F470283

General Info

Members Datasets Scaffolds Average Seq Length
624 386 548 284

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_10077977|Ga0268265_100779772
Length 322
Sequence MAGSTPASATGDAEAGTAAVRPPQLDQGARGVVGLAAHRTAEMAGAPIGLVGRRGVSPWAEAWRRFKRHKLAVASLFVLALMXXAVLLGPTIWKVAINEIDFTARLKPPSFAHPFGTDDLGQDILARMLYGGRISLARGGVDAALMWLTDLFLSLPQLPLLLLIIYLFRDTLKTTFGPEVGVFLLIVAVIGLFRWMPVARLVRAQFFSLREKEFVEAARALGASTSRQVVRHILPNALGPVIVAGTIDVAAAIIAESTLSFLGLGFPPDIPTWGRLLFDAKDHMDIAAHWALFPGAAIFFTVLTINFIGDGLRDALDPRRVL

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
3 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
6 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
9 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
10 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
11 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
12 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
13 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
14 2643221733 Bosea sp. Root381 Isolate Unclassified
15 2643221734 Bosea sp. Root670 Isolate Unclassified
16 2643221736 Bosea sp. Root483D1 Isolate Unclassified
17 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
18 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
19 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
20 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
21 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
22 2818991467 Bosea vestrisii 3192 Isolate Unclassified
23 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
24 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
25 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
26 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
27 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
28 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
29 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
30 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
31 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
32 2841760612 Bosea sp. Tri-49 Isolate Nodule
33 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
34 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
35 2844104063 Bosea sp. Tri-39 Isolate Nodule
36 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
37 2851182111 Bosea sp. Tri-44 Isolate Nodule
38 2851246043 Bosea sp. Tri-54 Isolate Nodule
39 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
40 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
41 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
42 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
43 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
44 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
45 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
46 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
47 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
48 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
49 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
50 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
51 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
52 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
53 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
54 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
55 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
56 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
57 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
58 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
59 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
60 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
61 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
62 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
63 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
64 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
65 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
66 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
68 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
69 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
70 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
71 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
72 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
73 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
74 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
75 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
76 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
77 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
78 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
79 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
80 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
81 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
82 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
83 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
84 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
85 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
86 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
87 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
88 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
89 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
90 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
91 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
92 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
93 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
94 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
95 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
96 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
97 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
98 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
99 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
100 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
101 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
102 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
103 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
104 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
105 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
106 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
107 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
108 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
109 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
110 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
111 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
112 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
113 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
114 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
115 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
116 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
117 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
118 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
119 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
120 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
121 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
122 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
123 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
124 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
125 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
126 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
127 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
128 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
129 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
130 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
131 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
132 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
133 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
134 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
136 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
137 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
138 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
139 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
140 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
141 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
142 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
144 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
145 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
146 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
149 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
150 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
151 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
152 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
153 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
154 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
163 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
164 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
165 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
170 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
171 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
173 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
230 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
231 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
237 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
238 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
239 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
240 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
241 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
242 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
243 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
244 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
245 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
246 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
247 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
