_1179 | 277 |
| 251 | 3300047673 | Ga0495593_0010681 | Ga0495593_0010681_175_1014 | 277 |
| 252 | 3300048903 | Ga0496100_0068760 | Ga0496100_0068760_557_1390 | 277 |
| 253 | 3300048903 | Ga0496100_0196940 | Ga0496100_0196940_183_1016 | 277 |
| 254 | 3300048903 | Ga0496100_0496323 | Ga0496100_0496323_73_906 | 277 |
| 255 | 3300048904 | Ga0496101_0026670 | Ga0496101_0026670_1878_2711 | 277 |
| 256 | 3300048904 | Ga0496101_0091404 | Ga0496101_0091404_1196_2029 | 277 |
| 257 | 3300048905 | Ga0496102_0012165 | Ga0496102_0012165_1408_2241 | 277 |
| 258 | 3300048905 | Ga0496102_0012619 | Ga0496102_0012619_5626_6459 | 277 |
| 259 | 3300048906 | Ga0496103_0000538 | Ga0496103_0000538_24526_25359 | 277 |
| 260 | 3300048906 | Ga0496103_0159629 | Ga0496103_0159629_573_1409 | 277 |
| 261 | 3300048907 | Ga0496104_0017819 | Ga0496104_0017819_209_1042 | 277 |
| 262 | 3300048907 | Ga0496104_0230975 | Ga0496104_0230975_164_997 | 277 |
| 263 | 3300048907 | Ga0496104_0341286 | Ga0496104_0341286_231_1082 | 277 |
| 264 | 3300048908 | Ga0496105_0037799 | Ga0496105_0037799_2156_2989 | 277 |
| 265 | 3300048909 | Ga0496106_0003068 | Ga0496106_0003068_2684_3517 | 277 |
| 266 | 3300048910 | Ga0496107_0001670 | Ga0496107_0001670_4776_5609 | 277 |
| 267 | 3300048911 | Ga0496108_0094431 | Ga0496108_0094431_1024_1866 | 277 |
| 268 | 3300048912 | Ga0496109_0016900 | Ga0496109_0016900_757_1590 | 277 |
| 269 | 3300048912 | Ga0496109_0321026 | Ga0496109_0321026_527_1360 | 277 |
| 270 | 3300048913 | Ga0496110_0005194 | Ga0496110_0005194_2922_3755 | 277 |
| 271 | 3300048913 | Ga0496110_0194231 | Ga0496110_0194231_62_895 | 277 |
| 272 | 3300048914 | Ga0496111_0137687 | Ga0496111_0137687_141_974 | 277 |
| 273 | 3300048915 | Ga0496112_0009281 | Ga0496112_0009281_6840_7679 | 277 |
| 274 | 3300048915 | Ga0496112_0204597 | Ga0496112_0204597_200_1033 | 277 |
| 275 | 3300048916 | Ga0496113_0117552 | Ga0496113_0117552_310_1143 | 277 |
| 276 | 3300048917 | Ga0496114_0000183 | Ga0496114_0000183_32048_32881 | 277 |
| 277 | 3300048918 | Ga0496115_0008628 | Ga0496115_0008628_1512_2345 | 277 |
| 278 | 3300050489 | nmdc:mga03683_23831_c1 | nmdc:mga03683_23831_c1_789_1622 | 277 |
| 279 | 3300050490 | nmdc:mga03n38_117970_c1 | nmdc:mga03n38_117970_c1_418_1254 | 277 |
| 280 | 3300050490 | nmdc:mga03n38_1904_c2 | nmdc:mga03n38_1904_c2_297_1133 | 277 |
| 281 | 3300050491 | nmdc:mga00v17_1631_c1 | nmdc:mga00v17_1631_c1_10223_11056 | 277 |
| 282 | 3300050491 | nmdc:mga00v17_6388_c1 | nmdc:mga00v17_6388_c1_1468_2301 | 277 |
| 283 | 3300050491 | nmdc:mga00v17_65428_c1 | nmdc:mga00v17_65428_c1_1292_2128 | 277 |
| 284 | 3300050492 | nmdc:mga0yw44_33112_c1 | nmdc:mga0yw44_33112_c1_2088_2921 | 277 |
| 285 | 3300050492 | nmdc:mga0yw44_62629_c1 | nmdc:mga0yw44_62629_c1_1285_2121 | 277 |
| 286 | 3300050492 | nmdc:mga0yw44_95983_c1 | nmdc:mga0yw44_95983_c1_342_1178 | 277 |
| 287 | 3300050494 | nmdc:mga06z11_151469_c1 | nmdc:mga06z11_151469_c1_36_872 | 277 |
| 288 | 3300050495 | nmdc:mga04h51_76722_c1 | nmdc:mga04h51_76722_c1_43_879 | 277 |
| 289 | 3300050496 | nmdc:mga07m45_57610_c1 | nmdc:mga07m45_57610_c1_1215_2051 | 277 |
| 290 | 3300050507 | nmdc:mga05p37_46015_c1 | nmdc:mga05p37_46015_c1_3808_4641 | 277 |
| 291 | 3300050516 | nmdc:mga0sz30_7569_c1 | nmdc:mga0sz30_7569_c1_2725_3558 | 277 |
| 292 | iso_pu_bacteria | 2738541274 | 2738706098 | 277 |
| 293 | iso_pu_bacteria | 2738543028 | 2739333002 | 277 |
| 294 | iso_pu_bacteria | 2842134933 | 2842138452 | 277 |
| 295 | iso_pu_bacteria | 2902792274 | 2902798447 | 277 |
| 296 | iso_pu_bacteria | 2902799365 | 2902801608 | 277 |
| 297 | 3300048907 | Ga0496104_0413151 | Ga0496104_0413151_215_1066 | 278 |