248 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
249 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
250 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
251 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
252 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
253 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
256 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
257 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
258 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
259 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
262 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
263 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
264 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
265 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
266 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
267 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
268 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
269 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
270 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
271 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
272 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
273 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
274 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
275 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
276 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
278 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
279 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
280 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
281 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
282 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
283 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
284 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
285 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
286 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
287 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
288 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
289 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
290 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
291 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
292 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
293 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
294 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
295 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
296 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
297 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
298 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
299 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
300 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
301 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
309 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
312 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
313 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
314 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
317 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
318 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
319 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
320 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
321 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
322 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
330 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
331 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
332 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
335 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
350 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
360 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
364 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
365 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
366 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
367 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
368 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
369 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
370 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
371 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
372 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
373 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
374 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
375 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
376 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
377 641522639 Methylobacterium sp. 4-46 Isolate Nodule
378 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
379 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
380 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
381 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
382 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
383 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
384 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
385 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
386 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.1
Metatranscriptomes 0
Isolates 11.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.01
Nodule 8.01
Rhizoplane 2.56
Rhizosphere 77.88
Stem 0
Stem Tuber 0
Unclassified 7.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000015 3300003187 Bacteria 250420
2 JGI25406J46586_10001538 3300003203 Bacteria 10890
3 Ga0055535_1000125 3300003761 Bacteria 81678
4 Ga0055529_1000266 3300003763 Bacteria 62097
5 Ga0055526_1002615 3300003771 Bacteria 12033
6 Ga0055526_1004093 3300003771 Bacteria 8909
7 Ga0055524_1000051 3300003775 Bacteria 146215
8 Ga0055524_1027579 3300003775 Bacteria 1720
9 Ga0065165_1000014 3300005262 Bacteria 292366
10 Ga0065712_10015931 3300005290 Bacteria 2106
11 Ga0070658_10006666 3300005327 Bacteria 9357
12 Ga0070658_10007485 3300005327 Bacteria 8810
13 Ga0070658_10111994 3300005327 Bacteria 2262
14 Ga0070676_10026886 3300005328 Bacteria 3258
15 Ga0070683_100043839 3300005329 Bacteria 4123
16 Ga0070683_100230178 3300005329 Bacteria 1762
17 Ga0070683_100607939 3300005329 Bacteria 1046
18 Ga0070690_100019065 3300005330 Bacteria 4156
19 Ga0070670_100000757 3300005331 Bacteria 25060
20 Ga0070670_100006587 3300005331 Bacteria 9843
21 Ga0070670_100051866 3300005331 Bacteria 3522
22 Ga0070670_100188471 3300005331 Bacteria 1791
23 Ga0070670_100252458 3300005331 Bacteria 1537
24 Ga0070670_100276930 3300005331 Bacteria 1465
25 Ga0070677_10002073 3300005333 Bacteria 6389
26 Ga0070666_10003353 3300005335 Bacteria 9714
27 Ga0070680_100009124 3300005336 Bacteria 7607
28 Ga0070680_100011564 3300005336 Bacteria 6833
29 Ga0068868_100001471 3300005338 Bacteria 16271
30 Ga0070660_100012301 3300005339 Bacteria 6107
31 Ga0070660_100107010 3300005339 Bacteria 2222
32 Ga0070661_100222352 3300005344 Bacteria 1449
33 Ga0070668_100033710 3300005347 Bacteria 3901
34 Ga0070668_100071699 3300005347 Bacteria 2699
35 Ga0070669_100046884 3300005353 Bacteria 3152
36 Ga0070669_100094316 3300005353 Bacteria 2249
37 Ga0070675_100000817 3300005354 Bacteria 21947
38 Ga0070675_100004170 3300005354 Bacteria 10975
39 Ga0070675_100007385 3300005354 Bacteria 8488
40 Ga0070675_100075083 3300005354 Bacteria 2809
41 Ga0070675_100095804 3300005354 Bacteria 2492
42 Ga0070675_100132682 3300005354 Bacteria 2123
43 Ga0070671_100000285 3300005355 Bacteria 34428
44 Ga0070671_100019127 3300005355 Bacteria 5571
45 Ga0070671_100076387 3300005355 Bacteria 2798
46 Ga0070671_100237676 3300005355 Bacteria 1546
47 Ga0070674_100002835 3300005356 Bacteria 9582
48 Ga0070674_100317626 3300005356 Bacteria 1248
49 Ga0070673_100043247 3300005364 Bacteria 3479
50 Ga0070673_100069351 3300005364 Bacteria 2825
51 Ga0070673_100131783 3300005364 Bacteria 2098
52 Ga0070659_100432940 3300005366 Bacteria 1113
53 Ga0070667_100002131 3300005367 Bacteria 17457
54 Ga0070667_100016645 3300005367 Bacteria 6085
55 Ga0070667_100072899 3300005367 Bacteria 2927
56 Ga0070714_100016146 3300005435 Bacteria 6023
57 Ga0070714_100089254 3300005435 Bacteria 2698
58 Ga0070713_100061563 3300005436 Bacteria 3140
59 Ga0070713_100083082 3300005436 Bacteria 2737
60 Ga0070710_10008027 3300005437 Bacteria 5131
61 Ga0070711_100026370 3300005439 Bacteria 3808
62 Ga0070700_100270760 3300005441 Bacteria 1227
63 Ga0070708_100138448 3300005445 Bacteria 2256
64 Ga0070708_100314990 3300005445 Bacteria 1474
65 Ga0070663_100036099 3300005455 Bacteria 3433
66 Ga0070678_100001849 3300005456 Bacteria 11408
67 Ga0070678_100011698 3300005456 Bacteria 5426
68 Ga0070678_100076876 3300005456 Bacteria 2516
69 Ga0070678_100121908 3300005456 Bacteria 2057
70 Ga0070678_100206576 3300005456 Bacteria 1624
71 Ga0070662_100017341 3300005457 Bacteria 4854
72 Ga0070662_100278217 3300005457 Bacteria 1354
73 Ga0070681_10002841 3300005458 Bacteria 16008
74 Ga0070681_10041436 3300005458 Bacteria 4615
75 Ga0068867_100010057 3300005459 Bacteria 6666
76 Ga0068867_100146410 3300005459 Bacteria 1852
77 Ga0068867_100178978 3300005459 Bacteria 1685
78 Ga0070706_100025976 3300005467 Bacteria 5389
79 Ga0070706_100032002 3300005467 Bacteria 4850
80 Ga0070706_100241516 3300005467 Bacteria 1686
81 Ga0070707_100002379 3300005468 Bacteria 17956
82 Ga0070698_100008329 3300005471 Bacteria 11206
83 Ga0070699_100267726 3300005518 Bacteria 1529
84 Ga0070679_100013328 3300005530 Bacteria 7872
85 Ga0070679_100042738 3300005530 Bacteria 4514
86 Ga0070697_100092399 3300005536 Bacteria 2504
87 Ga0068853_100028368 3300005539 Bacteria 4708
88 Ga0068853_100297676 3300005539 Bacteria 1490
89 Ga0070672_100009725 3300005543 Bacteria 6640
90 Ga0070672_100014255 3300005543 Bacteria 5629
91 Ga0070672_100159752 3300005543 Bacteria 1869
92 Ga0070672_100242730 3300005543 Bacteria 1515
93 Ga0070695_100056862 3300005545 Bacteria 2526
94 Ga0070696_100064639 3300005546 Bacteria 2564
95 Ga0070693_100028772 3300005547 Bacteria 3024
96 Ga0070665_100024707 3300005548 Bacteria 6054
97 Ga0070665_100201777 3300005548 Bacteria 1989
98 Ga0068855_100012231 3300005563 Bacteria 10373
99 Ga0070664_100134690 3300005564 Bacteria 2171
100 Ga0070664_100138193 3300005564 Bacteria 2144
101 Ga0070664_100156521 3300005564 Bacteria 2014
102 Ga0068857_100020969 3300005577 Bacteria 5750
103 Ga0068854_100224524 3300005578 Bacteria 1488
104 Ga0068856_100154080 3300005614 Bacteria 2308
105 Ga0068856_100186105 3300005614 Bacteria 2090
106 Ga0068856_100462279 3300005614 Bacteria 1290
107 Ga0070702_100061441 3300005615 Bacteria 2188
108 Ga0068852_100245630 3300005616 Bacteria 1713
109 Ga0068859_100026986 3300005617 Bacteria 5761
110 Ga0068859_100050451 3300005617 Bacteria 4180
111 Ga0068859_100235456 3300005617 Bacteria 1919
112 Ga0068864_100001465 3300005618 Bacteria 19452
113 Ga0068864_100014494 3300005618 Bacteria 6547
114 Ga0068864_100035977 3300005618 Bacteria 4218
115 Ga0068864_100051817 3300005618 Bacteria 3536
116 Ga0068864_100198788 3300005618 Bacteria 1840
117 Ga0068861_100012878 3300005719 Bacteria 5839
118 Ga0068861_100030764 3300005719 Bacteria 3936
119 Ga0068861_100136528 3300005719 Bacteria 1996
120 Ga0068851_10039036 3300005834 Bacteria 2384
121 Ga0068863_100026019 3300005841 Bacteria 5583
122 Ga0068863_100204022 3300005841 Bacteria 1902
123 Ga0068863_100261103 3300005841 Bacteria 1674
124 Ga0068863_100389571 3300005841 Bacteria 1361
125 Ga0068858_100001383 3300005842 Bacteria 25002
126 Ga0068860_100000590 3300005843 Bacteria 43453
127 Ga0068862_100032721 3300005844 Bacteria 4393
128 Ga0068862_100235069 3300005844 Bacteria 1664
129 Ga0081455_10000370 3300005937 Bacteria 59432
130 Ga0081455_10008796 3300005937 Bacteria 10452
131 Ga0081455_10083343 3300005937 Bacteria 2613
132 Ga0081539_10003824 3300005985 Bacteria 17697
133 Ga0081539_10030355 3300005985 Bacteria 3357
134 Ga0070717_10046109 3300006028 Bacteria 3565
135 Ga0070712_100209611 3300006175 Bacteria 1536
136 Ga0097621_100069169 3300006237 Bacteria 2914
137 Ga0097621_100142282 3300006237 Bacteria 2050
138 Ga0068871_100073525 3300006358 Bacteria 2818
139 Ga0068871_100213809 3300006358 Bacteria 1668
140 Ga0075428_100068071 3300006844 Bacteria 3896
141 Ga0075431_100031310 3300006847 Bacteria 5479
142 Ga0075433_10004040 3300006852 Bacteria 11353
143 Ga0075433_10008607 3300006852 Bacteria 8141
144 Ga0075434_100017089 3300006871 Bacteria 6982
145 Ga0075429_100033217 3300006880 Bacteria 4483
146 Ga0068865_100023491 3300006881 Bacteria 4037
147 Ga0068865_100075594 3300006881 Bacteria 2402
148 Ga0097620_100026987 3300006931 Bacteria 5761
149 Ga0097620_100050450 3300006931 Bacteria 4180
150 Ga0097620_100235464 3300006931 Bacteria 1919
151 Ga0099824_1020738 3300006942 Bacteria 4753
152 Ga0075435_100047972 3300007076 Bacteria 3429
153 Ga0105240_10003533 3300009093 Bacteria 24249
154 Ga0105240_10012127 3300009093 Bacteria 11933
155 Ga0111539_10004086 3300009094 Bacteria 19146
156 Ga0111539_10016141 3300009094 Bacteria 9266
157 Ga0111539_10125922 3300009094 Bacteria 3002
158 Ga0114129_10028131 3300009147 Bacteria 7965
159 Ga0105243_10103828 3300009148 Bacteria 2364
160 Ga0105248_10047576 3300009177 Bacteria 4810
161 Ga0105248_10064899 3300009177 Bacteria 4099
162 Ga0105237_10151724 3300009545 Bacteria 2314
163 Ga0105238_10002653 3300009551 Bacteria 17798
164 Ga0105249_10016504 3300009553 Bacteria 6550
165 Ga0105249_10227500 3300009553 Bacteria 1838
166 Ga0105249_10272884 3300009553 Bacteria 1685
167 Ga0105239_10052352 3300010375 Bacteria 4477
168 Ga0157373_10108531 3300013100 Bacteria 1951
169 Ga0157370_10020086 3300013104 Bacteria 6680
170 Ga0157369_10010670 3300013105 Bacteria 10456
171 Ga0171462_1007 3300013250 Bacteria 417698
172 Ga0157378_10018935 3300013297 Bacteria 6051
173 Ga0163162_10067480 3300013306 Bacteria 3627
174 Ga0163162_10345500 3300013306 Bacteria 1620
175 Ga0157372_10501756 3300013307 Bacteria 1415
176 Ga0157375_10040120 3300013308 Bacteria 4511
177 Ga0157375_10052057 3300013308 Bacteria 4024
178 Ga0157375_10218341 3300013308 Bacteria 2065
179 Ga0163163_10400097 3300014325 Bacteria 1431
180 Ga0157380_10085184 3300014326 Bacteria 2593
181 Ga0157380_10692160 3300014326 Bacteria 1023
182 Ga0182008_10020965 3300014497 Bacteria 3361
183 Ga0157377_10005668 3300014745 Bacteria 5885
184 Ga0157379_10040572 3300014968 Bacteria 4155
185 Ga0157379_10240282 3300014968 Bacteria 1643
186 Ga0157376_10011864 3300014969 Bacteria 6441
187 Ga0157376_10015816 3300014969 Bacteria 5710
188 Ga0163161_10062877 3300017792 Bacteria 2704
189 Ga0213875_10000003 3300021388 Bacteria 719367
190 Ga0213871_10004272 3300021441 Bacteria 2845
191 Ga0209148_1007501 3300025254 Bacteria 2262
192 Ga0209759_1001594 3300025256 Bacteria 12279
193 Ga0209455_1000030 3300025272 Bacteria 533479
194 Ga0209130_1000024 3300025284 Bacteria 354212
195 Ga0209675_1000378 3300025291 Bacteria 37093
196 Ga0209025_1000010 3300025294 Bacteria 986612
197 Ga0209025_1001592 3300025294 Bacteria 28567
198 Ga0209025_1051603 3300025294 Bacteria 1632
199 Ga0209564_1000048 3300025295 Bacteria 364806
200 Ga0209564_1000074 3300025295 Bacteria 286043
201 Ga0209256_1000041 3300025299 Bacteria 364827
202 Ga0209256_1000109 3300025299 Bacteria 184928
203 Ga0207697_10050176 3300025315 Bacteria 1723
204 Ga0207656_10012166 3300025321 Bacteria 3267
205 Ga0207656_10022456 3300025321 Bacteria 2532
206 Ga0207682_10020446 3300025893 Bacteria 2599
207 Ga0207682_10032345 3300025893 Bacteria 2102
208 Ga0207682_10054720 3300025893 Bacteria 1659
209 Ga0207692_10095124 3300025898 Bacteria 1624
210 Ga0207680_10070442 3300025903 Bacteria 2164
211 Ga0207680_10113863 3300025903 Bacteria 1759
212 Ga0207699_10046945 3300025906 Bacteria 2529
213 Ga0207645_10006813 3300025907 Bacteria 8156
214 Ga0207645_10024881 3300025907 Bacteria 3879
215 Ga0207705_10040345 3300025909 Bacteria 3348
216 Ga0207705_10068814 3300025909 Bacteria 2564
217 Ga0207705_10085966 3300025909 Bacteria 2298
218 Ga0207684_10017603 3300025910 Bacteria 6129
219 Ga0207684_10030377 3300025910 Bacteria 4599
220 Ga0207684_10133541 3300025910 Bacteria 2130
221 Ga0207684_10172713 3300025910 Bacteria 1863
222 Ga0207707_10016025 3300025912 Bacteria 6537
223 Ga0207707_10057244 3300025912 Bacteria 3393
224 Ga0207695_10022997 3300025913 Bacteria 7059
225 Ga0207695_10049892 3300025913 Bacteria 4406
226 Ga0207671_10195865 3300025914 Bacteria 1577
227 Ga0207693_10026247 3300025915 Bacteria 4611
228 Ga0207660_10008937 3300025917 Bacteria 6483
229 Ga0207660_10026443 3300025917 Bacteria 3952
230 Ga0207657_10007756 3300025919 Bacteria 10963
231 Ga0207657_10129568 3300025919 Bacteria 2069
232 Ga0207652_10009010 3300025921 Bacteria 8042
233 Ga0207646_10001470 3300025922 Bacteria 29142
234 Ga0207646_10079522 3300025922 Bacteria 2931
235 Ga0207681_10006481 3300025923 Bacteria 7188
236 Ga0207681_10118299 3300025923 Bacteria 1939
237 Ga0207694_10044983 3300025924 Bacteria 3409
238 Ga0207650_10001226 3300025925 Bacteria 18753
239 Ga0207650_10001840 3300025925 Bacteria 14970
240 Ga0207650_10049553 3300025925 Bacteria 3102
241 Ga0207659_10018397 3300025926 Bacteria 4581
242 Ga0207659_10020094 3300025926 Bacteria 4407
243 Ga0207659_10043645 3300025926 Bacteria 3150
244 Ga0207659_10047511 3300025926 Bacteria 3036
245 Ga0207700_10056838 3300025928 Bacteria 2947
246 Ga0207700_10311710 3300025928 Bacteria 1361
247 Ga0207644_10000317 3300025931 Bacteria 31456
248 Ga0207644_10012920 3300025931 Bacteria 5552
249 Ga0207644_10032611 3300025931 Bacteria 3635
250 Ga0207706_10004572 3300025933 Bacteria 12986
251 Ga0207706_10026885 3300025933 Bacteria 5150
252 Ga0207706_10064655 3300025933 Bacteria 3221
253 Ga0207706_10178533 3300025933 Bacteria 1865
254 Ga0207686_10018274 3300025934 Bacteria 3968
255 Ga0207669_10041226 3300025937 Bacteria 2685
256 Ga0207704_10114815 3300025938 Bacteria 1829
257 Ga0207665_10077278 3300025939 Bacteria 2285
258 Ga0207691_10000090 3300025940 Bacteria 77582
259 Ga0207691_10037329 3300025940 Bacteria 4499
260 Ga0207691_10047951 3300025940 Bacteria 3918
261 Ga0207691_10084335 3300025940 Bacteria 2852
262 Ga0207691_10149401 3300025940 Bacteria 2055
263 Ga0207691_10151753 3300025940 Bacteria 2037
264 Ga0207691_10168394 3300025940 Bacteria 1919
265 Ga0207691_10229054 3300025940 Bacteria 1610
266 Ga0207711_10012299 3300025941 Bacteria 7115
267 Ga0207711_10055449 3300025941 Bacteria 3403
268 Ga0207711_10234703 3300025941 Bacteria 1681
269 Ga0207689_10000735 3300025942 Bacteria 31549
270 Ga0207661_10109597 3300025944 Bacteria 2332
271 Ga0207679_10057351 3300025945 Bacteria 2880
272 Ga0207679_10064127 3300025945 Bacteria 2745
273 Ga0207667_10021341 3300025949 Bacteria 7177
274 Ga0207667_10024662 3300025949 Bacteria 6598
275 Ga0207651_10000327 3300025960 Bacteria 20323
276 Ga0207651_10004608 3300025960 Bacteria 6980
277 Ga0207651_10015165 3300025960 Bacteria 4470
278 Ga0207651_10043012 3300025960 Bacteria 3011
279 Ga0207712_10018812 3300025961 Bacteria 4504
280 Ga0207712_10356591 3300025961 Bacteria 1217
281 Ga0207668_10006559 3300025972 Bacteria 6878
282 Ga0207668_10010800 3300025972 Bacteria 5531
283 Ga0207640_10179538 3300025981 Bacteria 1586
284 Ga0207658_10002716 3300025986 Bacteria 12776
285 Ga0207658_10031398 3300025986 Bacteria 3771
286 Ga0207677_10004266 3300026023 Bacteria 7646
287 Ga0207677_10009883 3300026023 Bacteria 5380
288 Ga0207677_10170477 3300026023 Bacteria 1701
289 Ga0207703_10002402 3300026035 Bacteria 16278
290 Ga0207703_10147413 3300026035 Bacteria 2048
291 Ga0207678_10022457 3300026067 Bacteria 5525
292 Ga0207678_10038674 3300026067 Bacteria 4144
293 Ga0207708_10053675 3300026075 Bacteria 3071
294 Ga0207641_10035597 3300026088 Bacteria 4149
295 Ga0207641_10043575 3300026088 Bacteria 3769
296 Ga0207641_10147506 3300026088 Bacteria 2128