| 298 | iso_pu_bacteria | 2929212328 | 2929214917 | 278 |
| 299 | 3300003792 | Ga0055540_1002541 | Ga0055540_10025413 | 280 |
| 300 | 3300003792 | Ga0055540_1003267 | Ga0055540_10032675 | 280 |
| 301 | 3300003792 | Ga0055540_1004510 | Ga0055540_10045102 | 280 |
| 302 | 3300005539 | Ga0068853_100008592 | Ga0068853_1000085923 | 280 |
| 303 | 3300006038 | Ga0075365_10033291 | Ga0075365_100332914 | 280 |
| 304 | 3300006038 | Ga0075365_10093120 | Ga0075365_100931202 | 280 |
| 305 | 3300006186 | Ga0075369_10090683 | Ga0075369_100906832 | 280 |
| 306 | 3300025273 | Ga0209673_1029315 | Ga0209673_10293153 | 280 |
| 307 | 3300025303 | Ga0209051_1004157 | Ga0209051_10041576 | 280 |
| 308 | 3300025303 | Ga0209051_1008656 | Ga0209051_10086562 | 280 |
| 309 | 3300025303 | Ga0209051_1015862 | Ga0209051_10158624 | 280 |
| 310 | 3300026041 | Ga0207639_10008929 | Ga0207639_100089296 | 280 |
| 311 | 3300041452 | Ga0451793_0913039 | Ga0451793_0913039_862_1710 | 280 |
| 312 | 3300041462 | Ga0451806_876685 | Ga0451806_876685_373_1221 | 280 |
| 313 | 3300047472 | Ga0495686_0002735 | Ga0495686_0002735_13127_13975 | 280 |
| 314 | 3300050491 | nmdc:mga00v17_181726_c1 | nmdc:mga00v17_181726_c1_428_1282 | 280 |
| 315 | 3300005347 | Ga0070668_100034956 | Ga0070668_1000349562 | 281 |
| 316 | 3300005353 | Ga0070669_100001847 | Ga0070669_10000184711 | 281 |
| 317 | 3300005355 | Ga0070671_100149893 | Ga0070671_1001498931 | 281 |
| 318 | 3300005356 | Ga0070674_100017309 | Ga0070674_1000173094 | 281 |
| 319 | 3300005367 | Ga0070667_100000391 | Ga0070667_10000039134 | 281 |
| 320 | 3300005435 | Ga0070714_100033174 | Ga0070714_1000331743 | 281 |
| 321 | 3300005615 | Ga0070702_100152457 | Ga0070702_1001524572 | 281 |
| 322 | 3300005617 | Ga0068859_100032433 | Ga0068859_1000324335 | 281 |
| 323 | 3300005618 | Ga0068864_100351267 | Ga0068864_1003512672 | 281 |
| 324 | 3300005841 | Ga0068863_100000992 | Ga0068863_1000009923 | 281 |
| 325 | 3300005841 | Ga0068863_100483321 | Ga0068863_1004833212 | 281 |
| 326 | 3300005842 | Ga0068858_100029600 | Ga0068858_1000296005 | 281 |
| 327 | 3300005843 | Ga0068860_100000065 | Ga0068860_100000065173 | 281 |
| 328 | 3300005844 | Ga0068862_100000028 | Ga0068862_100000028167 | 281 |
| 329 | 3300006051 | Ga0075364_10060585 | Ga0075364_100605852 | 281 |
| 330 | 3300006186 | Ga0075369_10010294 | Ga0075369_100102943 | 281 |
| 331 | 3300006931 | Ga0097620_100032433 | Ga0097620_1000324335 | 281 |
| 332 | 3300009101 | Ga0105247_10000232 | Ga0105247_1000023224 | 281 |
| 333 | 3300009177 | Ga0105248_10000074 | Ga0105248_1000007424 | 281 |
| 334 | 3300009545 | Ga0105237_10010195 | Ga0105237_100101953 | 281 |
| 335 | 3300009553 | Ga0105249_10000011 | Ga0105249_10000011255 | 281 |
| 336 | 3300014325 | Ga0163163_10046502 | Ga0163163_100465025 | 281 |
| 337 | 3300021377 | Ga0213874_10089055 | Ga0213874_100890551 | 281 |
| 338 | 3300025898 | Ga0207692_10049291 | Ga0207692_100492912 | 281 |
| 339 | 3300025900 | Ga0207710_10000022 | Ga0207710_10000022288 | 281 |
| 340 | 3300025914 | Ga0207671_10041471 | Ga0207671_100414712 | 281 |
| 341 | 3300025923 | Ga0207681_10001802 | Ga0207681_100018027 | 281 |
| 342 | 3300025928 | Ga0207700_10041267 | Ga0207700_100412672 | 281 |
| 343 | 3300025929 | Ga0207664_10261936 | Ga0207664_102619362 | 281 |
| 344 | 3300025929 | Ga0207664_10450520 | Ga0207664_104505201 | 281 |
| 345 | 3300025931 | Ga0207644_10315948 | Ga0207644_103159482 | 281 |
| 346 | 3300025937 | Ga0207669_10038390 | Ga0207669_100383902 | 281 |
| 347 | 3300025941 | Ga0207711_10001226 | Ga0207711_100012268 | 281 |
| 348 | 3300025941 | Ga0207711_10014691 | Ga0207711_100146916 | 281 |
| 349 | 3300025961 | Ga0207712_10000020 | Ga0207712_1000002023 | 281 |