297 Ga0207641_10162638 3300026088 Bacteria 2030
298 Ga0207648_10000842 3300026089 Bacteria 34576
299 Ga0207648_10125398 3300026089 Bacteria 2259
300 Ga0207648_10167642 3300026089 Bacteria 1941
301 Ga0207648_10205043 3300026089 Bacteria 1750
302 Ga0207676_10016655 3300026095 Bacteria 5324
303 Ga0207676_10060408 3300026095 Bacteria 2998
304 Ga0207674_10031036 3300026116 Bacteria 5616
305 Ga0207674_10208280 3300026116 Bacteria 1905
306 Ga0207675_100005811 3300026118 Bacteria 11789
307 Ga0207675_100103371 3300026118 Bacteria 2685
308 Ga0207683_10019166 3300026121 Bacteria 5841
309 Ga0207683_10105910 3300026121 Bacteria 2514
310 Ga0207683_10261960 3300026121 Bacteria 1579
311 Ga0207683_10271670 3300026121 Bacteria 1549
312 Ga0207683_10385111 3300026121 Bacteria 1289
313 Ga0207698_10036041 3300026142 Bacteria 3626
314 Ga0207698_10078288 3300026142 Bacteria 2654
315 Ga0207698_10096289 3300026142 Bacteria 2439
316 Ga0207698_10206752 3300026142 Bacteria 1763
317 Ga0207698_10343841 3300026142 Bacteria 1406
318 Ga0209589_1000002 3300027357 Bacteria 708598
319 Ga0209489_100002 3300027361 Bacteria 708609
320 Ga0209700_100002 3300027363 Bacteria 708598
321 Ga0207428_10000049 3300027907 Bacteria 179267
322 Ga0207428_10005387 3300027907 Bacteria 11937
323 Ga0207428_10013198 3300027907 Bacteria 7231
324 Ga0268266_10011882 3300028379 Bacteria 7541
325 Ga0268266_10141537 3300028379 Bacteria 2159
326 Ga0268266_10231960 3300028379 Bacteria 1700
327 Ga0268266_10502313 3300028379 Bacteria 1158
328 Ga0268265_10031287 3300028380 Bacteria 3842
329 Ga0268265_10073695 3300028380 Bacteria 2667
330 Ga0268265_10077977 3300028380 Bacteria 2604
331 Ga0268264_10009099 3300028381 Bacteria 8236
332 Ga0268264_10364877 3300028381 Bacteria 1379
333 Ga0268264_10413319 3300028381 Bacteria 1299
334 Ga0265334_10020990 3300028573 Bacteria 2670
335 Ga0265336_10000042 3300028666 Bacteria 136760
336 Ga0307515_10038014 3300028794 Bacteria 7717
337 Ga0265324_10000213 3300029957 Bacteria 44530
338 Ga0307511_10054382 3300030521 Bacteria 3157
339 Ga0307513_10010247 3300031456 Bacteria 11767
340 Ga0307509_10027844 3300031507 Bacteria 6286
341 Ga0307508_10018371 3300031616 Bacteria 6357
342 Ga0307514_10000339 3300031649 Bacteria 111130
343 Ga0316575_10031754 3300031665 Bacteria 2067
344 Ga0316579_10004495 3300031691 Bacteria 5544
345 Ga0316579_10030880 3300031691 Bacteria 2450
346 Ga0316579_10121166 3300031691 Bacteria 1257
347 Ga0316576_10009720 3300031727 Bacteria 6222
348 Ga0316576_10322225 3300031727 Bacteria 1153
349 Ga0316578_10035292 3300031728 Bacteria 2874
350 Ga0307516_10000669 3300031730 Bacteria 46347
351 Ga0307405_10014886 3300031731 Bacteria 4197
352 Ga0307405_10143789 3300031731 Bacteria 1667
353 Ga0316577_10002137 3300031733 Bacteria 9668
354 Ga0316577_10002905 3300031733 Bacteria 8567
355 Ga0316577_10037087 3300031733 Bacteria 2726
356 Ga0316577_10063247 3300031733 Bacteria 2066
357 Ga0307413_10127217 3300031824 Bacteria 1737
358 Ga0307410_10010061 3300031852 Bacteria 5340
359 Ga0307410_10018143 3300031852 Bacteria 4246
360 Ga0307410_10176361 3300031852 Bacteria 1615
361 Ga0307410_10239673 3300031852 Bacteria 1405
362 Ga0307406_10059842 3300031901 Bacteria 2454
363 Ga0307406_10174850 3300031901 Bacteria 1558
364 Ga0307407_10046631 3300031903 Bacteria 2455
365 Ga0307412_10024623 3300031911 Bacteria 3717
366 Ga0307409_100006230 3300031995 Bacteria 6985
367 Ga0307416_100022926 3300032002 Bacteria 4519
368 Ga0307416_100046020 3300032002 Bacteria 3440
369 Ga0307414_10010416 3300032004 Bacteria 5393
370 Ga0307414_10415387 3300032004 Bacteria 1172
371 Ga0307411_10390046 3300032005 Bacteria 1148
372 Ga0316585_10008215 3300032137 Bacteria 3024
373 Ga0316580_10027258 3300032139 Bacteria 1767
374 Ga0307507_10032790 3300033179 Bacteria 5412
375 Ga0315911_1000007 3300033442 Bacteria 413725
376 Ga0373934_0126211 3300035086 Bacteria 1042
377 Ga0373940_0007313 3300035088 Bacteria 2488
378 Ga0373923_0091369 3300035111 Bacteria 1332
379 Ga0373932_0049415 3300035112 Bacteria 1243
380 Ga0373932_0050939 3300035112 Bacteria 1228
381 Ga0373953_0014557 3300035117 Bacteria 2832
382 Ga0373956_0130002 3300035119 Bacteria 1179
383 Ga0373943_0034790 3300035170 Bacteria 2405
384 Ga0373943_0122772 3300035170 Bacteria 1382
385 Ga0373946_0057075 3300035171 Bacteria 1651
386 Ga0373955_0040933 3300035172 Bacteria 2481
387 Ga0373955_0133683 3300035172 Bacteria 1450
388 Ga0373955_0156017 3300035172 Bacteria 1345
389 Ga0316574_0171084 3300035398 Bacteria 1398
390 Ga0373931_0026627 3300035691 Bacteria 2945
391 Ga0373931_0032759 3300035691 Bacteria 2690
392 Ga0373931_0086664 3300035691 Bacteria 1738
393 Ga0373935_0035719 3300035692 Bacteria 3103
394 Ga0373935_0089391 3300035692 Bacteria 2014
395 Ga0373935_0404198 3300035692 Bacteria 981
396 Ga0373927_0010615 3300035695 Bacteria 6138
397 Ga0373927_0069340 3300035695 Bacteria 2282
398 Ga0373927_0111726 3300035695 Bacteria 1781
399 Ga0373927_0261672 3300035695 Bacteria 1138
400 Ga0373933_0004917 3300035724 Bacteria 7293
401 Ga0373933_0080962 3300035724 Bacteria 1991
402 Ga0373937_0003711 3300036401 Bacteria 12899
403 Ga0373937_0016046 3300036401 Bacteria 6643
404 Ga0373937_0040382 3300036401 Bacteria 4253
405 Ga0373937_0106992 3300036401 Bacteria 2600
406 Ga0373937_0161024 3300036401 Bacteria 2104
407 Ga0316582_0000152 3300036647 Bacteria 20917
408 Ga0316582_0051402 3300036647 Bacteria 2615
409 Ga0316582_0053628 3300036647 Bacteria 2565
410 Ga0316582_0070137 3300036647 Bacteria 2267
411 Ga0316584_0001806 3300036712 Bacteria 13219
412 Ga0316584_0008542 3300036712 Bacteria 7059
413 Ga0316584_0013977 3300036712 Bacteria 5699
414 Ga0373925_0001453 3300037068 Bacteria 20460
415 Ga0373925_0007427 3300037068 Bacteria 7997
416 Ga0373925_0098325 3300037068 Bacteria 2246
417 Ga0373925_0135538 3300037068 Bacteria 1924
418 Ga0395899_0001159 3300037312 Bacteria 23305
419 Ga0395899_0062362 3300037312 Bacteria 2745
420 Ga0395900_0046685 3300037418 Bacteria 4460
421 Ga0395898_0002205 3300037466 Bacteria 23788
422 Ga0316581_0000131 3300037588 Bacteria 11079
423 Ga0316581_0006644 3300037588 Bacteria 3070
424 Ga0316581_0021000 3300037588 Bacteria 1916
425 Ga0436364_0837883 3300037853 Bacteria 1609
426 Ga0436364_0960990 3300037853 Bacteria 25250
427 Ga0395901_0058531 3300038443 Bacteria 4007
428 Ga0436360_0208407 3300039438 Bacteria 3275
429 Ga0436360_0445758 3300039438 Bacteria 1233
430 Ga0436360_1065138 3300039438 Bacteria 1418
431 Ga0436361_0513491 3300039447 Bacteria 4789
432 Ga0439464_0001490 3300042439 Bacteria 5530
433 Ga0450893_0004958 3300042532 Bacteria 2126
434 Ga0451577_0004779 3300042876 Bacteria 14161
435 Ga0451577_0111081 3300042876 Bacteria 2452
436 Ga0453683_0014124 3300044673 Bacteria 5192
437 Ga0453684_0005806 3300044712 Bacteria 24055
438 Ga0453684_0262500 3300044712 Bacteria 1977
439 Ga0451576_0005513 3300045051 Bacteria 15810
440 Ga0451576_0062837 3300045051 Bacteria 3870
441 Ga0451576_0078142 3300045051 Bacteria 3444
442 Ga0495653_0282749 3300046463 Bacteria 1088
443 Ga0495650_0013732 3300046471 Bacteria 4263
444 Ga0495639_0021981 3300046475 Bacteria 2796
445 Ga0495664_0004084 3300046477 Bacteria 7963
446 Ga0495608_0029382 3300046511 Bacteria 3729
447 Ga0495652_0374704 3300046529 Bacteria 1014
448 Ga0495640_0030571 3300046533 Bacteria 3855
449 Ga0495586_0022472 3300046535 Bacteria 3366
450 Ga0495587_0008866 3300046536 Bacteria 6455
451 Ga0495621_0003372 3300046539 Bacteria 4407
452 Ga0495621_0037223 3300046539 Bacteria 1691
453 Ga0495621_0066412 3300046539 Bacteria 1320
454 Ga0495645_0000948 3300046543 Bacteria 19815
455 Ga0495622_0029722 3300046557 Bacteria 2553
456 Ga0495667_0004591 3300046559 Bacteria 9337
457 Ga0495635_0021420 3300046663 Bacteria 4504
458 Ga0495635_0180323 3300046663 Bacteria 1436
459 Ga0495657_0093237 3300046675 Bacteria 1928
460 Ga0495599_0015847 3300046678 Bacteria 4680
461 Ga0495646_0005751 3300046680 Bacteria 7859
462 Ga0495646_0058442 3300046680 Bacteria 2306
463 Ga0495658_0021911 3300046683 Bacteria 3373
464 Ga0495658_0058042 3300046683 Bacteria 2213
465 Ga0495658_0185774 3300046683 Bacteria 1291
466 Ga0495600_0159626 3300046809 Bacteria 1458
467 Ga0495604_0166413 3300047317 Bacteria 1554
468 Ga0495675_0286733 3300047444 Bacteria 981
469 Ga0495602_0003095 3300048088 Bacteria 17102
470 Ga0496101_0054891 3300048904 Bacteria 2876
471 Ga0496102_0471551 3300048905 Bacteria 1176
472 Ga0496104_0096825 3300048907 Bacteria 2823
473 Ga0496105_0084176 3300048908 Bacteria 2627
474 Ga0496105_0400806 3300048908 Bacteria 1089
475 Ga0496106_0057156 3300048909 Bacteria 2950
476 Ga0496108_0133369 3300048911 Bacteria 2135
477 Ga0496108_0165651 3300048911 Bacteria 1911
478 Ga0496108_0227466 3300048911 Bacteria 1621
479 Ga0496109_0163484 3300048912 Bacteria 2086
480 Ga0496109_0318562 3300048912 Bacteria 1467
481 Ga0496110_0420740 3300048913 Bacteria 1218
482 Ga0496114_0026107 3300048917 Bacteria 4780
483 Ga0496114_0401897 3300048917 Bacteria 1213
484 Ga0496115_0112119 3300048918 Bacteria 2241
485 Ga0496117_0041047 3300048920 Bacteria 3395
486 Ga0496118_0175914 3300048921 Bacteria 1300
487 Ga0496122_0016914 3300048925 Bacteria 6854
488 Ga0496122_0020976 3300048925 Bacteria 5870
489 Ga0496123_0018808 3300048926 Bacteria 5474
490 Ga0496125_0000243 3300048928 Bacteria 111891
491 Ga0496125_0002877 3300048928 Bacteria 21668
492 Ga0496126_0115136 3300048929 Bacteria 2338
493 Ga0501033_0092886 3300049570 Bacteria 2207
494 Ga0501034_0020767 3300049571 Bacteria 6702
495 Ga0501034_0057859 3300049571 Bacteria 3897
496 Ga0501036_0151388 3300049572 Bacteria 1957
497 Ga0501037_0027490 3300049573 Bacteria 4203
498 Ga0501038_0075863 3300049574 Bacteria 2841
499 Ga0501039_0138134 3300049575 Bacteria 1914
500 Ga0501040_0038056 3300049576 Bacteria 3270
501 Ga0501041_0005402 3300049577 Bacteria 7487
502 Ga0501042_0180385 3300049578 Bacteria 1523
503 Ga0501043_0006665 3300049579 Bacteria 9238
504 Ga0501046_0019777 3300049580 Bacteria 5578
505 Ga0501046_0041793 3300049580 Bacteria 3657
506 Ga0501046_0109390 3300049580 Bacteria 2113
507 Ga0501047_0007815 3300049581 Bacteria 10071
508 Ga0501048_0058916 3300049582 Bacteria 2721
509 Ga0501048_0092331 3300049582 Bacteria 2135
510 Ga0501070_0059866 3300049586 Bacteria 3157
511 Ga0501071_0026290 3300049587 Bacteria 4084
512 Ga0501072_0066445 3300049588 Bacteria 2845
513 Ga0501072_0111306 3300049588 Bacteria 2180
514 Ga0501075_0000122 3300049591 Bacteria 37780
515 Ga0501075_0161281 3300049591 Bacteria 1711
516 Ga0501076_0000012 3300049592 Bacteria 113396
517 Ga0501079_0059982 3300049741 Bacteria 2934
518 Ga0501080_0021641 3300049742 Bacteria 5954
519 Ga0501080_0134839 3300049742 Bacteria 2285
520 Ga0501081_0009712 3300049743 Bacteria 6274
521 Ga0501083_0109311 3300049744 Bacteria 1818
522 Ga0501035_0262955 3300049822 Bacteria 1462
523 Ga0501044_0051179 3300049823 Bacteria 4259
524 Ga0501045_0026360 3300049824 Bacteria 4180
525 nmdc:mga0k408_3893_c1 3300050493 Bacteria 7912
526 nmdc:mga05p37_242228_c1 3300050507 Bacteria 2168
527 nmdc:mga05p37_6592_c1 3300050507 Bacteria 13687
528 nmdc:mga09592_12606_c1 3300050508 Bacteria 6891
529 nmdc:mga09592_218707_c1 3300050508 Bacteria 1651
530 nmdc:mga08y16_17270_c1 3300050511 Bacteria 7597
531 nmdc:mga08y16_190_c1 3300050511 Bacteria 55016
532 nmdc:mga08y16_378652_c1 3300050511 Bacteria 1451
533 nmdc:mga08y16_457_c1 3300050511 Bacteria 38015
534 nmdc:mga0n895_26533_c1 3300050512 Bacteria 5488
535 nmdc:mga0rr50_160607_c1 3300050513 Bacteria 1824
536 nmdc:mga0a205_308_c1 3300050515 Bacteria 36240
537 nmdc:mga0a205_4287_c1 3300050515 Bacteria 12802
538 Ga0495601_0000910 3300053077 Bacteria 16108
539 Ga0495612_0001140 3300053078 Bacteria 10902
540 Ga0500635_0000021 3300053080 Bacteria 110194
541 Ga0500635_0019599 3300053080 Bacteria 2059
542 Ga0495619_0132043 3300053085 Bacteria 1716
543 Ga0500578_0095730 3300053086 Bacteria 1883
544 Ga0500622_0036688 3300053156 Bacteria 2562
545 Ga0500637_0012513 3300053178 Bacteria 4423
546 Ga0501084_0154840 3300054114 Bacteria 1932
547 Ga0501082_0001139 3300060353 Bacteria 23451
548 Ga0530510_0000015 3300061734 Bacteria 104554

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_0161281 Ga0501075_0161281_23_823 240
2 3300009094 Ga0111539_10004086 Ga0111539_100040864 243
3 3300005937 Ga0081455_10008796 Ga0081455_100087963 247
4 3300028381 Ga0268264_10364877 Ga0268264_103648772 247
5 3300005327 Ga0070658_10006666 Ga0070658_100066662 248
6 3300005336 Ga0070680_100009124 Ga0070680_1000091247 248
7 3300005458 Ga0070681_10002841 Ga0070681_100028419 248
8 3300005530 Ga0070679_100013328 Ga0070679_1000133284 248
9 3300013297 Ga0157378_10018935 Ga0157378_100189352 248
10 3300013306 Ga0163162_10067480 Ga0163162_100674803 248
11 3300013308 Ga0157375_10052057 Ga0157375_100520572 248
12 3300028573 Ga0265334_10020990 Ga0265334_100209903 250
13 3300031730 Ga0307516_10000669 Ga0307516_1000066929 250
14 3300035119 Ga0373956_0130002 Ga0373956_0130002_97_924 250
15 3300046475 Ga0495639_0021981 Ga0495639_0021981_1151_2077 250
16 3300046529 Ga0495652_0374704 Ga0495652_0374704_75_1001 250
17 3300003775 Ga0055524_1027579 Ga0055524_10275792 252
18 3300003761 Ga0055535_1000125 Ga0055535_100012524 254
19 3300003763 Ga0055529_1000266 Ga0055529_100026610 254
20 3300046471 Ga0495650_0013732 Ga0495650_0013732_1403_2230 254
21 3300053080 Ga0500635_0000021 Ga0500635_0000021_22512_23339 254
22 3300026023 Ga0207677_10009883 Ga0207677_100098831 255
23 3300005354 Ga0070675_100132682 Ga0070675_1001326822 256
24 3300005546 Ga0070696_100064639 Ga0070696_1000646392 256
25 3300031901 Ga0307406_10174850 Ga0307406_101748502 257
26 3300005329 Ga0070683_100607939 Ga0070683_1006079392 258
27 3300014968 Ga0157379_10240282 Ga0157379_102402822 258
28 3300014969 Ga0157376_10011864 Ga0157376_100118644 258
29 3300030521 Ga0307511_10054382 Ga0307511_100543823 258
30 3300031507 Ga0307509_10027844 Ga0307509_100278444 258
31 3300031616 Ga0307508_10018371 Ga0307508_100183712 258
32 3300033179 Ga0307507_10032790 Ga0307507_100327904 258
33 3300035695 Ga0373927_0010615 Ga0373927_0010615_1186_2103 258
34 3300037068 Ga0373925_0007427 Ga0373925_0007427_2905_3822 258
35 3300046557 Ga0495622_0029722 Ga0495622_0029722_541_1458 258
36 3300046683 Ga0495658_0185774 Ga0495658_0185774_321_1238 258
37 3300053080 Ga0500635_0019599 Ga0500635_0019599_933_1850 258
38 3300053178 Ga0500637_0012513 Ga0500637_0012513_1115_2032 258
39 3300005547 Ga0070693_100028772 Ga0070693_1000287723 259
40 3300005615 Ga0070702_100061441 Ga0070702_1000614413 259
41 3300009553 Ga0105249_10227500 Ga0105249_102275002 259
42 3300014745 Ga0157377_10005668 Ga0157377_100056684 259
43 3300033442 Ga0315911_1000007 Ga0315911_100000780 259
44 3300035172 Ga0373955_0133683 Ga0373955_0133683_360_1295 259
45 3300035692 Ga0373935_0035719 Ga0373935_0035719_333_1241 259
46 3300036401 Ga0373937_0040382 Ga0373937_0040382_1005_1952 259
47 3300037068 Ga0373925_0135538 Ga0373925_0135538_323_1237 259
48 3300046683 Ga0495658_0021911 Ga0495658_0021911_1638_2573 259
49 3300048904 Ga0496101_0054891 Ga0496101_0054891_1477_2379 259
50 3300048913 Ga0496110_0420740 Ga0496110_0420740_256_1158 259
51 3300048928 Ga0496125_0002877 Ga0496125_0002877_18568_19485 259
52 3300049574 Ga0501038_0075863 Ga0501038_0075863_143_1084 260
53 3300049575 Ga0501039_0138134 Ga0501039_0138134_680_1621 260
54 3300049576 Ga0501040_0038056 Ga0501040_0038056_129_1070 260
55 3300049577 Ga0501041_0005402 Ga0501041_0005402_6441_7382 260
56 3300049578 Ga0501042_0180385 Ga0501042_0180385_425_1366 260
57 3300049582 Ga0501048_0058916 Ga0501048_0058916_1587_2528 260
58 3300049587 Ga0501071_0026290 Ga0501071_0026290_23_964 260
59 3300049588 Ga0501072_0066445 Ga0501072_0066445_252_1193 260
60 3300049591 Ga0501075_0000122 Ga0501075_0000122_223_1164 260
61 3300049592 Ga0501076_0000012 Ga0501076_0000012_32847_33788 260
62 3300049741 Ga0501079_0059982 Ga0501079_0059982_75_1016 260
63 3300049742 Ga0501080_0134839 Ga0501080_0134839_1065_2006 260
64 3300049743 Ga0501081_0009712 Ga0501081_0009712_216_1157 260
65 3300049822 Ga0501035_0262955 Ga0501035_0262955_195_1136 260
66 3300049824 Ga0501045_0026360 Ga0501045_0026360_3115_4056 260
67 3300050511 nmdc:mga08y16_457_c1 nmdc:mga08y16_457_c1_3327_4181 260
68 3300054114 Ga0501084_0154840 Ga0501084_0154840_760_1701 260
69 3300060353 Ga0501082_0001139 Ga0501082_0001139_19045_19986 260
70 3300061734 Ga0530510_0000015 Ga0530510_0000015_63447_64388 260
71 3300005456 Ga0070678_100206576 Ga0070678_1002065762 261
72 3300009094 Ga0111539_10125922 Ga0111539_101259223 261
73 3300025934 Ga0207686_10018274 Ga0207686_100182743 261
74 3300026121 Ga0207683_10385111 Ga0207683_103851112 261
75 3300045051 Ga0451576_0062837 Ga0451576_0062837_505_1365 261
76 3300005331 Ga0070670_100276930 Ga0070670_1002769302 262
77 3300005344 Ga0070661_100222352 Ga0070661_1002223521 262
78 3300005354 Ga0070675_100075083 Ga0070675_1000750833 262
79 3300005457 Ga0070662_100017341 Ga0070662_1000173412 262
80 3300005564 Ga0070664_100156521 Ga0070664_1001565212 262
81 3300005617 Ga0068859_100235456 Ga0068859_1002354562 262
82 3300006358 Ga0068871_100073525 Ga0068871_1000735252 262
83 3300006931 Ga0097620_100235464 Ga0097620_1002354642 262
84 3300025933 Ga0207706_10026885 Ga0207706_100268854 262
85 3300025945 Ga0207679_10064127 Ga0207679_100641272 262
86 3300025981 Ga0207640_10179538 Ga0207640_101795382 262
87 3300042532 Ga0450893_0004958 Ga0450893_0004958_589_1452 262
88 3300048929 Ga0496126_0115136 Ga0496126_0115136_1031_1948 262
89 iso_pu_bacteria 2728368998 2728752459 262
90 3300005456 Ga0070678_100121908 Ga0070678_1001219082 263
91 3300005614 Ga0068856_100462279 Ga0068856_1004622792 263
92 3300009093 Ga0105240_10003533 Ga0105240_1000353319 263
93 3300013100 Ga0157373_10108531 Ga0157373_101085312 263
94 3300025909 Ga0207705_10040345 Ga0207705_100403453 263
95 3300025912 Ga0207707_10057244 Ga0207707_100572443 263
96 3300025913 Ga0207695_10022997 Ga0207695_100229975 263
97 3300025917 Ga0207660_10008937 Ga0207660_100089375 263
98 3300025949 Ga0207667_10024662 Ga0207667_100246624 263
99 3300031456 Ga0307513_10010247 Ga0307513_100102472 263
100 3300005331 Ga0070670_100252458 Ga0070670_1002524582 264
101 3300005355 Ga0070671_100076387 Ga0070671_1000763873 264
102 3300005563 Ga0068855_100012231 Ga0068855_1000122316 264
103 3300005578 Ga0068854_100224524 Ga0068854_1002245242 264
104 3300006942 Ga0099824_1020738 Ga0099824_10207383 264
105 3300025907 Ga0207645_10006813 Ga0207645_100068137 264
106 3300027357 Ga0209589_1000002 Ga0209589_1000002189 264
107 3300027361 Ga0209489_100002 Ga0209489_100002189 264
108 3300027363 Ga0209700_100002 Ga0209700_100002189 264
109 3300035111 Ga0373923_0091369 Ga0373923_0091369_166_1056 264
110 3300035172 Ga0373955_0156017 Ga0373955_0156017_203_1093 264
111 3300035724 Ga0373933_0080962 Ga0373933_0080962_935_1825 264
112 3300046477 Ga0495664_0004084 Ga0495664_0004084_2176_3066 264
113 3300046511 Ga0495608_0029382 Ga0495608_0029382_1059_1949 264
114 3300046536 Ga0495587_0008866 Ga0495587_0008866_165_1055 264
115 3300046543 Ga0495645_0000948 Ga0495645_0000948_12689_13579 264
116 3300046559 Ga0495667_0004591 Ga0495667_0004591_1611_2501 264
117 3300046663 Ga0495635_0021420 Ga0495635_0021420_1798_2688 264
118 3300046675 Ga0495657_0093237 Ga0495657_0093237_514_1404 264
119 3300046678 Ga0495599_0015847 Ga0495599_0015847_522_1412 264
120 3300046680 Ga0495646_0005751 Ga0495646_0005751_131_1021 264
121 3300047317 Ga0495604_0166413 Ga0495604_0166413_177_1067 264
122 3300048088 Ga0495602_0003095 Ga0495602_0003095_8172_9062 264
123 3300053077 Ga0495601_0000910 Ga0495601_0000910_4904_5794 264
124 3300053078 Ga0495612_0001140 Ga0495612_0001140_6836_7726 264