| 350 | 3300025986 | Ga0207658_10000284 | Ga0207658_1000028423 | 281 |
| 351 | 3300026035 | Ga0207703_10040837 | Ga0207703_100408372 | 281 |
| 352 | 3300026088 | Ga0207641_10001875 | Ga0207641_1000187510 | 281 |
| 353 | 3300026088 | Ga0207641_10120457 | Ga0207641_101204572 | 281 |
| 354 | 3300026095 | Ga0207676_10068225 | Ga0207676_100682252 | 281 |
| 355 | 3300026095 | Ga0207676_10301592 | Ga0207676_103015922 | 281 |
| 356 | 3300028380 | Ga0268265_10000004 | Ga0268265_10000004433 | 281 |
| 357 | 3300028381 | Ga0268264_10000024 | Ga0268264_10000024443 | 281 |
| 358 | 3300031728 | Ga0316578_10065817 | Ga0316578_100658172 | 281 |
| 359 | 3300046460 | Ga0495638_0000404 | Ga0495638_0000404_14824_15675 | 281 |
| 360 | 3300046524 | Ga0495648_0004183 | Ga0495648_0004183_9967_10836 | 281 |
| 361 | 3300046694 | Ga0495649_0135016 | Ga0495649_0135016_111_986 | 281 |
| 362 | 3300047469 | Ga0495673_0002291 | Ga0495673_0002291_10554_11423 | 281 |
| 363 | 3300048903 | Ga0496100_0001047 | Ga0496100_0001047_8724_9599 | 281 |
| 364 | 3300048904 | Ga0496101_0000102 | Ga0496101_0000102_2428_3279 | 281 |
| 365 | 3300048904 | Ga0496101_0000931 | Ga0496101_0000931_11885_12760 | 281 |
| 366 | 3300048904 | Ga0496101_0009266 | Ga0496101_0009266_3006_3857 | 281 |
| 367 | 3300048905 | Ga0496102_0000037 | Ga0496102_0000037_85526_86377 | 281 |
| 368 | 3300048905 | Ga0496102_0000256 | Ga0496102_0000256_17819_18670 | 281 |
| 369 | 3300048906 | Ga0496103_0000004 | Ga0496103_0000004_396238_397089 | 281 |
| 370 | 3300048906 | Ga0496103_0000989 | Ga0496103_0000989_2402_3253 | 281 |
| 371 | 3300048907 | Ga0496104_0002403 | Ga0496104_0002403_5718_6593 | 281 |
| 372 | 3300048908 | Ga0496105_0008381 | Ga0496105_0008381_4845_5720 | 281 |
| 373 | 3300048909 | Ga0496106_0001747 | Ga0496106_0001747_7251_8126 | 281 |
| 374 | 3300048909 | Ga0496106_0022182 | Ga0496106_0022182_1276_2127 | 281 |
| 375 | 3300048910 | Ga0496107_0012063 | Ga0496107_0012063_3781_4632 | 281 |
| 376 | 3300048910 | Ga0496107_0012623 | Ga0496107_0012623_2359_3234 | 281 |
| 377 | 3300048910 | Ga0496107_0090242 | Ga0496107_0090242_327_1178 | 281 |
| 378 | 3300048917 | Ga0496114_0008349 | Ga0496114_0008349_4728_5603 | 281 |
| 379 | 3300048918 | Ga0496115_0002353 | Ga0496115_0002353_5117_5992 | 281 |
| 380 | 3300048919 | Ga0496116_0000276 | Ga0496116_0000276_85500_86351 | 281 |
| 381 | 3300048919 | Ga0496116_0046987 | Ga0496116_0046987_1624_2475 | 281 |
| 382 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_1594641_1595492 | 281 |
| 383 | 3300048920 | Ga0496117_0006489 | Ga0496117_0006489_435_1286 | 281 |
| 384 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_1594644_1595495 | 281 |
| 385 | 3300048921 | Ga0496118_0000275 | Ga0496118_0000275_20486_21337 | 281 |
| 386 | 3300048922 | Ga0496119_0006561 | Ga0496119_0006561_7171_8022 | 281 |
| 387 | 3300048923 | Ga0496120_0025924 | Ga0496120_0025924_589_1440 | 281 |
| 388 | 3300048923 | Ga0496120_0044917 | Ga0496120_0044917_46_897 | 281 |
| 389 | 3300048923 | Ga0496120_0109896 | Ga0496120_0109896_199_1062 | 281 |
| 390 | 3300048924 | Ga0496121_0000338 | Ga0496121_0000338_94425_95276 | 281 |
| 391 | 3300048924 | Ga0496121_0001738 | Ga0496121_0001738_3608_4459 | 281 |
| 392 | 3300048927 | Ga0496124_0030038 | Ga0496124_0030038_1624_2475 | 281 |
| 393 | 3300048928 | Ga0496125_0008077 | Ga0496125_0008077_1379_2230 | 281 |
| 394 | 3300048929 | Ga0496126_0000551 | Ga0496126_0000551_68068_68919 | 281 |
| 395 | 3300048929 | Ga0496126_0010005 | Ga0496126_0010005_5198_6049 | 281 |
| 396 | 3300053079 | Ga0500610_0001927 | Ga0500610_0001927_1396_2271 | 281 |
| 397 | 3300053080 | Ga0500635_0003792 | Ga0500635_0003792_2370_3218 | 281 |