125 3300005356 Ga0070674_100317626 Ga0070674_1003176262 265
126 3300025941 Ga0207711_10234703 Ga0207711_102347032 265
127 3300005331 Ga0070670_100000757 Ga0070670_1000007578 266
128 3300005354 Ga0070675_100007385 Ga0070675_1000073852 266
129 3300005543 Ga0070672_100014255 Ga0070672_1000142553 266
130 3300005548 Ga0070665_100201777 Ga0070665_1002017772 266
131 3300005618 Ga0068864_100014494 Ga0068864_1000144942 266
132 3300014969 Ga0157376_10015816 Ga0157376_100158164 266
133 3300025321 Ga0207656_10022456 Ga0207656_100224563 266
134 3300025925 Ga0207650_10001840 Ga0207650_100018404 266
135 3300025926 Ga0207659_10020094 Ga0207659_100200942 266
136 3300025940 Ga0207691_10037329 Ga0207691_100373292 266
137 3300025960 Ga0207651_10015165 Ga0207651_100151653 266
138 3300026088 Ga0207641_10147506 Ga0207641_101475061 266
139 3300026142 Ga0207698_10096289 Ga0207698_100962892 266
140 3300035695 Ga0373927_0069340 Ga0373927_0069340_463_1461 266
141 3300037068 Ga0373925_0001453 Ga0373925_0001453_8046_9044 266
142 3300037312 Ga0395899_0001159 Ga0395899_0001159_4665_5621 266
143 3300038443 Ga0395901_0058531 Ga0395901_0058531_234_1190 266
144 3300042876 Ga0451577_0004779 Ga0451577_0004779_11786_12718 266
145 3300048918 Ga0496115_0112119 Ga0496115_0112119_835_1752 266
146 iso_pu_bacteria 2841911363 2841915960 267
147 iso_pu_bacteria 2841917233 2841921660 267
148 3300005330 Ga0070690_100019065 Ga0070690_1000190653 268
149 3300005335 Ga0070666_10003353 Ga0070666_100033535 268
150 3300005338 Ga0068868_100001471 Ga0068868_10000147111 268
151 3300005354 Ga0070675_100000817 Ga0070675_10000081713 268
152 3300005355 Ga0070671_100237676 Ga0070671_1002376761 268
153 3300005364 Ga0070673_100043247 Ga0070673_1000432472 268
154 3300005367 Ga0070667_100002131 Ga0070667_10000213110 268
155 3300005456 Ga0070678_100076876 Ga0070678_1000768762 268
156 3300005459 Ga0068867_100146410 Ga0068867_1001464102 268
157 3300005543 Ga0070672_100242730 Ga0070672_1002427302 268
158 3300005618 Ga0068864_100001465 Ga0068864_10000146511 268
159 3300005841 Ga0068863_100026019 Ga0068863_1000260193 268
160 3300005842 Ga0068858_100001383 Ga0068858_10000138316 268
161 3300006237 Ga0097621_100069169 Ga0097621_1000691693 268
162 3300006358 Ga0068871_100213809 Ga0068871_1002138092 268
163 3300009177 Ga0105248_10047576 Ga0105248_100475763 268
164 3300013308 Ga0157375_10218341 Ga0157375_102183412 268
165 3300014325 Ga0163163_10400097 Ga0163163_104000972 268
166 3300014968 Ga0157379_10040572 Ga0157379_100405723 268
167 3300025893 Ga0207682_10032345 Ga0207682_100323452 268
168 3300025903 Ga0207680_10070442 Ga0207680_100704422 268
169 3300025926 Ga0207659_10018397 Ga0207659_100183975 268
170 3300025940 Ga0207691_10168394 Ga0207691_101683942 268
171 3300025941 Ga0207711_10055449 Ga0207711_100554493 268
172 3300025960 Ga0207651_10043012 Ga0207651_100430122 268
173 3300025986 Ga0207658_10002716 Ga0207658_100027167 268
174 3300026023 Ga0207677_10004266 Ga0207677_100042666 268
175 3300026035 Ga0207703_10002402 Ga0207703_100024026 268
176 3300026088 Ga0207641_10162638 Ga0207641_101626382 268
177 3300026089 Ga0207648_10125398 Ga0207648_101253982 268
178 3300026095 Ga0207676_10016655 Ga0207676_100166552 268
179 3300026121 Ga0207683_10261960 Ga0207683_102619602 268
180 3300048911 Ga0496108_0133369 Ga0496108_0133369_588_1469 268
181 3300048912 Ga0496109_0163484 Ga0496109_0163484_1074_1955 268
182 3300005841 Ga0068863_100204022 Ga0068863_1002040222 269
183 3300025254 Ga0209148_1007501 Ga0209148_10075012 269
184 3300025256 Ga0209759_1001594 Ga0209759_10015944 269
185 3300025272 Ga0209455_1000030 Ga0209455_100003092 269
186 3300049588 Ga0501072_0111306 Ga0501072_0111306_1045_1935 269
187 3300005327 Ga0070658_10007485 Ga0070658_100074858 270
188 3300025909 Ga0207705_10068814 Ga0207705_100688142 270
189 3300037853 Ga0436364_0837883 Ga0436364_0837883_490_1440 270
190 3300049580 Ga0501046_0041793 Ga0501046_0041793_1381_2334 270
191 3300005844 Ga0068862_100235069 Ga0068862_1002350692 271
192 3300006852 Ga0075433_10004040 Ga0075433_100040402 271
193 3300027907 Ga0207428_10005387 Ga0207428_100053877 271
194 3300042876 Ga0451577_0111081 Ga0451577_0111081_279_1241 271
195 3300044673 Ga0453683_0014124 Ga0453683_0014124_1334_2296 271
196 3300044712 Ga0453684_0005806 Ga0453684_0005806_11263_12225 271
197 3300045051 Ga0451576_0078142 Ga0451576_0078142_2086_3048 271
198 3300050511 nmdc:mga08y16_17270_c1 nmdc:mga08y16_17270_c1_3606_4568 271
199 3300050512 nmdc:mga0n895_26533_c1 nmdc:mga0n895_26533_c1_4254_5216 271
200 3300050515 nmdc:mga0a205_308_c1 nmdc:mga0a205_308_c1_28782_29744 271
201 3300005328 Ga0070676_10026886 Ga0070676_100268864 272
202 3300005329 Ga0070683_100043839 Ga0070683_1000438393 272
203 3300005339 Ga0070660_100107010 Ga0070660_1001070102 272
204 3300005347 Ga0070668_100071699 Ga0070668_1000716992 272
205 3300005353 Ga0070669_100094316 Ga0070669_1000943162 272
206 3300005367 Ga0070667_100016645 Ga0070667_1000166452 272
207 3300005459 Ga0068867_100010057 Ga0068867_1000100574 272
208 3300005543 Ga0070672_100159752 Ga0070672_1001597522 272
209 3300005614 Ga0068856_100186105 Ga0068856_1001861052 272
210 3300005618 Ga0068864_100035977 Ga0068864_1000359773 272
211 3300005719 Ga0068861_100012878 Ga0068861_1000128784 272
212 3300005719 Ga0068861_100030764 Ga0068861_1000307643 272
213 3300005841 Ga0068863_100261103 Ga0068863_1002611032 272
214 3300005843 Ga0068860_100000590 Ga0068860_10000059047 272
215 3300005844 Ga0068862_100032721 Ga0068862_1000327212 272
216 3300006881 Ga0068865_100023491 Ga0068865_1000234913 272
217 3300021388 Ga0213875_10000003 Ga0213875_10000003600 272
218 3300025907 Ga0207645_10024881 Ga0207645_100248812 272
219 3300025919 Ga0207657_10129568 Ga0207657_101295682 272
220 3300025923 Ga0207681_10118299 Ga0207681_101182992 272
221 3300025933 Ga0207706_10004572 Ga0207706_1000457210 272
222 3300025940 Ga0207691_10151753 Ga0207691_101517532 272
223 3300025942 Ga0207689_10000735 Ga0207689_1000073516 272
224 3300025944 Ga0207661_10109597 Ga0207661_101095972 272
225 3300025945 Ga0207679_10057351 Ga0207679_100573512 272
226 3300025972 Ga0207668_10010800 Ga0207668_100108001 272
227 3300026023 Ga0207677_10170477 Ga0207677_101704772 272
228 3300026067 Ga0207678_10022457 Ga0207678_100224573 272
229 3300026075 Ga0207708_10053675 Ga0207708_100536753 272
230 3300026089 Ga0207648_10000842 Ga0207648_1000084219 272
231 3300026118 Ga0207675_100005811 Ga0207675_1000058118 272
232 3300028380 Ga0268265_10031287 Ga0268265_100312873 272
233 3300028381 Ga0268264_10009099 Ga0268264_100090999 272
234 3300031852 Ga0307410_10010061 Ga0307410_100100615 272
235 3300032002 Ga0307416_100022926 Ga0307416_1000229264 272
236 3300037853 Ga0436364_0960990 Ga0436364_0960990_10958_11920 272
237 3300046535 Ga0495586_0022472 Ga0495586_0022472_1007_2008 272
238 3300005937 Ga0081455_10083343 Ga0081455_100833433 273
239 3300025898 Ga0207692_10095124 Ga0207692_100951242 273
240 3300025928 Ga0207700_10056838 Ga0207700_100568382 273
241 3300025939 Ga0207665_10077278 Ga0207665_100772782 273
242 3300032005 Ga0307411_10390046 Ga0307411_103900462 273
243 3300035112 Ga0373932_0049415 Ga0373932_0049415_269_1168 273
244 3300035691 Ga0373931_0032759 Ga0373931_0032759_838_1737 273
245 3300035692 Ga0373935_0404198 Ga0373935_0404198_43_945 273
246 3300036401 Ga0373937_0106992 Ga0373937_0106992_46_1005 273
247 3300048907 Ga0496104_0096825 Ga0496104_0096825_1839_2780 273
248 3300048908 Ga0496105_0084176 Ga0496105_0084176_223_1164 273
249 3300003771 Ga0055526_1004093 Ga0055526_10040932 274
250 3300005327 Ga0070658_10111994 Ga0070658_101119943 274
251 3300005329 Ga0070683_100230178 Ga0070683_1002301782 274
252 3300005336 Ga0070680_100011564 Ga0070680_1000115644 274
253 3300005339 Ga0070660_100012301 Ga0070660_1000123013 274
254 3300005347 Ga0070668_100033710 Ga0070668_1000337102 274
255 3300005364 Ga0070673_100131783 Ga0070673_1001317832 274
256 3300005366 Ga0070659_100432940 Ga0070659_1004329402 274
257 3300005455 Ga0070663_100036099 Ga0070663_1000360992 274
258 3300005458 Ga0070681_10041436 Ga0070681_100414364 274
259 3300005459 Ga0068867_100178978 Ga0068867_1001789782 274
260 3300005530 Ga0070679_100042738 Ga0070679_1000427384 274
261 3300005539 Ga0068853_100028368 Ga0068853_1000283683 274
262 3300005539 Ga0068853_100297676 Ga0068853_1002976762 274
263 3300005564 Ga0070664_100138193 Ga0070664_1001381932 274
264 3300005577 Ga0068857_100020969 Ga0068857_1000209695 274
265 3300005719 Ga0068861_100136528 Ga0068861_1001365282 274
266 3300005834 Ga0068851_10039036 Ga0068851_100390362 274
267 3300006881 Ga0068865_100075594 Ga0068865_1000755942 274
268 3300009093 Ga0105240_10012127 Ga0105240_100121272 274
269 3300009148 Ga0105243_10103828 Ga0105243_101038281 274
270 3300009545 Ga0105237_10151724 Ga0105237_101517242 274
271 3300009551 Ga0105238_10002653 Ga0105238_100026536 274
272 3300009553 Ga0105249_10016504 Ga0105249_100165043 274
273 3300010375 Ga0105239_10052352 Ga0105239_100523524 274
274 3300013104 Ga0157370_10020086 Ga0157370_100200864 274
275 3300013105 Ga0157369_10010670 Ga0157369_100106709 274
276 3300013306 Ga0163162_10345500 Ga0163162_103455002 274
277 3300014326 Ga0157380_10085184 Ga0157380_100851842 274
278 3300017792 Ga0163161_10062877 Ga0163161_100628772 274
279 3300025315 Ga0207697_10050176 Ga0207697_100501762 274
280 3300025321 Ga0207656_10012166 Ga0207656_100121662 274
281 3300025903 Ga0207680_10113863 Ga0207680_101138632 274
282 3300025909 Ga0207705_10085966 Ga0207705_100859662 274
283 3300025912 Ga0207707_10016025 Ga0207707_100160254 274
284 3300025913 Ga0207695_10049892 Ga0207695_100498923 274
285 3300025914 Ga0207671_10195865 Ga0207671_101958652 274
286 3300025917 Ga0207660_10026443 Ga0207660_100264433 274
287 3300025919 Ga0207657_10007756 Ga0207657_100077565 274
288 3300025921 Ga0207652_10009010 Ga0207652_100090104 274