| 398 | 3300053104 | Ga0500556_0002820 | Ga0500556_0002820_3575_4426 | 281 |
| 399 | 3300053131 | Ga0500652_002710 | Ga0500652_002710_3572_4420 | 281 |
| 400 | 3300053153 | Ga0500616_0117672 | Ga0500616_0117672_371_1246 | 281 |
| 401 | 3300053158 | Ga0500627_0113044 | Ga0500627_0113044_354_1205 | 281 |
| 402 | 3300001977 | JGI24746J21847_1011268 | JGI24746J21847_10112682 | 282 |
| 403 | 3300002073 | JGI24745J21846_1009453 | JGI24745J21846_10094531 | 282 |
| 404 | 3300002073 | JGI24745J21846_1012054 | JGI24745J21846_10120541 | 282 |
| 405 | 3300002076 | JGI24749J21850_1001809 | JGI24749J21850_10018092 | 282 |
| 406 | 3300002077 | JGI24744J21845_10010692 | JGI24744J21845_100106922 | 282 |
| 407 | 3300002239 | JGI24034J26672_10012582 | JGI24034J26672_100125822 | 282 |
| 408 | 3300005328 | Ga0070676_10019431 | Ga0070676_100194313 | 282 |
| 409 | 3300005329 | Ga0070683_100092309 | Ga0070683_1000923093 | 282 |
| 410 | 3300005329 | Ga0070683_100211327 | Ga0070683_1002113272 | 282 |
| 411 | 3300005330 | Ga0070690_100034010 | Ga0070690_1000340102 | 282 |
| 412 | 3300005331 | Ga0070670_100092554 | Ga0070670_1000925542 | 282 |
| 413 | 3300005334 | Ga0068869_100044162 | Ga0068869_1000441622 | 282 |
| 414 | 3300005337 | Ga0070682_100012745 | Ga0070682_1000127454 | 282 |
| 415 | 3300005337 | Ga0070682_100020030 | Ga0070682_1000200303 | 282 |
| 416 | 3300005338 | Ga0068868_100012095 | Ga0068868_1000120957 | 282 |
| 417 | 3300005339 | Ga0070660_100053721 | Ga0070660_1000537213 | 282 |
| 418 | 3300005340 | Ga0070689_100178783 | Ga0070689_1001787831 | 282 |
| 419 | 3300005340 | Ga0070689_100444973 | Ga0070689_1004449731 | 282 |
| 420 | 3300005347 | Ga0070668_100027824 | Ga0070668_1000278244 | 282 |
| 421 | 3300005355 | Ga0070671_100006018 | Ga0070671_1000060187 | 282 |
| 422 | 3300005355 | Ga0070671_100069793 | Ga0070671_1000697933 | 282 |
| 423 | 3300005356 | Ga0070674_100006799 | Ga0070674_1000067992 | 282 |
| 424 | 3300005356 | Ga0070674_100065972 | Ga0070674_1000659722 | 282 |
| 425 | 3300005365 | Ga0070688_100014710 | Ga0070688_1000147103 | 282 |
| 426 | 3300005366 | Ga0070659_100063391 | Ga0070659_1000633912 | 282 |
| 427 | 3300005366 | Ga0070659_100164909 | Ga0070659_1001649093 | 282 |
| 428 | 3300005367 | Ga0070667_100003100 | Ga0070667_1000031002 | 282 |
| 429 | 3300005367 | Ga0070667_100015262 | Ga0070667_1000152622 | 282 |
| 430 | 3300005367 | Ga0070667_100084670 | Ga0070667_1000846702 | 282 |
| 431 | 3300005367 | Ga0070667_100140469 | Ga0070667_1001404691 | 282 |
| 432 | 3300005367 | Ga0070667_100529738 | Ga0070667_1005297381 | 282 |
| 433 | 3300005434 | Ga0070709_10120023 | Ga0070709_101200231 | 282 |
| 434 | 3300005435 | Ga0070714_100251271 | Ga0070714_1002512712 | 282 |
| 435 | 3300005435 | Ga0070714_100252258 | Ga0070714_1002522582 | 282 |
| 436 | 3300005437 | Ga0070710_10017522 | Ga0070710_100175224 | 282 |
| 437 | 3300005438 | Ga0070701_10007431 | Ga0070701_100074314 | 282 |
| 438 | 3300005439 | Ga0070711_100000375 | Ga0070711_10000037519 | 282 |
| 439 | 3300005439 | Ga0070711_100027419 | Ga0070711_1000274194 | 282 |
| 440 | 3300005440 | Ga0070705_100061875 | Ga0070705_1000618752 | 282 |
| 441 | 3300005440 | Ga0070705_100079824 | Ga0070705_1000798241 | 282 |
| 442 | 3300005441 | Ga0070700_100093028 | Ga0070700_1000930282 | 282 |
| 443 | 3300005455 | Ga0070663_100028665 | Ga0070663_1000286653 | 282 |
| 444 | 3300005456 | Ga0070678_100001259 | Ga0070678_10000125913 | 282 |
| 445 | 3300005456 | Ga0070678_100117161 | Ga0070678_1001171612 | 282 |
| 446 | 3300005457 | Ga0070662_100015363 | Ga0070662_1000153632 | 282 |
| 447 | 3300005535 | Ga0070684_100108762 | Ga0070684_1001087621 | 282 |
| 448 | 3300005539 | Ga0068853_100059908 | Ga0068853_1000599083 | 282 |
| 449 | 3300005543 | Ga0070672_100085529 | Ga0070672_1000855292 | 282 |
| 450 | 3300005544 | Ga0070686_100228465 | Ga0070686_1002284652 | 282 |
| 451 | 3300005546 | Ga0070696_100001702 | Ga0070696_1000017022 | 282 |
| 452 | 3300005546 | Ga0070696_100033682 | Ga0070696_1000336824 | 282 |
| 453 | 3300005548 | Ga0070665_100018284 | Ga0070665_1000182842 | 282 |
| 454 | 3300005548 | Ga0070665_100050045 | Ga0070665_1000500452 | 282 |
| 455 | 3300005548 | Ga0070665_100141304 | Ga0070665_1001413042 | 282 |
| 456 | 3300005549 | Ga0070704_100001435 | Ga0070704_1000014352 | 282 |
| 457 | 3300005563 | Ga0068855_100038774 | Ga0068855_1000387745 | 282 |
| 458 | 3300005578 | Ga0068854_100003064 | Ga0068854_1000030642 | 282 |
| 459 | 3300005615 | Ga0070702_100032358 | Ga0070702_1000323582 | 282 |
| 460 | 3300005615 | Ga0070702_100077581 | Ga0070702_1000775812 | 282 |
| 461 | 3300005616 | Ga0068852_100089668 | Ga0068852_1000896682 | 282 |
| 462 | 3300005617 | Ga0068859_100008118 | Ga0068859_10000811811 | 282 |
| 463 | 3300005618 | Ga0068864_100065747 | Ga0068864_1000657472 | 282 |
| 464 | 3300005618 | Ga0068864_100094936 | Ga0068864_1000949362 | 282 |
| 465 | 3300005718 | Ga0068866_10000812 | Ga0068866_1000081213 | 282 |
| 466 | 3300005718 | Ga0068866_10035513 | Ga0068866_100355132 | 282 |
| 467 | 3300005719 | Ga0068861_100009768 | Ga0068861_1000097682 | 282 |
| 468 | 3300005841 | Ga0068863_100011377 | Ga0068863_1000113776 | 282 |
| 469 | 3300005841 | Ga0068863_100060458 | Ga0068863_1000604583 | 282 |
| 470 | 3300005842 | Ga0068858_100001306 | Ga0068858_10000130621 | 282 |
| 471 | 3300005843 | Ga0068860_100235614 | Ga0068860_1002356141 | 282 |
| 472 | 3300006038 | Ga0075365_10015167 | Ga0075365_100151672 | 282 |
| 473 | 3300006038 | Ga0075365_10160424 | Ga0075365_101604242 | 282 |
| 474 | 3300006048 | Ga0075363_100003126 | Ga0075363_1000031266 | 282 |
| 475 | 3300006048 | Ga0075363_100014059 | Ga0075363_1000140592 | 282 |
| 476 | 3300006048 | Ga0075363_100014862 | Ga0075363_1000148623 | 282 |
| 477 | 3300006048 | Ga0075363_100095625 | Ga0075363_1000956252 | 282 |
| 478 | 3300006051 | Ga0075364_10001383 | Ga0075364_100013832 | 282 |
| 479 | 3300006051 | Ga0075364_10006919 | Ga0075364_100069197 | 282 |
| 480 | 3300006051 | Ga0075364_10013609 | Ga0075364_100136094 | 282 |
| 481 | 3300006051 | Ga0075364_10094436 | Ga0075364_100944362 | 282 |
| 482 | 3300006051 | Ga0075364_10118586 | Ga0075364_101185862 | 282 |
| 483 | 3300006163 | Ga0070715_10001286 | Ga0070715_100012862 | 282 |
| 484 | 3300006163 | Ga0070715_10070106 | Ga0070715_100701062 | 282 |
| 485 | 3300006173 | Ga0070716_100003259 | Ga0070716_1000032599 | 282 |
| 486 | 3300006173 | Ga0070716_100388212 | Ga0070716_1003882121 | 282 |
| 487 | 3300006175 | Ga0070712_100008493 | Ga0070712_1000084932 | 282 |
| 488 | 3300006175 | Ga0070712_100064828 | Ga0070712_1000648282 | 282 |
| 489 | 3300006177 | Ga0075362_10010964 | Ga0075362_100109642 | 282 |
| 490 | 3300006177 | Ga0075362_10042022 | Ga0075362_100420222 | 282 |
| 491 | 3300006178 | Ga0075367_10008062 | Ga0075367_100080625 | 282 |
| 492 | 3300006178 | Ga0075367_10255738 | Ga0075367_102557381 | 282 |
| 493 | 3300006186 | Ga0075369_10002341 | Ga0075369_100023412 | 282 |
| 494 | 3300006186 | Ga0075369_10101291 | Ga0075369_101012912 | 282 |
| 495 | 3300006195 | Ga0075366_10070125 | Ga0075366_100701252 | 282 |
| 496 | 3300006237 | Ga0097621_100149369 | Ga0097621_1001493692 | 282 |
| 497 | 3300006237 | Ga0097621_100208351 | Ga0097621_1002083512 | 282 |
| 498 | 3300006353 | Ga0075370_10012324 | Ga0075370_100123243 | 282 |
| 499 | 3300006353 | Ga0075370_10018620 | Ga0075370_100186202 | 282 |