289 3300025923 Ga0207681_10006481 Ga0207681_100064813 274
290 3300025924 Ga0207694_10044983 Ga0207694_100449832 274
291 3300025938 Ga0207704_10114815 Ga0207704_101148151 274
292 3300025940 Ga0207691_10084335 Ga0207691_100843352 274
293 3300025940 Ga0207691_10229054 Ga0207691_102290542 274
294 3300025949 Ga0207667_10021341 Ga0207667_100213414 274
295 3300025961 Ga0207712_10018812 Ga0207712_100188123 274
296 3300025972 Ga0207668_10006559 Ga0207668_100065593 274
297 3300026067 Ga0207678_10038674 Ga0207678_100386742 274
298 3300026088 Ga0207641_10043575 Ga0207641_100435752 274
299 3300026089 Ga0207648_10205043 Ga0207648_102050432 274
300 3300026116 Ga0207674_10031036 Ga0207674_100310362 274
301 3300026118 Ga0207675_100103371 Ga0207675_1001033712 274
302 3300026142 Ga0207698_10078288 Ga0207698_100782882 274
303 3300028380 Ga0268265_10073695 Ga0268265_100736953 274
304 3300046539 Ga0495621_0003372 Ga0495621_0003372_1898_2788 274
305 3300046539 Ga0495621_0037223 Ga0495621_0037223_199_1140 274
306 3300048911 Ga0496108_0227466 Ga0496108_0227466_413_1363 274
307 3300005331 Ga0070670_100051866 Ga0070670_1000518663 275
308 3300005355 Ga0070671_100000285 Ga0070671_1000002859 275
309 3300005618 Ga0068864_100198788 Ga0068864_1001987882 275
310 3300025925 Ga0207650_10049553 Ga0207650_100495533 275
311 3300025931 Ga0207644_10000317 Ga0207644_100003179 275
312 3300025941 Ga0207711_10012299 Ga0207711_100122996 275
313 3300026088 Ga0207641_10035597 Ga0207641_100355973 275
314 3300026142 Ga0207698_10206752 Ga0207698_102067522 275
315 3300042439 Ga0439464_0001490 Ga0439464_0001490_296_1237 275
316 3300048911 Ga0496108_0165651 Ga0496108_0165651_332_1276 275
317 3300048917 Ga0496114_0401897 Ga0496114_0401897_40_978 275
318 3300050493 nmdc:mga0k408_3893_c1 nmdc:mga0k408_3893_c1_5792_6829 275
319 3300009177 Ga0105248_10064899 Ga0105248_100648993 276
320 3300005331 Ga0070670_100188471 Ga0070670_1001884711 277
321 3300005617 Ga0068859_100050451 Ga0068859_1000504512 277
322 3300005985 Ga0081539_10030355 Ga0081539_100303552 277
323 3300006931 Ga0097620_100050450 Ga0097620_1000504502 277
324 3300013250 Ga0171462_1007 Ga0171462_1007113 277
325 3300026121 Ga0207683_10271670 Ga0207683_102716702 277
326 3300028379 Ga0268266_10502313 Ga0268266_105023131 277
327 3300031665 Ga0316575_10031754 Ga0316575_100317542 277
328 3300031691 Ga0316579_10004495 Ga0316579_100044953 277
329 3300031691 Ga0316579_10121166 Ga0316579_101211662 277
330 3300031727 Ga0316576_10009720 Ga0316576_100097203 277
331 3300031727 Ga0316576_10322225 Ga0316576_103222251 277
332 3300031728 Ga0316578_10035292 Ga0316578_100352922 277
333 3300031733 Ga0316577_10002137 Ga0316577_100021373 277
334 3300031733 Ga0316577_10002905 Ga0316577_100029055 277
335 3300031733 Ga0316577_10037087 Ga0316577_100370872 277
336 3300032137 Ga0316585_10008215 Ga0316585_100082152 277
337 3300032139 Ga0316580_10027258 Ga0316580_100272582 277
338 3300035398 Ga0316574_0171084 Ga0316574_0171084_226_1179 277
339 3300036647 Ga0316582_0000152 Ga0316582_0000152_9142_10095 277
340 3300036647 Ga0316582_0051402 Ga0316582_0051402_251_1204 277
341 3300036647 Ga0316582_0053628 Ga0316582_0053628_1457_2410 277
342 3300036712 Ga0316584_0001806 Ga0316584_0001806_10512_11465 277
343 3300036712 Ga0316584_0008542 Ga0316584_0008542_2894_3847 277
344 3300036712 Ga0316584_0013977 Ga0316584_0013977_3588_4541 277
345 3300037588 Ga0316581_0000131 Ga0316581_0000131_3023_3976 277
346 3300037588 Ga0316581_0006644 Ga0316581_0006644_959_1912 277
347 3300005467 Ga0070706_100032002 Ga0070706_1000320023 278
348 3300005471 Ga0070698_100008329 Ga0070698_1000083293 278
349 3300006844 Ga0075428_100068071 Ga0075428_1000680713 278
350 3300025922 Ga0207646_10079522 Ga0207646_100795222 278
351 3300027907 Ga0207428_10013198 Ga0207428_100131986 278
352 3300036647 Ga0316582_0070137 Ga0316582_0070137_1138_2112 278
353 3300037312 Ga0395899_0062362 Ga0395899_0062362_420_1373 278
354 3300048921 Ga0496118_0175914 Ga0496118_0175914_149_1048 278
355 3300048925 Ga0496122_0016914 Ga0496122_0016914_3887_4786 278
356 3300048926 Ga0496123_0018808 Ga0496123_0018808_4178_5077 278
357 3300049570 Ga0501033_0092886 Ga0501033_0092886_1292_2191 278
358 3300049571 Ga0501034_0057859 Ga0501034_0057859_1315_2214 278
359 3300049573 Ga0501037_0027490 Ga0501037_0027490_2280_3179 278
360 3300005841 Ga0068863_100389571 Ga0068863_1003895712 279
361 3300006847 Ga0075431_100031310 Ga0075431_1000313106 279
362 3300014326 Ga0157380_10692160 Ga0157380_106921601 279
363 3300035088 Ga0373940_0007313 Ga0373940_0007313_1016_1960 279
364 3300035691 Ga0373931_0026627 Ga0373931_0026627_1375_2319 279
365 3300039438 Ga0436360_1065138 Ga0436360_1065138_11_937 279
366 3300050507 nmdc:mga05p37_6592_c1 nmdc:mga05p37_6592_c1_1044_1988 279
367 3300050508 nmdc:mga09592_12606_c1 nmdc:mga09592_12606_c1_197_1141 279
368 3300053086 Ga0500578_0095730 Ga0500578_0095730_512_1414 279
369 3300053156 Ga0500622_0036688 Ga0500622_0036688_969_1871 279
370 3300031691 Ga0316579_10030880 Ga0316579_100308802 280
371 3300031733 Ga0316577_10063247 Ga0316577_100632471 280
372 3300037588 Ga0316581_0021000 Ga0316581_0021000_63_1034 280
373 3300039438 Ga0436360_0445758 Ga0436360_0445758_55_996 280
374 3300046680 Ga0495646_0058442 Ga0495646_0058442_842_1759 280
375 3300049580 Ga0501046_0109390 Ga0501046_0109390_1168_2103 280
376 iso_pu_bacteria 2507262055 2507504478 280
377 iso_pu_bacteria 2511231028 2511400271 280
378 iso_pu_bacteria 2513237092 2513624273 280
379 iso_pu_bacteria 2513237094 2513638760 280
380 iso_pu_bacteria 2513237096 2513657761 280
381 iso_pu_bacteria 2513237101 2513693116 280
382 iso_pu_bacteria 2513237102 2513701650 280
383 iso_pu_bacteria 2513237137 2513861559 280
384 iso_pu_bacteria 2513237145 2513919760 280
385 iso_pu_bacteria 2517572143 2517895229 280
386 iso_pu_bacteria 2524023228 2524536357 280
387 iso_pu_bacteria 2528768022 2528849479 280
388 iso_pu_bacteria 2667528175 2671121748 280
389 iso_pu_bacteria 2721755755 2723843257 280
390 iso_pu_bacteria 2791355196 2793059265 280
391 iso_pu_bacteria 2791355197 2793069178 280
392 iso_pu_bacteria 2824600985 2824607595 280
393 iso_pu_bacteria 2824609381 2824615353 280
394 iso_pu_bacteria 2824617872 2824618804 280
395 iso_pu_bacteria 2824626560 2824628910 280
396 iso_pu_bacteria 2824635225 2824638421 280
397 iso_pu_bacteria 2824644064 2824648053 280
398 iso_pu_bacteria 2824653114 2824657974 280
399 iso_pu_bacteria 2824714736 2824718610 280
400 iso_pu_bacteria 2824723954 2824726012 280
401 iso_pu_bacteria 2844315083 2844321461 280
402 iso_pu_bacteria 2874604998 2874607749 280
403 iso_pu_bacteria 2874628541 2874629599 280
404 iso_pu_bacteria 2879099564 2879102267 280
405 iso_pu_bacteria 2879110137 2879110816 280
406 iso_pu_bacteria 2881364244 2881364588 280
407 iso_pu_bacteria 2885374607 2885374896 280
408 iso_pu_bacteria 2888419890 2888426984 280
409 iso_pu_bacteria 2903748898 2903754310 280
410 iso_pu_bacteria 2906610324 2906611907 280
411 iso_pu_bacteria 2906635258 2906636354 280
412 iso_pu_bacteria 2906660503 2906665421 280
413 iso_pu_bacteria 2908739725 2908740581 280
414 iso_pu_bacteria 2922361189 2922361532 280
415 iso_pu_bacteria 2922393267 2922400113 280
416 iso_pu_bacteria 2922425934 2922427394 280
417 iso_pu_bacteria 2932794094 2932801191 280
418 iso_pu_bacteria 2935630451 2935637562 280
419 iso_pu_bacteria 2941507105 2941514065 280
420 iso_pu_bacteria 2941515067 2941522026 280
421 iso_pu_bacteria 2941523033 2941529764 280
422 iso_pu_bacteria 3005474847 3005477114 280
423 iso_pu_bacteria 3005506211 3005506534 280
424 iso_pu_bacteria 3005710791 3005717565 280
425 iso_pu_bacteria 8006933436 8006938324 280
426 iso_pu_bacteria 8006973647 8006978401 280
427 iso_pu_bacteria 8006984368 8006985103 280
428 iso_pu_bacteria 8019555841 8019560705 280
429 iso_pu_bacteria 8019565922 8019570788 280
430 iso_pu_bacteria 8056673599 8056677562 280
431 iso_pu_bacteria 8056689827 8056695595 280
432 3300005290 Ga0065712_10015931 Ga0065712_100159312 281
433 3300005331 Ga0070670_100006587 Ga0070670_1000065872 281
434 3300005333 Ga0070677_10002073 Ga0070677_100020736 281
435 3300005353 Ga0070669_100046884 Ga0070669_1000468842 281
436 3300005354 Ga0070675_100004170 Ga0070675_1000041703 281
437 3300005355 Ga0070671_100019127 Ga0070671_1000191273 281
438 3300005356 Ga0070674_100002835 Ga0070674_10000283511 281
439 3300005364 Ga0070673_100069351 Ga0070673_1000693513 281
440 3300005367 Ga0070667_100072899 Ga0070667_1000728992 281
441 3300005456 Ga0070678_100001849 Ga0070678_1000018492 281
442 3300005543 Ga0070672_100009725 Ga0070672_1000097255 281
443 3300005618 Ga0068864_100051817 Ga0068864_1000518172 281
444 3300006237 Ga0097621_100142282 Ga0097621_1001422822 281
445 3300021441 Ga0213871_10004272 Ga0213871_100042722 281
446 3300025893 Ga0207682_10020446 Ga0207682_100204463 281
447 3300025925 Ga0207650_10001226 Ga0207650_100012269 281
448 3300025926 Ga0207659_10047511 Ga0207659_100475113 281
449 3300025931 Ga0207644_10012920 Ga0207644_100129202 281
450 3300025937 Ga0207669_10041226 Ga0207669_100412262 281
451 3300025940 Ga0207691_10000090 Ga0207691_100000902 281
452 3300025960 Ga0207651_10004608 Ga0207651_100046084 281
453 3300025986 Ga0207658_10031398 Ga0207658_100313983 281
454 3300026095 Ga0207676_10060408 Ga0207676_100604083 281
455 3300026121 Ga0207683_10019166 Ga0207683_100191665 281
456 3300026142 Ga0207698_10343841 Ga0207698_103438412 281
457 3300028794 Ga0307515_10038014 Ga0307515_100380142 281
458 3300039438 Ga0436360_0208407 Ga0436360_0208407_1569_2498 281
459 3300039447 Ga0436361_0513491 Ga0436361_0513491_2414_3343 281
460 iso_pu_bacteria 2904690495 2904693232 281
461 iso_pu_bacteria 2908756301 2908759304 281
462 3300005937 Ga0081455_10000370 Ga0081455_1000037021 282
463 3300025960 Ga0207651_10000327 Ga0207651_1000032711 282
464 3300048928 Ga0496125_0000243 Ga0496125_0000243_70307_71224 282