| 500 | 3300006353 | Ga0075370_10019367 | Ga0075370_100193672 | 282 |
| 501 | 3300006353 | Ga0075370_10030301 | Ga0075370_100303012 | 282 |
| 502 | 3300006353 | Ga0075370_10063273 | Ga0075370_100632732 | 282 |
| 503 | 3300006353 | Ga0075370_10071213 | Ga0075370_100712132 | 282 |
| 504 | 3300006844 | Ga0075428_100004253 | Ga0075428_10000425313 | 282 |
| 505 | 3300006881 | Ga0068865_100167486 | Ga0068865_1001674862 | 282 |
| 506 | 3300006931 | Ga0097620_100008118 | Ga0097620_10000811811 | 282 |
| 507 | 3300009551 | Ga0105238_10252130 | Ga0105238_102521302 | 282 |
| 508 | 3300010375 | Ga0105239_10198895 | Ga0105239_101988952 | 282 |
| 509 | 3300011119 | Ga0105246_10198502 | Ga0105246_101985023 | 282 |
| 510 | 3300013102 | Ga0157371_10159628 | Ga0157371_101596282 | 282 |
| 511 | 3300013105 | Ga0157369_10435238 | Ga0157369_104352382 | 282 |
| 512 | 3300013308 | Ga0157375_10228333 | Ga0157375_102283332 | 282 |
| 513 | 3300014745 | Ga0157377_10015647 | Ga0157377_100156472 | 282 |
| 514 | 3300014968 | Ga0157379_10309819 | Ga0157379_103098192 | 282 |
| 515 | 3300017792 | Ga0163161_10003257 | Ga0163161_100032572 | 282 |
| 516 | 3300017792 | Ga0163161_10173713 | Ga0163161_101737132 | 282 |
| 517 | 3300021384 | Ga0213876_10003552 | Ga0213876_100035528 | 282 |
| 518 | 3300021384 | Ga0213876_10018948 | Ga0213876_100189482 | 282 |
| 519 | 3300025885 | Ga0207653_10002968 | Ga0207653_100029681 | 282 |
| 520 | 3300025898 | Ga0207692_10003952 | Ga0207692_100039526 | 282 |
| 521 | 3300025898 | Ga0207692_10026397 | Ga0207692_100263973 | 282 |
| 522 | 3300025899 | Ga0207642_10000117 | Ga0207642_100001175 | 282 |
| 523 | 3300025901 | Ga0207688_10005173 | Ga0207688_100051731 | 282 |
| 524 | 3300025901 | Ga0207688_10007002 | Ga0207688_100070025 | 282 |
| 525 | 3300025904 | Ga0207647_10044118 | Ga0207647_100441182 | 282 |
| 526 | 3300025904 | Ga0207647_10122375 | Ga0207647_101223752 | 282 |
| 527 | 3300025905 | Ga0207685_10049609 | Ga0207685_100496092 | 282 |
| 528 | 3300025905 | Ga0207685_10089453 | Ga0207685_100894532 | 282 |
| 529 | 3300025908 | Ga0207643_10203479 | Ga0207643_102034792 | 282 |
| 530 | 3300025915 | Ga0207693_10000930 | Ga0207693_1000093022 | 282 |
| 531 | 3300025915 | Ga0207693_10001479 | Ga0207693_100014792 | 282 |
| 532 | 3300025916 | Ga0207663_10002583 | Ga0207663_100025834 | 282 |
| 533 | 3300025916 | Ga0207663_10073617 | Ga0207663_100736173 | 282 |
| 534 | 3300025923 | Ga0207681_10027533 | Ga0207681_100275332 | 282 |
| 535 | 3300025924 | Ga0207694_10366477 | Ga0207694_103664771 | 282 |
| 536 | 3300025925 | Ga0207650_10105386 | Ga0207650_101053861 | 282 |
| 537 | 3300025927 | Ga0207687_10001341 | Ga0207687_1000134112 | 282 |
| 538 | 3300025929 | Ga0207664_10104274 | Ga0207664_101042742 | 282 |
| 539 | 3300025932 | Ga0207690_10018077 | Ga0207690_100180774 | 282 |
| 540 | 3300025932 | Ga0207690_10033766 | Ga0207690_100337662 | 282 |
| 541 | 3300025933 | Ga0207706_10010030 | Ga0207706_100100308 | 282 |
| 542 | 3300025933 | Ga0207706_10143832 | Ga0207706_101438321 | 282 |
| 543 | 3300025935 | Ga0207709_10021840 | Ga0207709_100218402 | 282 |
| 544 | 3300025935 | Ga0207709_10064292 | Ga0207709_100642922 | 282 |
| 545 | 3300025936 | Ga0207670_10137047 | Ga0207670_101370472 | 282 |
| 546 | 3300025936 | Ga0207670_10166116 | Ga0207670_101661162 | 282 |
| 547 | 3300025937 | Ga0207669_10000297 | Ga0207669_100002977 | 282 |
| 548 | 3300025938 | Ga0207704_10007363 | Ga0207704_100073633 | 282 |
| 549 | 3300025938 | Ga0207704_10023526 | Ga0207704_100235263 | 282 |
| 550 | 3300025939 | Ga0207665_10008653 | Ga0207665_100086535 | 282 |
| 551 | 3300025939 | Ga0207665_10290570 | Ga0207665_102905702 | 282 |
| 552 | 3300025940 | Ga0207691_10061917 | Ga0207691_100619173 | 282 |
| 553 | 3300025941 | Ga0207711_10362162 | Ga0207711_103621622 | 282 |
| 554 | 3300025942 | Ga0207689_10032281 | Ga0207689_100322813 | 282 |
| 555 | 3300025944 | Ga0207661_10167397 | Ga0207661_101673972 | 282 |
| 556 | 3300025945 | Ga0207679_10331582 | Ga0207679_103315822 | 282 |
| 557 | 3300025949 | Ga0207667_10051635 | Ga0207667_100516353 | 282 |
| 558 | 3300025960 | Ga0207651_10058995 | Ga0207651_100589951 | 282 |
| 559 | 3300025961 | Ga0207712_10008422 | Ga0207712_100084224 | 282 |
| 560 | 3300025961 | Ga0207712_10011195 | Ga0207712_100111952 | 282 |
| 561 | 3300025961 | Ga0207712_10383786 | Ga0207712_103837862 | 282 |
| 562 | 3300025972 | Ga0207668_10029134 | Ga0207668_100291343 | 282 |
| 563 | 3300025972 | Ga0207668_10104725 | Ga0207668_101047251 | 282 |
| 564 | 3300025972 | Ga0207668_10320497 | Ga0207668_103204971 | 282 |
| 565 | 3300025981 | Ga0207640_10026973 | Ga0207640_100269732 | 282 |
| 566 | 3300025986 | Ga0207658_10004009 | Ga0207658_100040098 | 282 |
| 567 | 3300025986 | Ga0207658_10015254 | Ga0207658_100152544 | 282 |
| 568 | 3300025986 | Ga0207658_10110492 | Ga0207658_101104922 | 282 |
| 569 | 3300026023 | Ga0207677_10002994 | Ga0207677_100029943 | 282 |
| 570 | 3300026035 | Ga0207703_10001189 | Ga0207703_1000118922 | 282 |
| 571 | 3300026067 | Ga0207678_10013971 | Ga0207678_100139719 | 282 |
| 572 | 3300026067 | Ga0207678_10061884 | Ga0207678_100618842 | 282 |
| 573 | 3300026075 | Ga0207708_10031691 | Ga0207708_100316912 | 282 |
| 574 | 3300026078 | Ga0207702_10202743 | Ga0207702_102027432 | 282 |
| 575 | 3300026088 | Ga0207641_10034263 | Ga0207641_100342632 | 282 |
| 576 | 3300026088 | Ga0207641_10133498 | Ga0207641_101334982 | 282 |
| 577 | 3300026089 | Ga0207648_10001361 | Ga0207648_100013614 | 282 |
| 578 | 3300026089 | Ga0207648_10046867 | Ga0207648_100468673 | 282 |
| 579 | 3300026095 | Ga0207676_10048723 | Ga0207676_100487232 | 282 |
| 580 | 3300026095 | Ga0207676_10125993 | Ga0207676_101259932 | 282 |
| 581 | 3300026095 | Ga0207676_10356650 | Ga0207676_103566502 | 282 |
| 582 | 3300026118 | Ga0207675_100003845 | Ga0207675_10000384513 | 282 |
| 583 | 3300026121 | Ga0207683_10002759 | Ga0207683_100027592 | 282 |
| 584 | 3300026121 | Ga0207683_10005268 | Ga0207683_1000526812 | 282 |
| 585 | 3300027907 | Ga0207428_10269006 | Ga0207428_102690061 | 282 |
| 586 | 3300028379 | Ga0268266_10004748 | Ga0268266_100047487 | 282 |
| 587 | 3300028379 | Ga0268266_10074922 | Ga0268266_100749222 | 282 |
| 588 | 3300028379 | Ga0268266_10082710 | Ga0268266_100827102 | 282 |
| 589 | 3300028380 | Ga0268265_10046780 | Ga0268265_100467802 | 282 |
| 590 | 3300028380 | Ga0268265_10549158 | Ga0268265_105491582 | 282 |
| 591 | 3300028381 | Ga0268264_10004434 | Ga0268264_100044342 | 282 |
| 592 | 3300028381 | Ga0268264_10180557 | Ga0268264_101805572 | 282 |
| 593 | 3300031824 | Ga0307413_10030289 | Ga0307413_100302892 | 282 |
| 594 | 3300031903 | Ga0307407_10117839 | Ga0307407_101178392 | 282 |
| 595 | 3300031995 | Ga0307409_100032573 | Ga0307409_1000325731 | 282 |
| 596 | 3300031995 | Ga0307409_100331609 | Ga0307409_1003316092 | 282 |
| 597 | 3300032002 | Ga0307416_100792870 | Ga0307416_1007928701 | 282 |
| 598 | 3300032005 | Ga0307411_10177701 | Ga0307411_101777012 | 282 |
| 599 | 3300032126 | Ga0307415_100149364 | Ga0307415_1001493642 | 282 |
| 600 | 3300035725 | Ga0373947_0097832 | Ga0373947_0097832_677_1531 | 282 |
| 601 | 3300039450 | Ga0436363_0789807 | Ga0436363_0789807_5794_6657 | 282 |
| 602 | 3300044842 | Ga0466957_0028501 | Ga0466957_0028501_287_1144 | 282 |
| 603 | 3300044901 | Ga0466960_0000905 | Ga0466960_0000905_2188_3045 | 282 |