465 iso_pu_bacteria 2545555834 2545673368 282
466 iso_pu_bacteria 641522639 641641200 282
467 iso_pu_bacteria 643348564 643599095 282
468 3300005354 Ga0070675_100095804 Ga0070675_1000958043 283
469 3300005445 Ga0070708_100138448 Ga0070708_1001384483 283
470 3300005564 Ga0070664_100134690 Ga0070664_1001346902 283
471 3300006852 Ga0075433_10008607 Ga0075433_100086075 283
472 3300006871 Ga0075434_100017089 Ga0075434_1000170895 283
473 3300006880 Ga0075429_100033217 Ga0075429_1000332174 283
474 3300007076 Ga0075435_100047972 Ga0075435_1000479723 283
475 3300025893 Ga0207682_10054720 Ga0207682_100547202 283
476 3300025910 Ga0207684_10030377 Ga0207684_100303772 283
477 3300025926 Ga0207659_10043645 Ga0207659_100436452 283
478 3300025940 Ga0207691_10149401 Ga0207691_101494012 283
479 3300031731 Ga0307405_10143789 Ga0307405_101437892 283
480 3300031852 Ga0307410_10239673 Ga0307410_102396732 283
481 3300031995 Ga0307409_100006230 Ga0307409_1000062304 283
482 3300032002 Ga0307416_100046020 Ga0307416_1000460202 283
483 3300050507 nmdc:mga05p37_242228_c1 nmdc:mga05p37_242228_c1_674_1615 283
484 3300050508 nmdc:mga09592_218707_c1 nmdc:mga09592_218707_c1_622_1563 283
485 3300050513 nmdc:mga0rr50_160607_c1 nmdc:mga0rr50_160607_c1_780_1721 283
486 3300050515 nmdc:mga0a205_4287_c1 nmdc:mga0a205_4287_c1_8843_9784 283
487 iso_pu_bacteria 3003665799 3003666615 283
488 3300005457 Ga0070662_100278217 Ga0070662_1002782172 284
489 3300009094 Ga0111539_10016141 Ga0111539_100161419 284
490 3300009147 Ga0114129_10028131 Ga0114129_100281312 284
491 3300013308 Ga0157375_10040120 Ga0157375_100401202 284
492 3300025933 Ga0207706_10064655 Ga0207706_100646552 284
493 3300026089 Ga0207648_10167642 Ga0207648_101676422 284
494 3300027907 Ga0207428_10000049 Ga0207428_10000049103 284
495 3300028381 Ga0268264_10413319 Ga0268264_104133191 284
496 3300028666 Ga0265336_10000042 Ga0265336_1000004252 284
497 3300029957 Ga0265324_10000213 Ga0265324_1000021338 284
498 3300035112 Ga0373932_0050939 Ga0373932_0050939_27_971 284
499 3300045051 Ga0451576_0005513 Ga0451576_0005513_7886_8824 284
500 3300046539 Ga0495621_0066412 Ga0495621_0066412_227_1165 284
501 3300048909 Ga0496106_0057156 Ga0496106_0057156_90_1028 284
502 3300049580 Ga0501046_0019777 Ga0501046_0019777_3770_4705 284
503 3300050511 nmdc:mga08y16_190_c1 nmdc:mga08y16_190_c1_45501_46445 284
504 3300003203 JGI25406J46586_10001538 JGI25406J46586_100015387 285
505 3300005435 Ga0070714_100089254 Ga0070714_1000892542 285
506 3300005437 Ga0070710_10008027 Ga0070710_100080273 285
507 3300005441 Ga0070700_100270760 Ga0070700_1002707601 285
508 3300005445 Ga0070708_100314990 Ga0070708_1003149902 285
509 3300005467 Ga0070706_100025976 Ga0070706_1000259761 285
510 3300005467 Ga0070706_100241516 Ga0070706_1002415162 285
511 3300005468 Ga0070707_100002379 Ga0070707_10000237918 285
512 3300005616 Ga0068852_100245630 Ga0068852_1002456302 285
513 3300005985 Ga0081539_10003824 Ga0081539_1000382410 285
514 3300006028 Ga0070717_10046109 Ga0070717_100461092 285
515 3300025910 Ga0207684_10017603 Ga0207684_100176037 285
516 3300025910 Ga0207684_10133541 Ga0207684_101335412 285
517 3300025922 Ga0207646_10001470 Ga0207646_100014703 285
518 3300025931 Ga0207644_10032611 Ga0207644_100326114 285
519 3300025933 Ga0207706_10178533 Ga0207706_101785331 285
520 3300026142 Ga0207698_10036041 Ga0207698_100360413 285
521 3300031731 Ga0307405_10014886 Ga0307405_100148864 285
522 3300031824 Ga0307413_10127217 Ga0307413_101272172 285
523 3300031852 Ga0307410_10018143 Ga0307410_100181432 285
524 3300031903 Ga0307407_10046631 Ga0307407_100466312 285
525 3300031911 Ga0307412_10024623 Ga0307412_100246233 285
526 3300032004 Ga0307414_10010416 Ga0307414_100104165 285
527 3300035171 Ga0373946_0057075 Ga0373946_0057075_487_1425 285
528 3300036401 Ga0373937_0161024 Ga0373937_0161024_382_1320 285
529 3300044712 Ga0453684_0262500 Ga0453684_0262500_608_1540 285
530 3300046683 Ga0495658_0058042 Ga0495658_0058042_1233_2171 285
531 3300046809 Ga0495600_0159626 Ga0495600_0159626_122_1060 285
532 3300048905 Ga0496102_0471551 Ga0496102_0471551_131_1072 285
533 3300048912 Ga0496109_0318562 Ga0496109_0318562_252_1193 285
534 3300049571 Ga0501034_0020767 Ga0501034_0020767_3157_4095 285
535 3300049572 Ga0501036_0151388 Ga0501036_0151388_555_1493 285
536 3300049579 Ga0501043_0006665 Ga0501043_0006665_3857_4795 285
537 3300049581 Ga0501047_0007815 Ga0501047_0007815_5280_6218 285
538 3300049582 Ga0501048_0092331 Ga0501048_0092331_1096_2040 285
539 3300049823 Ga0501044_0051179 Ga0501044_0051179_149_1087 285
540 3300013307 Ga0157372_10501756 Ga0157372_105017562 286
541 3300026116 Ga0207674_10208280 Ga0207674_102082802 286
542 3300028379 Ga0268266_10141537 Ga0268266_101415372 286
543 3300028380 Ga0268265_10077977 Ga0268265_100779772 286
544 3300031649 Ga0307514_10000339 Ga0307514_10000339118 286
545 3300031852 Ga0307410_10176361 Ga0307410_101763612 286
546 3300032004 Ga0307414_10415387 Ga0307414_104153872 286
547 3300035695 Ga0373927_0261672 Ga0373927_0261672_115_1062 286
548 3300037418 Ga0395900_0046685 Ga0395900_0046685_2073_3029 286
549 3300037466 Ga0395898_0002205 Ga0395898_0002205_19722_20678 286
550 3300048908 Ga0496105_0400806 Ga0496105_0400806_23_970 286
551 3300048917 Ga0496114_0026107 Ga0496114_0026107_3361_4308 286
552 iso_pu_bacteria 2889914905 2889918365 286
553 3300005435 Ga0070714_100016146 Ga0070714_1000161464 287
554 3300005518 Ga0070699_100267726 Ga0070699_1002677262 287
555 3300005536 Ga0070697_100092399 Ga0070697_1000923992 287
556 3300005545 Ga0070695_100056862 Ga0070695_1000568623 287
557 3300005548 Ga0070665_100024707 Ga0070665_1000247072 287
558 3300005617 Ga0068859_100026986 Ga0068859_1000269862 287
559 3300006931 Ga0097620_100026987 Ga0097620_1000269872 287
560 3300009553 Ga0105249_10272884 Ga0105249_102728842 287
561 3300025910 Ga0207684_10172713 Ga0207684_101727132 287
562 3300025961 Ga0207712_10356591 Ga0207712_103565911 287
563 3300028379 Ga0268266_10011882 Ga0268266_100118822 287
564 3300028379 Ga0268266_10231960 Ga0268266_102319602 287
565 3300035086 Ga0373934_0126211 Ga0373934_0126211_56_1000 287
566 3300035691 Ga0373931_0086664 Ga0373931_0086664_111_1067 287
567 3300050511 nmdc:mga08y16_378652_c1 nmdc:mga08y16_378652_c1_480_1421 287
568 3300005614 Ga0068856_100154080 Ga0068856_1001540802 288
569 3300014497 Ga0182008_10020965 Ga0182008_100209652 288
570 3300025928 Ga0207700_10311710 Ga0207700_103117102 288
571 3300026035 Ga0207703_10147413 Ga0207703_101474132 288
572 3300035117 Ga0373953_0014557 Ga0373953_0014557_945_1889 288
573 3300035170 Ga0373943_0034790 Ga0373943_0034790_271_1221 288
574 3300035172 Ga0373955_0040933 Ga0373955_0040933_320_1264 288
575 3300035724 Ga0373933_0004917 Ga0373933_0004917_3316_4260 288
576 3300036401 Ga0373937_0016046 Ga0373937_0016046_1732_2676 288
577 3300046533 Ga0495640_0030571 Ga0495640_0030571_2657_3601 288
578 3300046663 Ga0495635_0180323 Ga0495635_0180323_169_1119 288
579 3300047444 Ga0495675_0286733 Ga0495675_0286733_14_958 288
580 3300049586 Ga0501070_0059866 Ga0501070_0059866_1422_2363 288
581 3300049742 Ga0501080_0021641 Ga0501080_0021641_334_1275 288
582 3300049744 Ga0501083_0109311 Ga0501083_0109311_492_1433 288
583 3300053085 Ga0495619_0132043 Ga0495619_0132043_491_1435 288
584 iso_pu_bacteria 2643221733 2644730340 288
585 iso_pu_bacteria 2643221734 2644736311 288
586 iso_pu_bacteria 2643221736 2644746059 288
587 iso_pu_bacteria 2818991467 2819720409 288
588 iso_pu_bacteria 2841760612 2841765282 288
589 iso_pu_bacteria 2844104063 2844106892 288
590 iso_pu_bacteria 2851182111 2851185881 288
591 iso_pu_bacteria 2851246043 2851248932 288
592 iso_pu_bacteria 2917699015 2917702327 288
593 iso_pu_bacteria 8057529695 8057532542 288
594 3300005456 Ga0070678_100011698 Ga0070678_1000116982 290
595 3300025940 Ga0207691_10047951 Ga0207691_100479513 290
596 3300026121 Ga0207683_10105910 Ga0207683_101059102 290
597 3300003771 Ga0055526_1002615 Ga0055526_10026153 291
598 3300005436 Ga0070713_100061563 Ga0070713_1000615631 291
599 3300005439 Ga0070711_100026370 Ga0070711_1000263702 291
600 3300006175 Ga0070712_100209611 Ga0070712_1002096112 291
601 3300025294 Ga0209025_1001592 Ga0209025_10015927 291
602 3300025294 Ga0209025_1051603 Ga0209025_10516031 291
603 3300025295 Ga0209564_1000074 Ga0209564_1000074113 291
604 3300025906 Ga0207699_10046945 Ga0207699_100469453 291
605 3300025915 Ga0207693_10026247 Ga0207693_100262472 291
606 3300035170 Ga0373943_0122772 Ga0373943_0122772_23_973 291
607 3300035692 Ga0373935_0089391 Ga0373935_0089391_227_1177 291
608 3300035695 Ga0373927_0111726 Ga0373927_0111726_666_1616 291
609 3300036401 Ga0373937_0003711 Ga0373937_0003711_5096_6046 291
610 3300037068 Ga0373925_0098325 Ga0373925_0098325_674_1624 291
611 3300046463 Ga0495653_0282749 Ga0495653_0282749_50_1000 291
612 3300048920 Ga0496117_0041047 Ga0496117_0041047_1186_2133 291
613 3300003187 JGI25151J46595_10000015 JGI25151J46595_10000015167 292
614 3300003775 Ga0055524_1000051 Ga0055524_100005139 292
615 3300005262 Ga0065165_1000014 Ga0065165_1000014170 292
616 3300005436 Ga0070713_100083082 Ga0070713_1000830821 292
617 3300025284 Ga0209130_1000024 Ga0209130_1000024104 292
618 3300025291 Ga0209675_1000378 Ga0209675_100037825 292
619 3300025294 Ga0209025_1000010 Ga0209025_1000010693 292
620 3300025295 Ga0209564_1000048 Ga0209564_1000048225 292
621 3300025299 Ga0209256_1000041 Ga0209256_1000041225 292
622 3300025299 Ga0209256_1000109 Ga0209256_1000109150 292
623 3300031901 Ga0307406_10059842 Ga0307406_100598423 292
624 3300048925 Ga0496122_0020976 Ga0496122_0020976_607_1557 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

57

109

0.99

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

129

321

0.95

Feature Viewer

pLDDT pTM Quality
63.38 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map