| 604 | 3300046455 | Ga0495603_0035321 | Ga0495603_0035321_1255_2109 | 282 |
| 605 | 3300048903 | Ga0496100_0040440 | Ga0496100_0040440_1363_2217 | 282 |
| 606 | 3300048905 | Ga0496102_0045412 | Ga0496102_0045412_1255_2178 | 282 |
| 607 | 3300048912 | Ga0496109_0001781 | Ga0496109_0001781_2524_3372 | 282 |
| 608 | 3300048915 | Ga0496112_0133510 | Ga0496112_0133510_1301_2167 | 282 |
| 609 | 3300048915 | Ga0496112_0169588 | Ga0496112_0169588_67_915 | 282 |
| 610 | 3300048916 | Ga0496113_0077218 | Ga0496113_0077218_1238_2092 | 282 |
| 611 | 3300049569 | Ga0501032_0009164 | Ga0501032_0009164_2138_3004 | 282 |
| 612 | 3300049572 | Ga0501036_0015314 | Ga0501036_0015314_3570_4436 | 282 |
| 613 | 3300049573 | Ga0501037_0000663 | Ga0501037_0000663_25410_26276 | 282 |
| 614 | 3300049574 | Ga0501038_0004859 | Ga0501038_0004859_5323_6189 | 282 |
| 615 | 3300049583 | Ga0501067_0091701 | Ga0501067_0091701_204_1070 | 282 |
| 616 | 3300049586 | Ga0501070_0000944 | Ga0501070_0000944_1969_2835 | 282 |
| 617 | 3300049823 | Ga0501044_0002237 | Ga0501044_0002237_20869_21735 | 282 |
| 618 | 3300050490 | nmdc:mga03n38_40200_c1 | nmdc:mga03n38_40200_c1_789_1667 | 282 |
| 619 | 3300050490 | nmdc:mga03n38_58591_c1 | nmdc:mga03n38_58591_c1_767_1645 | 282 |
| 620 | 3300050491 | nmdc:mga00v17_7327_c1 | nmdc:mga00v17_7327_c1_3862_4740 | 282 |
| 621 | 3300050496 | nmdc:mga07m45_13765_c1 | nmdc:mga07m45_13765_c1_3009_3887 | 282 |
| 622 | 3300050496 | nmdc:mga07m45_35234_c1 | nmdc:mga07m45_35234_c1_251_1108 | 282 |
| 623 | 3300050516 | nmdc:mga0sz30_13696_c1 | nmdc:mga0sz30_13696_c1_206_1063 | 282 |
| 624 | 3300050516 | nmdc:mga0sz30_32403_c1 | nmdc:mga0sz30_32403_c1_1040_1894 | 282 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gpj-assembly1.cif.gz_A | crystal structure of a siderophore-interacting protein (sputcn32_0076) from shewanella putrefaciens cn-32 at 2.20 a resolution | 0.8901 | 5 | 280 |
| 2gpj-assembly1.cif.gz_A | crystal structure of a siderophore-interacting protein (sputcn32_0076) from shewanella putrefaciens cn-32 at 2.20 a resolution | 0.8799 | 5 | 280 |
| 7xlz-assembly1.cif.gz_A | structure of siderophore-interacting protein from vibrio anguillarum | 0.8731 | 6 | 277 |
| 6k2l-assembly1.cif.gz_B | crystal structure of the siderophore-interacting protein sips from aeromonas hydrophila | 0.8717 | 4 | 259 |
| 6k2l-assembly1.cif.gz_A | crystal structure of the siderophore-interacting protein sips from aeromonas hydrophila | 0.8708 | 4 | 277 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WL31_2_128_2.40.30.10 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9735 | 2 | 128 | 2.40.30.10 |
| af_P9WL31_2_128_2.40.30.10 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.966 | 2 | 128 | 2.40.30.10 |
| af_P9WL31_130_283_3.40.50.80 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module | 0.92 | 130 | 281 | 3.40.50.80 |
| af_P9WL31_130_283_3.40.50.80 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module | 0.903 | 130 | 281 | 3.40.50.80 |
| 2gpjA01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.8724 | 5 | 127 | 2.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1A3CD11-F1-model_v4 | NADPH-dependent ferric siderophore reductase | 0.969 | 1 | 193 |
GO:0016491
|
| AF-A0A1A3CD11-F1-model_v4 | NADPH-dependent ferric siderophore reductase | 0.9641 | 1 | 193 |
GO:0016491
|
| AF-E6TGH7-F1-model_v4 | Siderophore-interacting protein | 0.9628 | 1 | 280 |
GO:0016491
|
| AF-A0A652YI41-F1-model_v4 | NADPH-dependent ferric siderophore reductase | 0.9597 | 4 | 279 |
GO:0016491
|
| AF-A0A2S9FNF2-F1-model_v4 | NADPH-dependent ferric siderophore reductase | 0.9593 | 122 | 246 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar