F470283
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 624 | 386 | 548 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300028380|Ga0268265_10077977|Ga0268265_100779772 |
| Length | 322 |
| Sequence | MAGSTPASATGDAEAGTAAVRPPQLDQGARGVVGLAAHRTAEMAGAPIGLVGRRGVSPWAEAWRRFKRHKLAVASLFVLALMXXAVLLGPTIWKVAINEIDFTARLKPPSFAHPFGTDDLGQDILARMLYGGRISLARGGVDAALMWLTDLFLSLPQLPLLLLIIYLFRDTLKTTFGPEVGVFLLIVAVIGLFRWMPVARLVRAQFFSLREKEFVEAARALGASTSRQVVRHILPNALGPVIVAGTIDVAAAIIAESTLSFLGLGFPPDIPTWGRLLFDAKDHMDIAAHWALFPGAAIFFTVLTINFIGDGLRDALDPRRVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 3 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 4 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 5 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 6 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 7 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 8 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 9 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 10 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 11 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 12 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 13 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 14 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 15 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 16 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 17 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 18 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 19 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 20 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 21 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 22 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 23 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 24 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 25 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 26 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 27 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 28 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 29 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 30 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 31 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 32 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 33 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 34 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 35 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 36 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 37 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 38 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 39 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 40 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 41 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 42 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 43 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 44 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 45 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 46 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 47 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 48 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 49 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 50 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 51 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 52 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 53 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 54 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 55 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 56 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 57 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 58 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 59 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 60 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 61 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 62 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 63 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 64 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 65 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 66 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 68 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 69 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 70 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 71 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 72 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 73 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 77 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 82 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 102 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 103 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 108 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 110 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 116 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 118 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 119 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 120 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 122 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 123 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 124 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 125 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 126 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 127 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 128 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 129 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 130 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 131 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 132 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 134 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 136 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 137 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 138 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 139 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 140 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 141 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 142 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 144 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 145 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 158 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 165 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 170 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 171 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 230 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 231 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 232 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 233 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 238 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 239 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 241 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 242 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 243 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 244 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 245 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 246 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 247 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 248 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 249 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 250 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 251 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 252 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 253 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 254 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 255 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 256 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 257 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 258 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 259 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 260 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 261 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 262 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 263 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 264 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 265 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 268 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 270 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 272 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 274 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 275 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 276 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 277 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 278 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 279 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 281 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 282 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 284 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 285 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 286 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 287 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 288 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 289 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 290 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 291 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 292 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 293 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 294 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 295 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 296 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 297 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 321 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 322 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 323 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 329 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 330 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 331 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 332 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 333 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 334 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 335 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 370 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 372 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 373 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 374 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 377 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 378 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 379 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 380 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 381 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 382 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 383 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 384 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 385 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 386 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.1 |
| Metatranscriptomes | 0 |
| Isolates | 11.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.01 |
| Nodule | 8.01 |
| Rhizoplane | 2.56 |
| Rhizosphere | 77.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000015 | 3300003187 | Bacteria | 250420 |
| 2 | JGI25406J46586_10001538 | 3300003203 | Bacteria | 10890 |
| 3 | Ga0055535_1000125 | 3300003761 | Bacteria | 81678 |
| 4 | Ga0055529_1000266 | 3300003763 | Bacteria | 62097 |
| 5 | Ga0055526_1002615 | 3300003771 | Bacteria | 12033 |
| 6 | Ga0055526_1004093 | 3300003771 | Bacteria | 8909 |
| 7 | Ga0055524_1000051 | 3300003775 | Bacteria | 146215 |
| 8 | Ga0055524_1027579 | 3300003775 | Bacteria | 1720 |
| 9 | Ga0065165_1000014 | 3300005262 | Bacteria | 292366 |
| 10 | Ga0065712_10015931 | 3300005290 | Bacteria | 2106 |
| 11 | Ga0070658_10006666 | 3300005327 | Bacteria | 9357 |
| 12 | Ga0070658_10007485 | 3300005327 | Bacteria | 8810 |
| 13 | Ga0070658_10111994 | 3300005327 | Bacteria | 2262 |
| 14 | Ga0070676_10026886 | 3300005328 | Bacteria | 3258 |
| 15 | Ga0070683_100043839 | 3300005329 | Bacteria | 4123 |
| 16 | Ga0070683_100230178 | 3300005329 | Bacteria | 1762 |
| 17 | Ga0070683_100607939 | 3300005329 | Bacteria | 1046 |
| 18 | Ga0070690_100019065 | 3300005330 | Bacteria | 4156 |
| 19 | Ga0070670_100000757 | 3300005331 | Bacteria | 25060 |
| 20 | Ga0070670_100006587 | 3300005331 | Bacteria | 9843 |
| 21 | Ga0070670_100051866 | 3300005331 | Bacteria | 3522 |
| 22 | Ga0070670_100188471 | 3300005331 | Bacteria | 1791 |
| 23 | Ga0070670_100252458 | 3300005331 | Bacteria | 1537 |
| 24 | Ga0070670_100276930 | 3300005331 | Bacteria | 1465 |
| 25 | Ga0070677_10002073 | 3300005333 | Bacteria | 6389 |
| 26 | Ga0070666_10003353 | 3300005335 | Bacteria | 9714 |
| 27 | Ga0070680_100009124 | 3300005336 | Bacteria | 7607 |
| 28 | Ga0070680_100011564 | 3300005336 | Bacteria | 6833 |
| 29 | Ga0068868_100001471 | 3300005338 | Bacteria | 16271 |
| 30 | Ga0070660_100012301 | 3300005339 | Bacteria | 6107 |
| 31 | Ga0070660_100107010 | 3300005339 | Bacteria | 2222 |
| 32 | Ga0070661_100222352 | 3300005344 | Bacteria | 1449 |
| 33 | Ga0070668_100033710 | 3300005347 | Bacteria | 3901 |
| 34 | Ga0070668_100071699 | 3300005347 | Bacteria | 2699 |
| 35 | Ga0070669_100046884 | 3300005353 | Bacteria | 3152 |
| 36 | Ga0070669_100094316 | 3300005353 | Bacteria | 2249 |
| 37 | Ga0070675_100000817 | 3300005354 | Bacteria | 21947 |
| 38 | Ga0070675_100004170 | 3300005354 | Bacteria | 10975 |
| 39 | Ga0070675_100007385 | 3300005354 | Bacteria | 8488 |
| 40 | Ga0070675_100075083 | 3300005354 | Bacteria | 2809 |
| 41 | Ga0070675_100095804 | 3300005354 | Bacteria | 2492 |
| 42 | Ga0070675_100132682 | 3300005354 | Bacteria | 2123 |
| 43 | Ga0070671_100000285 | 3300005355 | Bacteria | 34428 |
| 44 | Ga0070671_100019127 | 3300005355 | Bacteria | 5571 |
| 45 | Ga0070671_100076387 | 3300005355 | Bacteria | 2798 |
| 46 | Ga0070671_100237676 | 3300005355 | Bacteria | 1546 |
| 47 | Ga0070674_100002835 | 3300005356 | Bacteria | 9582 |
| 48 | Ga0070674_100317626 | 3300005356 | Bacteria | 1248 |
| 49 | Ga0070673_100043247 | 3300005364 | Bacteria | 3479 |
| 50 | Ga0070673_100069351 | 3300005364 | Bacteria | 2825 |
| 51 | Ga0070673_100131783 | 3300005364 | Bacteria | 2098 |
| 52 | Ga0070659_100432940 | 3300005366 | Bacteria | 1113 |
| 53 | Ga0070667_100002131 | 3300005367 | Bacteria | 17457 |
| 54 | Ga0070667_100016645 | 3300005367 | Bacteria | 6085 |
| 55 | Ga0070667_100072899 | 3300005367 | Bacteria | 2927 |
| 56 | Ga0070714_100016146 | 3300005435 | Bacteria | 6023 |
| 57 | Ga0070714_100089254 | 3300005435 | Bacteria | 2698 |
| 58 | Ga0070713_100061563 | 3300005436 | Bacteria | 3140 |
| 59 | Ga0070713_100083082 | 3300005436 | Bacteria | 2737 |
| 60 | Ga0070710_10008027 | 3300005437 | Bacteria | 5131 |
| 61 | Ga0070711_100026370 | 3300005439 | Bacteria | 3808 |
| 62 | Ga0070700_100270760 | 3300005441 | Bacteria | 1227 |
| 63 | Ga0070708_100138448 | 3300005445 | Bacteria | 2256 |
| 64 | Ga0070708_100314990 | 3300005445 | Bacteria | 1474 |
| 65 | Ga0070663_100036099 | 3300005455 | Bacteria | 3433 |
| 66 | Ga0070678_100001849 | 3300005456 | Bacteria | 11408 |
| 67 | Ga0070678_100011698 | 3300005456 | Bacteria | 5426 |
| 68 | Ga0070678_100076876 | 3300005456 | Bacteria | 2516 |
| 69 | Ga0070678_100121908 | 3300005456 | Bacteria | 2057 |
| 70 | Ga0070678_100206576 | 3300005456 | Bacteria | 1624 |
| 71 | Ga0070662_100017341 | 3300005457 | Bacteria | 4854 |
| 72 | Ga0070662_100278217 | 3300005457 | Bacteria | 1354 |
| 73 | Ga0070681_10002841 | 3300005458 | Bacteria | 16008 |
| 74 | Ga0070681_10041436 | 3300005458 | Bacteria | 4615 |
| 75 | Ga0068867_100010057 | 3300005459 | Bacteria | 6666 |
| 76 | Ga0068867_100146410 | 3300005459 | Bacteria | 1852 |
| 77 | Ga0068867_100178978 | 3300005459 | Bacteria | 1685 |
| 78 | Ga0070706_100025976 | 3300005467 | Bacteria | 5389 |
| 79 | Ga0070706_100032002 | 3300005467 | Bacteria | 4850 |
| 80 | Ga0070706_100241516 | 3300005467 | Bacteria | 1686 |
| 81 | Ga0070707_100002379 | 3300005468 | Bacteria | 17956 |
| 82 | Ga0070698_100008329 | 3300005471 | Bacteria | 11206 |
| 83 | Ga0070699_100267726 | 3300005518 | Bacteria | 1529 |
| 84 | Ga0070679_100013328 | 3300005530 | Bacteria | 7872 |
| 85 | Ga0070679_100042738 | 3300005530 | Bacteria | 4514 |
| 86 | Ga0070697_100092399 | 3300005536 | Bacteria | 2504 |
| 87 | Ga0068853_100028368 | 3300005539 | Bacteria | 4708 |
| 88 | Ga0068853_100297676 | 3300005539 | Bacteria | 1490 |
| 89 | Ga0070672_100009725 | 3300005543 | Bacteria | 6640 |
| 90 | Ga0070672_100014255 | 3300005543 | Bacteria | 5629 |
| 91 | Ga0070672_100159752 | 3300005543 | Bacteria | 1869 |
| 92 | Ga0070672_100242730 | 3300005543 | Bacteria | 1515 |
| 93 | Ga0070695_100056862 | 3300005545 | Bacteria | 2526 |
| 94 | Ga0070696_100064639 | 3300005546 | Bacteria | 2564 |
| 95 | Ga0070693_100028772 | 3300005547 | Bacteria | 3024 |
| 96 | Ga0070665_100024707 | 3300005548 | Bacteria | 6054 |
| 97 | Ga0070665_100201777 | 3300005548 | Bacteria | 1989 |
| 98 | Ga0068855_100012231 | 3300005563 | Bacteria | 10373 |
| 99 | Ga0070664_100134690 | 3300005564 | Bacteria | 2171 |
| 100 | Ga0070664_100138193 | 3300005564 | Bacteria | 2144 |
| 101 | Ga0070664_100156521 | 3300005564 | Bacteria | 2014 |
| 102 | Ga0068857_100020969 | 3300005577 | Bacteria | 5750 |
| 103 | Ga0068854_100224524 | 3300005578 | Bacteria | 1488 |
| 104 | Ga0068856_100154080 | 3300005614 | Bacteria | 2308 |
| 105 | Ga0068856_100186105 | 3300005614 | Bacteria | 2090 |
| 106 | Ga0068856_100462279 | 3300005614 | Bacteria | 1290 |
| 107 | Ga0070702_100061441 | 3300005615 | Bacteria | 2188 |
| 108 | Ga0068852_100245630 | 3300005616 | Bacteria | 1713 |
| 109 | Ga0068859_100026986 | 3300005617 | Bacteria | 5761 |
| 110 | Ga0068859_100050451 | 3300005617 | Bacteria | 4180 |
| 111 | Ga0068859_100235456 | 3300005617 | Bacteria | 1919 |
| 112 | Ga0068864_100001465 | 3300005618 | Bacteria | 19452 |
| 113 | Ga0068864_100014494 | 3300005618 | Bacteria | 6547 |
| 114 | Ga0068864_100035977 | 3300005618 | Bacteria | 4218 |
| 115 | Ga0068864_100051817 | 3300005618 | Bacteria | 3536 |
| 116 | Ga0068864_100198788 | 3300005618 | Bacteria | 1840 |
| 117 | Ga0068861_100012878 | 3300005719 | Bacteria | 5839 |
| 118 | Ga0068861_100030764 | 3300005719 | Bacteria | 3936 |
| 119 | Ga0068861_100136528 | 3300005719 | Bacteria | 1996 |
| 120 | Ga0068851_10039036 | 3300005834 | Bacteria | 2384 |
| 121 | Ga0068863_100026019 | 3300005841 | Bacteria | 5583 |
| 122 | Ga0068863_100204022 | 3300005841 | Bacteria | 1902 |
| 123 | Ga0068863_100261103 | 3300005841 | Bacteria | 1674 |
| 124 | Ga0068863_100389571 | 3300005841 | Bacteria | 1361 |
| 125 | Ga0068858_100001383 | 3300005842 | Bacteria | 25002 |
| 126 | Ga0068860_100000590 | 3300005843 | Bacteria | 43453 |
| 127 | Ga0068862_100032721 | 3300005844 | Bacteria | 4393 |
| 128 | Ga0068862_100235069 | 3300005844 | Bacteria | 1664 |
| 129 | Ga0081455_10000370 | 3300005937 | Bacteria | 59432 |
| 130 | Ga0081455_10008796 | 3300005937 | Bacteria | 10452 |
| 131 | Ga0081455_10083343 | 3300005937 | Bacteria | 2613 |
| 132 | Ga0081539_10003824 | 3300005985 | Bacteria | 17697 |
| 133 | Ga0081539_10030355 | 3300005985 | Bacteria | 3357 |
| 134 | Ga0070717_10046109 | 3300006028 | Bacteria | 3565 |
| 135 | Ga0070712_100209611 | 3300006175 | Bacteria | 1536 |
| 136 | Ga0097621_100069169 | 3300006237 | Bacteria | 2914 |
| 137 | Ga0097621_100142282 | 3300006237 | Bacteria | 2050 |
| 138 | Ga0068871_100073525 | 3300006358 | Bacteria | 2818 |
| 139 | Ga0068871_100213809 | 3300006358 | Bacteria | 1668 |
| 140 | Ga0075428_100068071 | 3300006844 | Bacteria | 3896 |
| 141 | Ga0075431_100031310 | 3300006847 | Bacteria | 5479 |
| 142 | Ga0075433_10004040 | 3300006852 | Bacteria | 11353 |
| 143 | Ga0075433_10008607 | 3300006852 | Bacteria | 8141 |
| 144 | Ga0075434_100017089 | 3300006871 | Bacteria | 6982 |
| 145 | Ga0075429_100033217 | 3300006880 | Bacteria | 4483 |
| 146 | Ga0068865_100023491 | 3300006881 | Bacteria | 4037 |
| 147 | Ga0068865_100075594 | 3300006881 | Bacteria | 2402 |
| 148 | Ga0097620_100026987 | 3300006931 | Bacteria | 5761 |
| 149 | Ga0097620_100050450 | 3300006931 | Bacteria | 4180 |
| 150 | Ga0097620_100235464 | 3300006931 | Bacteria | 1919 |
| 151 | Ga0099824_1020738 | 3300006942 | Bacteria | 4753 |
| 152 | Ga0075435_100047972 | 3300007076 | Bacteria | 3429 |
| 153 | Ga0105240_10003533 | 3300009093 | Bacteria | 24249 |
| 154 | Ga0105240_10012127 | 3300009093 | Bacteria | 11933 |
| 155 | Ga0111539_10004086 | 3300009094 | Bacteria | 19146 |
| 156 | Ga0111539_10016141 | 3300009094 | Bacteria | 9266 |
| 157 | Ga0111539_10125922 | 3300009094 | Bacteria | 3002 |
| 158 | Ga0114129_10028131 | 3300009147 | Bacteria | 7965 |
| 159 | Ga0105243_10103828 | 3300009148 | Bacteria | 2364 |
| 160 | Ga0105248_10047576 | 3300009177 | Bacteria | 4810 |
| 161 | Ga0105248_10064899 | 3300009177 | Bacteria | 4099 |
| 162 | Ga0105237_10151724 | 3300009545 | Bacteria | 2314 |
| 163 | Ga0105238_10002653 | 3300009551 | Bacteria | 17798 |
| 164 | Ga0105249_10016504 | 3300009553 | Bacteria | 6550 |
| 165 | Ga0105249_10227500 | 3300009553 | Bacteria | 1838 |
| 166 | Ga0105249_10272884 | 3300009553 | Bacteria | 1685 |
| 167 | Ga0105239_10052352 | 3300010375 | Bacteria | 4477 |
| 168 | Ga0157373_10108531 | 3300013100 | Bacteria | 1951 |
| 169 | Ga0157370_10020086 | 3300013104 | Bacteria | 6680 |
| 170 | Ga0157369_10010670 | 3300013105 | Bacteria | 10456 |
| 171 | Ga0171462_1007 | 3300013250 | Bacteria | 417698 |
| 172 | Ga0157378_10018935 | 3300013297 | Bacteria | 6051 |
| 173 | Ga0163162_10067480 | 3300013306 | Bacteria | 3627 |
| 174 | Ga0163162_10345500 | 3300013306 | Bacteria | 1620 |
| 175 | Ga0157372_10501756 | 3300013307 | Bacteria | 1415 |
| 176 | Ga0157375_10040120 | 3300013308 | Bacteria | 4511 |
| 177 | Ga0157375_10052057 | 3300013308 | Bacteria | 4024 |
| 178 | Ga0157375_10218341 | 3300013308 | Bacteria | 2065 |
| 179 | Ga0163163_10400097 | 3300014325 | Bacteria | 1431 |
| 180 | Ga0157380_10085184 | 3300014326 | Bacteria | 2593 |
| 181 | Ga0157380_10692160 | 3300014326 | Bacteria | 1023 |
| 182 | Ga0182008_10020965 | 3300014497 | Bacteria | 3361 |
| 183 | Ga0157377_10005668 | 3300014745 | Bacteria | 5885 |
| 184 | Ga0157379_10040572 | 3300014968 | Bacteria | 4155 |
| 185 | Ga0157379_10240282 | 3300014968 | Bacteria | 1643 |
| 186 | Ga0157376_10011864 | 3300014969 | Bacteria | 6441 |
| 187 | Ga0157376_10015816 | 3300014969 | Bacteria | 5710 |
| 188 | Ga0163161_10062877 | 3300017792 | Bacteria | 2704 |
| 189 | Ga0213875_10000003 | 3300021388 | Bacteria | 719367 |
| 190 | Ga0213871_10004272 | 3300021441 | Bacteria | 2845 |
| 191 | Ga0209148_1007501 | 3300025254 | Bacteria | 2262 |
| 192 | Ga0209759_1001594 | 3300025256 | Bacteria | 12279 |
| 193 | Ga0209455_1000030 | 3300025272 | Bacteria | 533479 |
| 194 | Ga0209130_1000024 | 3300025284 | Bacteria | 354212 |
| 195 | Ga0209675_1000378 | 3300025291 | Bacteria | 37093 |
| 196 | Ga0209025_1000010 | 3300025294 | Bacteria | 986612 |
| 197 | Ga0209025_1001592 | 3300025294 | Bacteria | 28567 |
| 198 | Ga0209025_1051603 | 3300025294 | Bacteria | 1632 |
| 199 | Ga0209564_1000048 | 3300025295 | Bacteria | 364806 |
| 200 | Ga0209564_1000074 | 3300025295 | Bacteria | 286043 |
| 201 | Ga0209256_1000041 | 3300025299 | Bacteria | 364827 |
| 202 | Ga0209256_1000109 | 3300025299 | Bacteria | 184928 |
| 203 | Ga0207697_10050176 | 3300025315 | Bacteria | 1723 |
| 204 | Ga0207656_10012166 | 3300025321 | Bacteria | 3267 |
| 205 | Ga0207656_10022456 | 3300025321 | Bacteria | 2532 |
| 206 | Ga0207682_10020446 | 3300025893 | Bacteria | 2599 |
| 207 | Ga0207682_10032345 | 3300025893 | Bacteria | 2102 |
| 208 | Ga0207682_10054720 | 3300025893 | Bacteria | 1659 |
| 209 | Ga0207692_10095124 | 3300025898 | Bacteria | 1624 |
| 210 | Ga0207680_10070442 | 3300025903 | Bacteria | 2164 |
| 211 | Ga0207680_10113863 | 3300025903 | Bacteria | 1759 |
| 212 | Ga0207699_10046945 | 3300025906 | Bacteria | 2529 |
| 213 | Ga0207645_10006813 | 3300025907 | Bacteria | 8156 |
| 214 | Ga0207645_10024881 | 3300025907 | Bacteria | 3879 |
| 215 | Ga0207705_10040345 | 3300025909 | Bacteria | 3348 |
| 216 | Ga0207705_10068814 | 3300025909 | Bacteria | 2564 |
| 217 | Ga0207705_10085966 | 3300025909 | Bacteria | 2298 |
| 218 | Ga0207684_10017603 | 3300025910 | Bacteria | 6129 |
| 219 | Ga0207684_10030377 | 3300025910 | Bacteria | 4599 |
| 220 | Ga0207684_10133541 | 3300025910 | Bacteria | 2130 |
| 221 | Ga0207684_10172713 | 3300025910 | Bacteria | 1863 |
| 222 | Ga0207707_10016025 | 3300025912 | Bacteria | 6537 |
| 223 | Ga0207707_10057244 | 3300025912 | Bacteria | 3393 |
| 224 | Ga0207695_10022997 | 3300025913 | Bacteria | 7059 |
| 225 | Ga0207695_10049892 | 3300025913 | Bacteria | 4406 |
| 226 | Ga0207671_10195865 | 3300025914 | Bacteria | 1577 |
| 227 | Ga0207693_10026247 | 3300025915 | Bacteria | 4611 |
| 228 | Ga0207660_10008937 | 3300025917 | Bacteria | 6483 |
| 229 | Ga0207660_10026443 | 3300025917 | Bacteria | 3952 |
| 230 | Ga0207657_10007756 | 3300025919 | Bacteria | 10963 |
| 231 | Ga0207657_10129568 | 3300025919 | Bacteria | 2069 |
| 232 | Ga0207652_10009010 | 3300025921 | Bacteria | 8042 |
| 233 | Ga0207646_10001470 | 3300025922 | Bacteria | 29142 |
| 234 | Ga0207646_10079522 | 3300025922 | Bacteria | 2931 |
| 235 | Ga0207681_10006481 | 3300025923 | Bacteria | 7188 |
| 236 | Ga0207681_10118299 | 3300025923 | Bacteria | 1939 |
| 237 | Ga0207694_10044983 | 3300025924 | Bacteria | 3409 |
| 238 | Ga0207650_10001226 | 3300025925 | Bacteria | 18753 |
| 239 | Ga0207650_10001840 | 3300025925 | Bacteria | 14970 |
| 240 | Ga0207650_10049553 | 3300025925 | Bacteria | 3102 |
| 241 | Ga0207659_10018397 | 3300025926 | Bacteria | 4581 |
| 242 | Ga0207659_10020094 | 3300025926 | Bacteria | 4407 |
| 243 | Ga0207659_10043645 | 3300025926 | Bacteria | 3150 |
| 244 | Ga0207659_10047511 | 3300025926 | Bacteria | 3036 |
| 245 | Ga0207700_10056838 | 3300025928 | Bacteria | 2947 |
| 246 | Ga0207700_10311710 | 3300025928 | Bacteria | 1361 |
| 247 | Ga0207644_10000317 | 3300025931 | Bacteria | 31456 |
| 248 | Ga0207644_10012920 | 3300025931 | Bacteria | 5552 |
| 249 | Ga0207644_10032611 | 3300025931 | Bacteria | 3635 |
| 250 | Ga0207706_10004572 | 3300025933 | Bacteria | 12986 |
| 251 | Ga0207706_10026885 | 3300025933 | Bacteria | 5150 |
| 252 | Ga0207706_10064655 | 3300025933 | Bacteria | 3221 |
| 253 | Ga0207706_10178533 | 3300025933 | Bacteria | 1865 |
| 254 | Ga0207686_10018274 | 3300025934 | Bacteria | 3968 |
| 255 | Ga0207669_10041226 | 3300025937 | Bacteria | 2685 |
| 256 | Ga0207704_10114815 | 3300025938 | Bacteria | 1829 |
| 257 | Ga0207665_10077278 | 3300025939 | Bacteria | 2285 |
| 258 | Ga0207691_10000090 | 3300025940 | Bacteria | 77582 |
| 259 | Ga0207691_10037329 | 3300025940 | Bacteria | 4499 |
| 260 | Ga0207691_10047951 | 3300025940 | Bacteria | 3918 |
| 261 | Ga0207691_10084335 | 3300025940 | Bacteria | 2852 |
| 262 | Ga0207691_10149401 | 3300025940 | Bacteria | 2055 |
| 263 | Ga0207691_10151753 | 3300025940 | Bacteria | 2037 |
| 264 | Ga0207691_10168394 | 3300025940 | Bacteria | 1919 |
| 265 | Ga0207691_10229054 | 3300025940 | Bacteria | 1610 |
| 266 | Ga0207711_10012299 | 3300025941 | Bacteria | 7115 |
| 267 | Ga0207711_10055449 | 3300025941 | Bacteria | 3403 |
| 268 | Ga0207711_10234703 | 3300025941 | Bacteria | 1681 |
| 269 | Ga0207689_10000735 | 3300025942 | Bacteria | 31549 |
| 270 | Ga0207661_10109597 | 3300025944 | Bacteria | 2332 |
| 271 | Ga0207679_10057351 | 3300025945 | Bacteria | 2880 |
| 272 | Ga0207679_10064127 | 3300025945 | Bacteria | 2745 |
| 273 | Ga0207667_10021341 | 3300025949 | Bacteria | 7177 |
| 274 | Ga0207667_10024662 | 3300025949 | Bacteria | 6598 |
| 275 | Ga0207651_10000327 | 3300025960 | Bacteria | 20323 |
| 276 | Ga0207651_10004608 | 3300025960 | Bacteria | 6980 |
| 277 | Ga0207651_10015165 | 3300025960 | Bacteria | 4470 |
| 278 | Ga0207651_10043012 | 3300025960 | Bacteria | 3011 |
| 279 | Ga0207712_10018812 | 3300025961 | Bacteria | 4504 |
| 280 | Ga0207712_10356591 | 3300025961 | Bacteria | 1217 |
| 281 | Ga0207668_10006559 | 3300025972 | Bacteria | 6878 |
| 282 | Ga0207668_10010800 | 3300025972 | Bacteria | 5531 |
| 283 | Ga0207640_10179538 | 3300025981 | Bacteria | 1586 |
| 284 | Ga0207658_10002716 | 3300025986 | Bacteria | 12776 |
| 285 | Ga0207658_10031398 | 3300025986 | Bacteria | 3771 |
| 286 | Ga0207677_10004266 | 3300026023 | Bacteria | 7646 |
| 287 | Ga0207677_10009883 | 3300026023 | Bacteria | 5380 |
| 288 | Ga0207677_10170477 | 3300026023 | Bacteria | 1701 |
| 289 | Ga0207703_10002402 | 3300026035 | Bacteria | 16278 |
| 290 | Ga0207703_10147413 | 3300026035 | Bacteria | 2048 |
| 291 | Ga0207678_10022457 | 3300026067 | Bacteria | 5525 |
| 292 | Ga0207678_10038674 | 3300026067 | Bacteria | 4144 |
| 293 | Ga0207708_10053675 | 3300026075 | Bacteria | 3071 |
| 294 | Ga0207641_10035597 | 3300026088 | Bacteria | 4149 |
| 295 | Ga0207641_10043575 | 3300026088 | Bacteria | 3769 |
| 296 | Ga0207641_10147506 | 3300026088 | Bacteria | 2128 |
| 297 | Ga0207641_10162638 | 3300026088 | Bacteria | 2030 |
| 298 | Ga0207648_10000842 | 3300026089 | Bacteria | 34576 |
| 299 | Ga0207648_10125398 | 3300026089 | Bacteria | 2259 |
| 300 | Ga0207648_10167642 | 3300026089 | Bacteria | 1941 |
| 301 | Ga0207648_10205043 | 3300026089 | Bacteria | 1750 |
| 302 | Ga0207676_10016655 | 3300026095 | Bacteria | 5324 |
| 303 | Ga0207676_10060408 | 3300026095 | Bacteria | 2998 |
| 304 | Ga0207674_10031036 | 3300026116 | Bacteria | 5616 |
| 305 | Ga0207674_10208280 | 3300026116 | Bacteria | 1905 |
| 306 | Ga0207675_100005811 | 3300026118 | Bacteria | 11789 |
| 307 | Ga0207675_100103371 | 3300026118 | Bacteria | 2685 |
| 308 | Ga0207683_10019166 | 3300026121 | Bacteria | 5841 |
| 309 | Ga0207683_10105910 | 3300026121 | Bacteria | 2514 |
| 310 | Ga0207683_10261960 | 3300026121 | Bacteria | 1579 |
| 311 | Ga0207683_10271670 | 3300026121 | Bacteria | 1549 |
| 312 | Ga0207683_10385111 | 3300026121 | Bacteria | 1289 |
| 313 | Ga0207698_10036041 | 3300026142 | Bacteria | 3626 |
| 314 | Ga0207698_10078288 | 3300026142 | Bacteria | 2654 |
| 315 | Ga0207698_10096289 | 3300026142 | Bacteria | 2439 |
| 316 | Ga0207698_10206752 | 3300026142 | Bacteria | 1763 |
| 317 | Ga0207698_10343841 | 3300026142 | Bacteria | 1406 |
| 318 | Ga0209589_1000002 | 3300027357 | Bacteria | 708598 |
| 319 | Ga0209489_100002 | 3300027361 | Bacteria | 708609 |
| 320 | Ga0209700_100002 | 3300027363 | Bacteria | 708598 |
| 321 | Ga0207428_10000049 | 3300027907 | Bacteria | 179267 |
| 322 | Ga0207428_10005387 | 3300027907 | Bacteria | 11937 |
| 323 | Ga0207428_10013198 | 3300027907 | Bacteria | 7231 |
| 324 | Ga0268266_10011882 | 3300028379 | Bacteria | 7541 |
| 325 | Ga0268266_10141537 | 3300028379 | Bacteria | 2159 |
| 326 | Ga0268266_10231960 | 3300028379 | Bacteria | 1700 |
| 327 | Ga0268266_10502313 | 3300028379 | Bacteria | 1158 |
| 328 | Ga0268265_10031287 | 3300028380 | Bacteria | 3842 |
| 329 | Ga0268265_10073695 | 3300028380 | Bacteria | 2667 |
| 330 | Ga0268265_10077977 | 3300028380 | Bacteria | 2604 |
| 331 | Ga0268264_10009099 | 3300028381 | Bacteria | 8236 |
| 332 | Ga0268264_10364877 | 3300028381 | Bacteria | 1379 |
| 333 | Ga0268264_10413319 | 3300028381 | Bacteria | 1299 |
| 334 | Ga0265334_10020990 | 3300028573 | Bacteria | 2670 |
| 335 | Ga0265336_10000042 | 3300028666 | Bacteria | 136760 |
| 336 | Ga0307515_10038014 | 3300028794 | Bacteria | 7717 |
| 337 | Ga0265324_10000213 | 3300029957 | Bacteria | 44530 |
| 338 | Ga0307511_10054382 | 3300030521 | Bacteria | 3157 |
| 339 | Ga0307513_10010247 | 3300031456 | Bacteria | 11767 |
| 340 | Ga0307509_10027844 | 3300031507 | Bacteria | 6286 |
| 341 | Ga0307508_10018371 | 3300031616 | Bacteria | 6357 |
| 342 | Ga0307514_10000339 | 3300031649 | Bacteria | 111130 |
| 343 | Ga0316575_10031754 | 3300031665 | Bacteria | 2067 |
| 344 | Ga0316579_10004495 | 3300031691 | Bacteria | 5544 |
| 345 | Ga0316579_10030880 | 3300031691 | Bacteria | 2450 |
| 346 | Ga0316579_10121166 | 3300031691 | Bacteria | 1257 |
| 347 | Ga0316576_10009720 | 3300031727 | Bacteria | 6222 |
| 348 | Ga0316576_10322225 | 3300031727 | Bacteria | 1153 |
| 349 | Ga0316578_10035292 | 3300031728 | Bacteria | 2874 |
| 350 | Ga0307516_10000669 | 3300031730 | Bacteria | 46347 |
| 351 | Ga0307405_10014886 | 3300031731 | Bacteria | 4197 |
| 352 | Ga0307405_10143789 | 3300031731 | Bacteria | 1667 |
| 353 | Ga0316577_10002137 | 3300031733 | Bacteria | 9668 |
| 354 | Ga0316577_10002905 | 3300031733 | Bacteria | 8567 |
| 355 | Ga0316577_10037087 | 3300031733 | Bacteria | 2726 |
| 356 | Ga0316577_10063247 | 3300031733 | Bacteria | 2066 |
| 357 | Ga0307413_10127217 | 3300031824 | Bacteria | 1737 |
| 358 | Ga0307410_10010061 | 3300031852 | Bacteria | 5340 |
| 359 | Ga0307410_10018143 | 3300031852 | Bacteria | 4246 |
| 360 | Ga0307410_10176361 | 3300031852 | Bacteria | 1615 |
| 361 | Ga0307410_10239673 | 3300031852 | Bacteria | 1405 |
| 362 | Ga0307406_10059842 | 3300031901 | Bacteria | 2454 |
| 363 | Ga0307406_10174850 | 3300031901 | Bacteria | 1558 |
| 364 | Ga0307407_10046631 | 3300031903 | Bacteria | 2455 |
| 365 | Ga0307412_10024623 | 3300031911 | Bacteria | 3717 |
| 366 | Ga0307409_100006230 | 3300031995 | Bacteria | 6985 |
| 367 | Ga0307416_100022926 | 3300032002 | Bacteria | 4519 |
| 368 | Ga0307416_100046020 | 3300032002 | Bacteria | 3440 |
| 369 | Ga0307414_10010416 | 3300032004 | Bacteria | 5393 |
| 370 | Ga0307414_10415387 | 3300032004 | Bacteria | 1172 |
| 371 | Ga0307411_10390046 | 3300032005 | Bacteria | 1148 |
| 372 | Ga0316585_10008215 | 3300032137 | Bacteria | 3024 |
| 373 | Ga0316580_10027258 | 3300032139 | Bacteria | 1767 |
| 374 | Ga0307507_10032790 | 3300033179 | Bacteria | 5412 |
| 375 | Ga0315911_1000007 | 3300033442 | Bacteria | 413725 |
| 376 | Ga0373934_0126211 | 3300035086 | Bacteria | 1042 |
| 377 | Ga0373940_0007313 | 3300035088 | Bacteria | 2488 |
| 378 | Ga0373923_0091369 | 3300035111 | Bacteria | 1332 |
| 379 | Ga0373932_0049415 | 3300035112 | Bacteria | 1243 |
| 380 | Ga0373932_0050939 | 3300035112 | Bacteria | 1228 |
| 381 | Ga0373953_0014557 | 3300035117 | Bacteria | 2832 |
| 382 | Ga0373956_0130002 | 3300035119 | Bacteria | 1179 |
| 383 | Ga0373943_0034790 | 3300035170 | Bacteria | 2405 |
| 384 | Ga0373943_0122772 | 3300035170 | Bacteria | 1382 |
| 385 | Ga0373946_0057075 | 3300035171 | Bacteria | 1651 |
| 386 | Ga0373955_0040933 | 3300035172 | Bacteria | 2481 |
| 387 | Ga0373955_0133683 | 3300035172 | Bacteria | 1450 |
| 388 | Ga0373955_0156017 | 3300035172 | Bacteria | 1345 |
| 389 | Ga0316574_0171084 | 3300035398 | Bacteria | 1398 |
| 390 | Ga0373931_0026627 | 3300035691 | Bacteria | 2945 |
| 391 | Ga0373931_0032759 | 3300035691 | Bacteria | 2690 |
| 392 | Ga0373931_0086664 | 3300035691 | Bacteria | 1738 |
| 393 | Ga0373935_0035719 | 3300035692 | Bacteria | 3103 |
| 394 | Ga0373935_0089391 | 3300035692 | Bacteria | 2014 |
| 395 | Ga0373935_0404198 | 3300035692 | Bacteria | 981 |
| 396 | Ga0373927_0010615 | 3300035695 | Bacteria | 6138 |
| 397 | Ga0373927_0069340 | 3300035695 | Bacteria | 2282 |
| 398 | Ga0373927_0111726 | 3300035695 | Bacteria | 1781 |
| 399 | Ga0373927_0261672 | 3300035695 | Bacteria | 1138 |
| 400 | Ga0373933_0004917 | 3300035724 | Bacteria | 7293 |
| 401 | Ga0373933_0080962 | 3300035724 | Bacteria | 1991 |
| 402 | Ga0373937_0003711 | 3300036401 | Bacteria | 12899 |
| 403 | Ga0373937_0016046 | 3300036401 | Bacteria | 6643 |
| 404 | Ga0373937_0040382 | 3300036401 | Bacteria | 4253 |
| 405 | Ga0373937_0106992 | 3300036401 | Bacteria | 2600 |
| 406 | Ga0373937_0161024 | 3300036401 | Bacteria | 2104 |
| 407 | Ga0316582_0000152 | 3300036647 | Bacteria | 20917 |
| 408 | Ga0316582_0051402 | 3300036647 | Bacteria | 2615 |
| 409 | Ga0316582_0053628 | 3300036647 | Bacteria | 2565 |
| 410 | Ga0316582_0070137 | 3300036647 | Bacteria | 2267 |
| 411 | Ga0316584_0001806 | 3300036712 | Bacteria | 13219 |
| 412 | Ga0316584_0008542 | 3300036712 | Bacteria | 7059 |
| 413 | Ga0316584_0013977 | 3300036712 | Bacteria | 5699 |
| 414 | Ga0373925_0001453 | 3300037068 | Bacteria | 20460 |
| 415 | Ga0373925_0007427 | 3300037068 | Bacteria | 7997 |
| 416 | Ga0373925_0098325 | 3300037068 | Bacteria | 2246 |
| 417 | Ga0373925_0135538 | 3300037068 | Bacteria | 1924 |
| 418 | Ga0395899_0001159 | 3300037312 | Bacteria | 23305 |
| 419 | Ga0395899_0062362 | 3300037312 | Bacteria | 2745 |
| 420 | Ga0395900_0046685 | 3300037418 | Bacteria | 4460 |
| 421 | Ga0395898_0002205 | 3300037466 | Bacteria | 23788 |
| 422 | Ga0316581_0000131 | 3300037588 | Bacteria | 11079 |
| 423 | Ga0316581_0006644 | 3300037588 | Bacteria | 3070 |
| 424 | Ga0316581_0021000 | 3300037588 | Bacteria | 1916 |
| 425 | Ga0436364_0837883 | 3300037853 | Bacteria | 1609 |
| 426 | Ga0436364_0960990 | 3300037853 | Bacteria | 25250 |
| 427 | Ga0395901_0058531 | 3300038443 | Bacteria | 4007 |
| 428 | Ga0436360_0208407 | 3300039438 | Bacteria | 3275 |
| 429 | Ga0436360_0445758 | 3300039438 | Bacteria | 1233 |
| 430 | Ga0436360_1065138 | 3300039438 | Bacteria | 1418 |
| 431 | Ga0436361_0513491 | 3300039447 | Bacteria | 4789 |
| 432 | Ga0439464_0001490 | 3300042439 | Bacteria | 5530 |
| 433 | Ga0450893_0004958 | 3300042532 | Bacteria | 2126 |
| 434 | Ga0451577_0004779 | 3300042876 | Bacteria | 14161 |
| 435 | Ga0451577_0111081 | 3300042876 | Bacteria | 2452 |
| 436 | Ga0453683_0014124 | 3300044673 | Bacteria | 5192 |
| 437 | Ga0453684_0005806 | 3300044712 | Bacteria | 24055 |
| 438 | Ga0453684_0262500 | 3300044712 | Bacteria | 1977 |
| 439 | Ga0451576_0005513 | 3300045051 | Bacteria | 15810 |
| 440 | Ga0451576_0062837 | 3300045051 | Bacteria | 3870 |
| 441 | Ga0451576_0078142 | 3300045051 | Bacteria | 3444 |
| 442 | Ga0495653_0282749 | 3300046463 | Bacteria | 1088 |
| 443 | Ga0495650_0013732 | 3300046471 | Bacteria | 4263 |
| 444 | Ga0495639_0021981 | 3300046475 | Bacteria | 2796 |
| 445 | Ga0495664_0004084 | 3300046477 | Bacteria | 7963 |
| 446 | Ga0495608_0029382 | 3300046511 | Bacteria | 3729 |
| 447 | Ga0495652_0374704 | 3300046529 | Bacteria | 1014 |
| 448 | Ga0495640_0030571 | 3300046533 | Bacteria | 3855 |
| 449 | Ga0495586_0022472 | 3300046535 | Bacteria | 3366 |
| 450 | Ga0495587_0008866 | 3300046536 | Bacteria | 6455 |
| 451 | Ga0495621_0003372 | 3300046539 | Bacteria | 4407 |
| 452 | Ga0495621_0037223 | 3300046539 | Bacteria | 1691 |
| 453 | Ga0495621_0066412 | 3300046539 | Bacteria | 1320 |
| 454 | Ga0495645_0000948 | 3300046543 | Bacteria | 19815 |
| 455 | Ga0495622_0029722 | 3300046557 | Bacteria | 2553 |
| 456 | Ga0495667_0004591 | 3300046559 | Bacteria | 9337 |
| 457 | Ga0495635_0021420 | 3300046663 | Bacteria | 4504 |
| 458 | Ga0495635_0180323 | 3300046663 | Bacteria | 1436 |
| 459 | Ga0495657_0093237 | 3300046675 | Bacteria | 1928 |
| 460 | Ga0495599_0015847 | 3300046678 | Bacteria | 4680 |
| 461 | Ga0495646_0005751 | 3300046680 | Bacteria | 7859 |
| 462 | Ga0495646_0058442 | 3300046680 | Bacteria | 2306 |
| 463 | Ga0495658_0021911 | 3300046683 | Bacteria | 3373 |
| 464 | Ga0495658_0058042 | 3300046683 | Bacteria | 2213 |
| 465 | Ga0495658_0185774 | 3300046683 | Bacteria | 1291 |
| 466 | Ga0495600_0159626 | 3300046809 | Bacteria | 1458 |
| 467 | Ga0495604_0166413 | 3300047317 | Bacteria | 1554 |
| 468 | Ga0495675_0286733 | 3300047444 | Bacteria | 981 |
| 469 | Ga0495602_0003095 | 3300048088 | Bacteria | 17102 |
| 470 | Ga0496101_0054891 | 3300048904 | Bacteria | 2876 |
| 471 | Ga0496102_0471551 | 3300048905 | Bacteria | 1176 |
| 472 | Ga0496104_0096825 | 3300048907 | Bacteria | 2823 |
| 473 | Ga0496105_0084176 | 3300048908 | Bacteria | 2627 |
| 474 | Ga0496105_0400806 | 3300048908 | Bacteria | 1089 |
| 475 | Ga0496106_0057156 | 3300048909 | Bacteria | 2950 |
| 476 | Ga0496108_0133369 | 3300048911 | Bacteria | 2135 |
| 477 | Ga0496108_0165651 | 3300048911 | Bacteria | 1911 |
| 478 | Ga0496108_0227466 | 3300048911 | Bacteria | 1621 |
| 479 | Ga0496109_0163484 | 3300048912 | Bacteria | 2086 |
| 480 | Ga0496109_0318562 | 3300048912 | Bacteria | 1467 |
| 481 | Ga0496110_0420740 | 3300048913 | Bacteria | 1218 |
| 482 | Ga0496114_0026107 | 3300048917 | Bacteria | 4780 |
| 483 | Ga0496114_0401897 | 3300048917 | Bacteria | 1213 |
| 484 | Ga0496115_0112119 | 3300048918 | Bacteria | 2241 |
| 485 | Ga0496117_0041047 | 3300048920 | Bacteria | 3395 |
| 486 | Ga0496118_0175914 | 3300048921 | Bacteria | 1300 |
| 487 | Ga0496122_0016914 | 3300048925 | Bacteria | 6854 |
| 488 | Ga0496122_0020976 | 3300048925 | Bacteria | 5870 |
| 489 | Ga0496123_0018808 | 3300048926 | Bacteria | 5474 |
| 490 | Ga0496125_0000243 | 3300048928 | Bacteria | 111891 |
| 491 | Ga0496125_0002877 | 3300048928 | Bacteria | 21668 |
| 492 | Ga0496126_0115136 | 3300048929 | Bacteria | 2338 |
| 493 | Ga0501033_0092886 | 3300049570 | Bacteria | 2207 |
| 494 | Ga0501034_0020767 | 3300049571 | Bacteria | 6702 |
| 495 | Ga0501034_0057859 | 3300049571 | Bacteria | 3897 |
| 496 | Ga0501036_0151388 | 3300049572 | Bacteria | 1957 |
| 497 | Ga0501037_0027490 | 3300049573 | Bacteria | 4203 |
| 498 | Ga0501038_0075863 | 3300049574 | Bacteria | 2841 |
| 499 | Ga0501039_0138134 | 3300049575 | Bacteria | 1914 |
| 500 | Ga0501040_0038056 | 3300049576 | Bacteria | 3270 |
| 501 | Ga0501041_0005402 | 3300049577 | Bacteria | 7487 |
| 502 | Ga0501042_0180385 | 3300049578 | Bacteria | 1523 |
| 503 | Ga0501043_0006665 | 3300049579 | Bacteria | 9238 |
| 504 | Ga0501046_0019777 | 3300049580 | Bacteria | 5578 |
| 505 | Ga0501046_0041793 | 3300049580 | Bacteria | 3657 |
| 506 | Ga0501046_0109390 | 3300049580 | Bacteria | 2113 |
| 507 | Ga0501047_0007815 | 3300049581 | Bacteria | 10071 |
| 508 | Ga0501048_0058916 | 3300049582 | Bacteria | 2721 |
| 509 | Ga0501048_0092331 | 3300049582 | Bacteria | 2135 |
| 510 | Ga0501070_0059866 | 3300049586 | Bacteria | 3157 |
| 511 | Ga0501071_0026290 | 3300049587 | Bacteria | 4084 |
| 512 | Ga0501072_0066445 | 3300049588 | Bacteria | 2845 |
| 513 | Ga0501072_0111306 | 3300049588 | Bacteria | 2180 |
| 514 | Ga0501075_0000122 | 3300049591 | Bacteria | 37780 |
| 515 | Ga0501075_0161281 | 3300049591 | Bacteria | 1711 |
| 516 | Ga0501076_0000012 | 3300049592 | Bacteria | 113396 |
| 517 | Ga0501079_0059982 | 3300049741 | Bacteria | 2934 |
| 518 | Ga0501080_0021641 | 3300049742 | Bacteria | 5954 |
| 519 | Ga0501080_0134839 | 3300049742 | Bacteria | 2285 |
| 520 | Ga0501081_0009712 | 3300049743 | Bacteria | 6274 |
| 521 | Ga0501083_0109311 | 3300049744 | Bacteria | 1818 |
| 522 | Ga0501035_0262955 | 3300049822 | Bacteria | 1462 |
| 523 | Ga0501044_0051179 | 3300049823 | Bacteria | 4259 |
| 524 | Ga0501045_0026360 | 3300049824 | Bacteria | 4180 |
| 525 | nmdc:mga0k408_3893_c1 | 3300050493 | Bacteria | 7912 |
| 526 | nmdc:mga05p37_242228_c1 | 3300050507 | Bacteria | 2168 |
| 527 | nmdc:mga05p37_6592_c1 | 3300050507 | Bacteria | 13687 |
| 528 | nmdc:mga09592_12606_c1 | 3300050508 | Bacteria | 6891 |
| 529 | nmdc:mga09592_218707_c1 | 3300050508 | Bacteria | 1651 |
| 530 | nmdc:mga08y16_17270_c1 | 3300050511 | Bacteria | 7597 |
| 531 | nmdc:mga08y16_190_c1 | 3300050511 | Bacteria | 55016 |
| 532 | nmdc:mga08y16_378652_c1 | 3300050511 | Bacteria | 1451 |
| 533 | nmdc:mga08y16_457_c1 | 3300050511 | Bacteria | 38015 |
| 534 | nmdc:mga0n895_26533_c1 | 3300050512 | Bacteria | 5488 |
| 535 | nmdc:mga0rr50_160607_c1 | 3300050513 | Bacteria | 1824 |
| 536 | nmdc:mga0a205_308_c1 | 3300050515 | Bacteria | 36240 |
| 537 | nmdc:mga0a205_4287_c1 | 3300050515 | Bacteria | 12802 |
| 538 | Ga0495601_0000910 | 3300053077 | Bacteria | 16108 |
| 539 | Ga0495612_0001140 | 3300053078 | Bacteria | 10902 |
| 540 | Ga0500635_0000021 | 3300053080 | Bacteria | 110194 |
| 541 | Ga0500635_0019599 | 3300053080 | Bacteria | 2059 |
| 542 | Ga0495619_0132043 | 3300053085 | Bacteria | 1716 |
| 543 | Ga0500578_0095730 | 3300053086 | Bacteria | 1883 |
| 544 | Ga0500622_0036688 | 3300053156 | Bacteria | 2562 |
| 545 | Ga0500637_0012513 | 3300053178 | Bacteria | 4423 |
| 546 | Ga0501084_0154840 | 3300054114 | Bacteria | 1932 |
| 547 | Ga0501082_0001139 | 3300060353 | Bacteria | 23451 |
| 548 | Ga0530510_0000015 | 3300061734 | Bacteria | 104554 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049591 | Ga0501075_0161281 | Ga0501075_0161281_23_823 | 240 |
| 2 | 3300009094 | Ga0111539_10004086 | Ga0111539_100040864 | 243 |
| 3 | 3300005937 | Ga0081455_10008796 | Ga0081455_100087963 | 247 |
| 4 | 3300028381 | Ga0268264_10364877 | Ga0268264_103648772 | 247 |
| 5 | 3300005327 | Ga0070658_10006666 | Ga0070658_100066662 | 248 |
| 6 | 3300005336 | Ga0070680_100009124 | Ga0070680_1000091247 | 248 |
| 7 | 3300005458 | Ga0070681_10002841 | Ga0070681_100028419 | 248 |
| 8 | 3300005530 | Ga0070679_100013328 | Ga0070679_1000133284 | 248 |
| 9 | 3300013297 | Ga0157378_10018935 | Ga0157378_100189352 | 248 |
| 10 | 3300013306 | Ga0163162_10067480 | Ga0163162_100674803 | 248 |
| 11 | 3300013308 | Ga0157375_10052057 | Ga0157375_100520572 | 248 |
| 12 | 3300028573 | Ga0265334_10020990 | Ga0265334_100209903 | 250 |
| 13 | 3300031730 | Ga0307516_10000669 | Ga0307516_1000066929 | 250 |
| 14 | 3300035119 | Ga0373956_0130002 | Ga0373956_0130002_97_924 | 250 |
| 15 | 3300046475 | Ga0495639_0021981 | Ga0495639_0021981_1151_2077 | 250 |
| 16 | 3300046529 | Ga0495652_0374704 | Ga0495652_0374704_75_1001 | 250 |
| 17 | 3300003775 | Ga0055524_1027579 | Ga0055524_10275792 | 252 |
| 18 | 3300003761 | Ga0055535_1000125 | Ga0055535_100012524 | 254 |
| 19 | 3300003763 | Ga0055529_1000266 | Ga0055529_100026610 | 254 |
| 20 | 3300046471 | Ga0495650_0013732 | Ga0495650_0013732_1403_2230 | 254 |
| 21 | 3300053080 | Ga0500635_0000021 | Ga0500635_0000021_22512_23339 | 254 |
| 22 | 3300026023 | Ga0207677_10009883 | Ga0207677_100098831 | 255 |
| 23 | 3300005354 | Ga0070675_100132682 | Ga0070675_1001326822 | 256 |
| 24 | 3300005546 | Ga0070696_100064639 | Ga0070696_1000646392 | 256 |
| 25 | 3300031901 | Ga0307406_10174850 | Ga0307406_101748502 | 257 |
| 26 | 3300005329 | Ga0070683_100607939 | Ga0070683_1006079392 | 258 |
| 27 | 3300014968 | Ga0157379_10240282 | Ga0157379_102402822 | 258 |
| 28 | 3300014969 | Ga0157376_10011864 | Ga0157376_100118644 | 258 |
| 29 | 3300030521 | Ga0307511_10054382 | Ga0307511_100543823 | 258 |
| 30 | 3300031507 | Ga0307509_10027844 | Ga0307509_100278444 | 258 |
| 31 | 3300031616 | Ga0307508_10018371 | Ga0307508_100183712 | 258 |
| 32 | 3300033179 | Ga0307507_10032790 | Ga0307507_100327904 | 258 |
| 33 | 3300035695 | Ga0373927_0010615 | Ga0373927_0010615_1186_2103 | 258 |
| 34 | 3300037068 | Ga0373925_0007427 | Ga0373925_0007427_2905_3822 | 258 |
| 35 | 3300046557 | Ga0495622_0029722 | Ga0495622_0029722_541_1458 | 258 |
| 36 | 3300046683 | Ga0495658_0185774 | Ga0495658_0185774_321_1238 | 258 |
| 37 | 3300053080 | Ga0500635_0019599 | Ga0500635_0019599_933_1850 | 258 |
| 38 | 3300053178 | Ga0500637_0012513 | Ga0500637_0012513_1115_2032 | 258 |
| 39 | 3300005547 | Ga0070693_100028772 | Ga0070693_1000287723 | 259 |
| 40 | 3300005615 | Ga0070702_100061441 | Ga0070702_1000614413 | 259 |
| 41 | 3300009553 | Ga0105249_10227500 | Ga0105249_102275002 | 259 |
| 42 | 3300014745 | Ga0157377_10005668 | Ga0157377_100056684 | 259 |
| 43 | 3300033442 | Ga0315911_1000007 | Ga0315911_100000780 | 259 |
| 44 | 3300035172 | Ga0373955_0133683 | Ga0373955_0133683_360_1295 | 259 |
| 45 | 3300035692 | Ga0373935_0035719 | Ga0373935_0035719_333_1241 | 259 |
| 46 | 3300036401 | Ga0373937_0040382 | Ga0373937_0040382_1005_1952 | 259 |
| 47 | 3300037068 | Ga0373925_0135538 | Ga0373925_0135538_323_1237 | 259 |
| 48 | 3300046683 | Ga0495658_0021911 | Ga0495658_0021911_1638_2573 | 259 |
| 49 | 3300048904 | Ga0496101_0054891 | Ga0496101_0054891_1477_2379 | 259 |
| 50 | 3300048913 | Ga0496110_0420740 | Ga0496110_0420740_256_1158 | 259 |
| 51 | 3300048928 | Ga0496125_0002877 | Ga0496125_0002877_18568_19485 | 259 |
| 52 | 3300049574 | Ga0501038_0075863 | Ga0501038_0075863_143_1084 | 260 |
| 53 | 3300049575 | Ga0501039_0138134 | Ga0501039_0138134_680_1621 | 260 |
| 54 | 3300049576 | Ga0501040_0038056 | Ga0501040_0038056_129_1070 | 260 |
| 55 | 3300049577 | Ga0501041_0005402 | Ga0501041_0005402_6441_7382 | 260 |
| 56 | 3300049578 | Ga0501042_0180385 | Ga0501042_0180385_425_1366 | 260 |
| 57 | 3300049582 | Ga0501048_0058916 | Ga0501048_0058916_1587_2528 | 260 |
| 58 | 3300049587 | Ga0501071_0026290 | Ga0501071_0026290_23_964 | 260 |
| 59 | 3300049588 | Ga0501072_0066445 | Ga0501072_0066445_252_1193 | 260 |
| 60 | 3300049591 | Ga0501075_0000122 | Ga0501075_0000122_223_1164 | 260 |
| 61 | 3300049592 | Ga0501076_0000012 | Ga0501076_0000012_32847_33788 | 260 |
| 62 | 3300049741 | Ga0501079_0059982 | Ga0501079_0059982_75_1016 | 260 |
| 63 | 3300049742 | Ga0501080_0134839 | Ga0501080_0134839_1065_2006 | 260 |
| 64 | 3300049743 | Ga0501081_0009712 | Ga0501081_0009712_216_1157 | 260 |
| 65 | 3300049822 | Ga0501035_0262955 | Ga0501035_0262955_195_1136 | 260 |
| 66 | 3300049824 | Ga0501045_0026360 | Ga0501045_0026360_3115_4056 | 260 |
| 67 | 3300050511 | nmdc:mga08y16_457_c1 | nmdc:mga08y16_457_c1_3327_4181 | 260 |
| 68 | 3300054114 | Ga0501084_0154840 | Ga0501084_0154840_760_1701 | 260 |
| 69 | 3300060353 | Ga0501082_0001139 | Ga0501082_0001139_19045_19986 | 260 |
| 70 | 3300061734 | Ga0530510_0000015 | Ga0530510_0000015_63447_64388 | 260 |
| 71 | 3300005456 | Ga0070678_100206576 | Ga0070678_1002065762 | 261 |
| 72 | 3300009094 | Ga0111539_10125922 | Ga0111539_101259223 | 261 |
| 73 | 3300025934 | Ga0207686_10018274 | Ga0207686_100182743 | 261 |
| 74 | 3300026121 | Ga0207683_10385111 | Ga0207683_103851112 | 261 |
| 75 | 3300045051 | Ga0451576_0062837 | Ga0451576_0062837_505_1365 | 261 |
| 76 | 3300005331 | Ga0070670_100276930 | Ga0070670_1002769302 | 262 |
| 77 | 3300005344 | Ga0070661_100222352 | Ga0070661_1002223521 | 262 |
| 78 | 3300005354 | Ga0070675_100075083 | Ga0070675_1000750833 | 262 |
| 79 | 3300005457 | Ga0070662_100017341 | Ga0070662_1000173412 | 262 |
| 80 | 3300005564 | Ga0070664_100156521 | Ga0070664_1001565212 | 262 |
| 81 | 3300005617 | Ga0068859_100235456 | Ga0068859_1002354562 | 262 |
| 82 | 3300006358 | Ga0068871_100073525 | Ga0068871_1000735252 | 262 |
| 83 | 3300006931 | Ga0097620_100235464 | Ga0097620_1002354642 | 262 |
| 84 | 3300025933 | Ga0207706_10026885 | Ga0207706_100268854 | 262 |
| 85 | 3300025945 | Ga0207679_10064127 | Ga0207679_100641272 | 262 |
| 86 | 3300025981 | Ga0207640_10179538 | Ga0207640_101795382 | 262 |
| 87 | 3300042532 | Ga0450893_0004958 | Ga0450893_0004958_589_1452 | 262 |
| 88 | 3300048929 | Ga0496126_0115136 | Ga0496126_0115136_1031_1948 | 262 |
| 89 | iso_pu_bacteria | 2728368998 | 2728752459 | 262 |
| 90 | 3300005456 | Ga0070678_100121908 | Ga0070678_1001219082 | 263 |
| 91 | 3300005614 | Ga0068856_100462279 | Ga0068856_1004622792 | 263 |
| 92 | 3300009093 | Ga0105240_10003533 | Ga0105240_1000353319 | 263 |
| 93 | 3300013100 | Ga0157373_10108531 | Ga0157373_101085312 | 263 |
| 94 | 3300025909 | Ga0207705_10040345 | Ga0207705_100403453 | 263 |
| 95 | 3300025912 | Ga0207707_10057244 | Ga0207707_100572443 | 263 |
| 96 | 3300025913 | Ga0207695_10022997 | Ga0207695_100229975 | 263 |
| 97 | 3300025917 | Ga0207660_10008937 | Ga0207660_100089375 | 263 |
| 98 | 3300025949 | Ga0207667_10024662 | Ga0207667_100246624 | 263 |
| 99 | 3300031456 | Ga0307513_10010247 | Ga0307513_100102472 | 263 |
| 100 | 3300005331 | Ga0070670_100252458 | Ga0070670_1002524582 | 264 |
| 101 | 3300005355 | Ga0070671_100076387 | Ga0070671_1000763873 | 264 |
| 102 | 3300005563 | Ga0068855_100012231 | Ga0068855_1000122316 | 264 |
| 103 | 3300005578 | Ga0068854_100224524 | Ga0068854_1002245242 | 264 |
| 104 | 3300006942 | Ga0099824_1020738 | Ga0099824_10207383 | 264 |
| 105 | 3300025907 | Ga0207645_10006813 | Ga0207645_100068137 | 264 |
| 106 | 3300027357 | Ga0209589_1000002 | Ga0209589_1000002189 | 264 |
| 107 | 3300027361 | Ga0209489_100002 | Ga0209489_100002189 | 264 |
| 108 | 3300027363 | Ga0209700_100002 | Ga0209700_100002189 | 264 |
| 109 | 3300035111 | Ga0373923_0091369 | Ga0373923_0091369_166_1056 | 264 |
| 110 | 3300035172 | Ga0373955_0156017 | Ga0373955_0156017_203_1093 | 264 |
| 111 | 3300035724 | Ga0373933_0080962 | Ga0373933_0080962_935_1825 | 264 |
| 112 | 3300046477 | Ga0495664_0004084 | Ga0495664_0004084_2176_3066 | 264 |
| 113 | 3300046511 | Ga0495608_0029382 | Ga0495608_0029382_1059_1949 | 264 |
| 114 | 3300046536 | Ga0495587_0008866 | Ga0495587_0008866_165_1055 | 264 |
| 115 | 3300046543 | Ga0495645_0000948 | Ga0495645_0000948_12689_13579 | 264 |
| 116 | 3300046559 | Ga0495667_0004591 | Ga0495667_0004591_1611_2501 | 264 |
| 117 | 3300046663 | Ga0495635_0021420 | Ga0495635_0021420_1798_2688 | 264 |
| 118 | 3300046675 | Ga0495657_0093237 | Ga0495657_0093237_514_1404 | 264 |
| 119 | 3300046678 | Ga0495599_0015847 | Ga0495599_0015847_522_1412 | 264 |
| 120 | 3300046680 | Ga0495646_0005751 | Ga0495646_0005751_131_1021 | 264 |
| 121 | 3300047317 | Ga0495604_0166413 | Ga0495604_0166413_177_1067 | 264 |
| 122 | 3300048088 | Ga0495602_0003095 | Ga0495602_0003095_8172_9062 | 264 |
| 123 | 3300053077 | Ga0495601_0000910 | Ga0495601_0000910_4904_5794 | 264 |
| 124 | 3300053078 | Ga0495612_0001140 | Ga0495612_0001140_6836_7726 | 264 |
| 125 | 3300005356 | Ga0070674_100317626 | Ga0070674_1003176262 | 265 |
| 126 | 3300025941 | Ga0207711_10234703 | Ga0207711_102347032 | 265 |
| 127 | 3300005331 | Ga0070670_100000757 | Ga0070670_1000007578 | 266 |
| 128 | 3300005354 | Ga0070675_100007385 | Ga0070675_1000073852 | 266 |
| 129 | 3300005543 | Ga0070672_100014255 | Ga0070672_1000142553 | 266 |
| 130 | 3300005548 | Ga0070665_100201777 | Ga0070665_1002017772 | 266 |
| 131 | 3300005618 | Ga0068864_100014494 | Ga0068864_1000144942 | 266 |
| 132 | 3300014969 | Ga0157376_10015816 | Ga0157376_100158164 | 266 |
| 133 | 3300025321 | Ga0207656_10022456 | Ga0207656_100224563 | 266 |
| 134 | 3300025925 | Ga0207650_10001840 | Ga0207650_100018404 | 266 |
| 135 | 3300025926 | Ga0207659_10020094 | Ga0207659_100200942 | 266 |
| 136 | 3300025940 | Ga0207691_10037329 | Ga0207691_100373292 | 266 |
| 137 | 3300025960 | Ga0207651_10015165 | Ga0207651_100151653 | 266 |
| 138 | 3300026088 | Ga0207641_10147506 | Ga0207641_101475061 | 266 |
| 139 | 3300026142 | Ga0207698_10096289 | Ga0207698_100962892 | 266 |
| 140 | 3300035695 | Ga0373927_0069340 | Ga0373927_0069340_463_1461 | 266 |
| 141 | 3300037068 | Ga0373925_0001453 | Ga0373925_0001453_8046_9044 | 266 |
| 142 | 3300037312 | Ga0395899_0001159 | Ga0395899_0001159_4665_5621 | 266 |
| 143 | 3300038443 | Ga0395901_0058531 | Ga0395901_0058531_234_1190 | 266 |
| 144 | 3300042876 | Ga0451577_0004779 | Ga0451577_0004779_11786_12718 | 266 |
| 145 | 3300048918 | Ga0496115_0112119 | Ga0496115_0112119_835_1752 | 266 |
| 146 | iso_pu_bacteria | 2841911363 | 2841915960 | 267 |
| 147 | iso_pu_bacteria | 2841917233 | 2841921660 | 267 |
| 148 | 3300005330 | Ga0070690_100019065 | Ga0070690_1000190653 | 268 |
| 149 | 3300005335 | Ga0070666_10003353 | Ga0070666_100033535 | 268 |
| 150 | 3300005338 | Ga0068868_100001471 | Ga0068868_10000147111 | 268 |
| 151 | 3300005354 | Ga0070675_100000817 | Ga0070675_10000081713 | 268 |
| 152 | 3300005355 | Ga0070671_100237676 | Ga0070671_1002376761 | 268 |
| 153 | 3300005364 | Ga0070673_100043247 | Ga0070673_1000432472 | 268 |
| 154 | 3300005367 | Ga0070667_100002131 | Ga0070667_10000213110 | 268 |
| 155 | 3300005456 | Ga0070678_100076876 | Ga0070678_1000768762 | 268 |
| 156 | 3300005459 | Ga0068867_100146410 | Ga0068867_1001464102 | 268 |
| 157 | 3300005543 | Ga0070672_100242730 | Ga0070672_1002427302 | 268 |
| 158 | 3300005618 | Ga0068864_100001465 | Ga0068864_10000146511 | 268 |
| 159 | 3300005841 | Ga0068863_100026019 | Ga0068863_1000260193 | 268 |
| 160 | 3300005842 | Ga0068858_100001383 | Ga0068858_10000138316 | 268 |
| 161 | 3300006237 | Ga0097621_100069169 | Ga0097621_1000691693 | 268 |
| 162 | 3300006358 | Ga0068871_100213809 | Ga0068871_1002138092 | 268 |
| 163 | 3300009177 | Ga0105248_10047576 | Ga0105248_100475763 | 268 |
| 164 | 3300013308 | Ga0157375_10218341 | Ga0157375_102183412 | 268 |
| 165 | 3300014325 | Ga0163163_10400097 | Ga0163163_104000972 | 268 |
| 166 | 3300014968 | Ga0157379_10040572 | Ga0157379_100405723 | 268 |
| 167 | 3300025893 | Ga0207682_10032345 | Ga0207682_100323452 | 268 |
| 168 | 3300025903 | Ga0207680_10070442 | Ga0207680_100704422 | 268 |
| 169 | 3300025926 | Ga0207659_10018397 | Ga0207659_100183975 | 268 |
| 170 | 3300025940 | Ga0207691_10168394 | Ga0207691_101683942 | 268 |
| 171 | 3300025941 | Ga0207711_10055449 | Ga0207711_100554493 | 268 |
| 172 | 3300025960 | Ga0207651_10043012 | Ga0207651_100430122 | 268 |
| 173 | 3300025986 | Ga0207658_10002716 | Ga0207658_100027167 | 268 |
| 174 | 3300026023 | Ga0207677_10004266 | Ga0207677_100042666 | 268 |
| 175 | 3300026035 | Ga0207703_10002402 | Ga0207703_100024026 | 268 |
| 176 | 3300026088 | Ga0207641_10162638 | Ga0207641_101626382 | 268 |
| 177 | 3300026089 | Ga0207648_10125398 | Ga0207648_101253982 | 268 |
| 178 | 3300026095 | Ga0207676_10016655 | Ga0207676_100166552 | 268 |
| 179 | 3300026121 | Ga0207683_10261960 | Ga0207683_102619602 | 268 |
| 180 | 3300048911 | Ga0496108_0133369 | Ga0496108_0133369_588_1469 | 268 |
| 181 | 3300048912 | Ga0496109_0163484 | Ga0496109_0163484_1074_1955 | 268 |
| 182 | 3300005841 | Ga0068863_100204022 | Ga0068863_1002040222 | 269 |
| 183 | 3300025254 | Ga0209148_1007501 | Ga0209148_10075012 | 269 |
| 184 | 3300025256 | Ga0209759_1001594 | Ga0209759_10015944 | 269 |
| 185 | 3300025272 | Ga0209455_1000030 | Ga0209455_100003092 | 269 |
| 186 | 3300049588 | Ga0501072_0111306 | Ga0501072_0111306_1045_1935 | 269 |
| 187 | 3300005327 | Ga0070658_10007485 | Ga0070658_100074858 | 270 |
| 188 | 3300025909 | Ga0207705_10068814 | Ga0207705_100688142 | 270 |
| 189 | 3300037853 | Ga0436364_0837883 | Ga0436364_0837883_490_1440 | 270 |
| 190 | 3300049580 | Ga0501046_0041793 | Ga0501046_0041793_1381_2334 | 270 |
| 191 | 3300005844 | Ga0068862_100235069 | Ga0068862_1002350692 | 271 |
| 192 | 3300006852 | Ga0075433_10004040 | Ga0075433_100040402 | 271 |
| 193 | 3300027907 | Ga0207428_10005387 | Ga0207428_100053877 | 271 |
| 194 | 3300042876 | Ga0451577_0111081 | Ga0451577_0111081_279_1241 | 271 |
| 195 | 3300044673 | Ga0453683_0014124 | Ga0453683_0014124_1334_2296 | 271 |
| 196 | 3300044712 | Ga0453684_0005806 | Ga0453684_0005806_11263_12225 | 271 |
| 197 | 3300045051 | Ga0451576_0078142 | Ga0451576_0078142_2086_3048 | 271 |
| 198 | 3300050511 | nmdc:mga08y16_17270_c1 | nmdc:mga08y16_17270_c1_3606_4568 | 271 |
| 199 | 3300050512 | nmdc:mga0n895_26533_c1 | nmdc:mga0n895_26533_c1_4254_5216 | 271 |
| 200 | 3300050515 | nmdc:mga0a205_308_c1 | nmdc:mga0a205_308_c1_28782_29744 | 271 |
| 201 | 3300005328 | Ga0070676_10026886 | Ga0070676_100268864 | 272 |
| 202 | 3300005329 | Ga0070683_100043839 | Ga0070683_1000438393 | 272 |
| 203 | 3300005339 | Ga0070660_100107010 | Ga0070660_1001070102 | 272 |
| 204 | 3300005347 | Ga0070668_100071699 | Ga0070668_1000716992 | 272 |
| 205 | 3300005353 | Ga0070669_100094316 | Ga0070669_1000943162 | 272 |
| 206 | 3300005367 | Ga0070667_100016645 | Ga0070667_1000166452 | 272 |
| 207 | 3300005459 | Ga0068867_100010057 | Ga0068867_1000100574 | 272 |
| 208 | 3300005543 | Ga0070672_100159752 | Ga0070672_1001597522 | 272 |
| 209 | 3300005614 | Ga0068856_100186105 | Ga0068856_1001861052 | 272 |
| 210 | 3300005618 | Ga0068864_100035977 | Ga0068864_1000359773 | 272 |
| 211 | 3300005719 | Ga0068861_100012878 | Ga0068861_1000128784 | 272 |
| 212 | 3300005719 | Ga0068861_100030764 | Ga0068861_1000307643 | 272 |
| 213 | 3300005841 | Ga0068863_100261103 | Ga0068863_1002611032 | 272 |
| 214 | 3300005843 | Ga0068860_100000590 | Ga0068860_10000059047 | 272 |
| 215 | 3300005844 | Ga0068862_100032721 | Ga0068862_1000327212 | 272 |
| 216 | 3300006881 | Ga0068865_100023491 | Ga0068865_1000234913 | 272 |
| 217 | 3300021388 | Ga0213875_10000003 | Ga0213875_10000003600 | 272 |
| 218 | 3300025907 | Ga0207645_10024881 | Ga0207645_100248812 | 272 |
| 219 | 3300025919 | Ga0207657_10129568 | Ga0207657_101295682 | 272 |
| 220 | 3300025923 | Ga0207681_10118299 | Ga0207681_101182992 | 272 |
| 221 | 3300025933 | Ga0207706_10004572 | Ga0207706_1000457210 | 272 |
| 222 | 3300025940 | Ga0207691_10151753 | Ga0207691_101517532 | 272 |
| 223 | 3300025942 | Ga0207689_10000735 | Ga0207689_1000073516 | 272 |
| 224 | 3300025944 | Ga0207661_10109597 | Ga0207661_101095972 | 272 |
| 225 | 3300025945 | Ga0207679_10057351 | Ga0207679_100573512 | 272 |
| 226 | 3300025972 | Ga0207668_10010800 | Ga0207668_100108001 | 272 |
| 227 | 3300026023 | Ga0207677_10170477 | Ga0207677_101704772 | 272 |
| 228 | 3300026067 | Ga0207678_10022457 | Ga0207678_100224573 | 272 |
| 229 | 3300026075 | Ga0207708_10053675 | Ga0207708_100536753 | 272 |
| 230 | 3300026089 | Ga0207648_10000842 | Ga0207648_1000084219 | 272 |
| 231 | 3300026118 | Ga0207675_100005811 | Ga0207675_1000058118 | 272 |
| 232 | 3300028380 | Ga0268265_10031287 | Ga0268265_100312873 | 272 |
| 233 | 3300028381 | Ga0268264_10009099 | Ga0268264_100090999 | 272 |
| 234 | 3300031852 | Ga0307410_10010061 | Ga0307410_100100615 | 272 |
| 235 | 3300032002 | Ga0307416_100022926 | Ga0307416_1000229264 | 272 |
| 236 | 3300037853 | Ga0436364_0960990 | Ga0436364_0960990_10958_11920 | 272 |
| 237 | 3300046535 | Ga0495586_0022472 | Ga0495586_0022472_1007_2008 | 272 |
| 238 | 3300005937 | Ga0081455_10083343 | Ga0081455_100833433 | 273 |
| 239 | 3300025898 | Ga0207692_10095124 | Ga0207692_100951242 | 273 |
| 240 | 3300025928 | Ga0207700_10056838 | Ga0207700_100568382 | 273 |
| 241 | 3300025939 | Ga0207665_10077278 | Ga0207665_100772782 | 273 |
| 242 | 3300032005 | Ga0307411_10390046 | Ga0307411_103900462 | 273 |
| 243 | 3300035112 | Ga0373932_0049415 | Ga0373932_0049415_269_1168 | 273 |
| 244 | 3300035691 | Ga0373931_0032759 | Ga0373931_0032759_838_1737 | 273 |
| 245 | 3300035692 | Ga0373935_0404198 | Ga0373935_0404198_43_945 | 273 |
| 246 | 3300036401 | Ga0373937_0106992 | Ga0373937_0106992_46_1005 | 273 |
| 247 | 3300048907 | Ga0496104_0096825 | Ga0496104_0096825_1839_2780 | 273 |
| 248 | 3300048908 | Ga0496105_0084176 | Ga0496105_0084176_223_1164 | 273 |
| 249 | 3300003771 | Ga0055526_1004093 | Ga0055526_10040932 | 274 |
| 250 | 3300005327 | Ga0070658_10111994 | Ga0070658_101119943 | 274 |
| 251 | 3300005329 | Ga0070683_100230178 | Ga0070683_1002301782 | 274 |
| 252 | 3300005336 | Ga0070680_100011564 | Ga0070680_1000115644 | 274 |
| 253 | 3300005339 | Ga0070660_100012301 | Ga0070660_1000123013 | 274 |
| 254 | 3300005347 | Ga0070668_100033710 | Ga0070668_1000337102 | 274 |
| 255 | 3300005364 | Ga0070673_100131783 | Ga0070673_1001317832 | 274 |
| 256 | 3300005366 | Ga0070659_100432940 | Ga0070659_1004329402 | 274 |
| 257 | 3300005455 | Ga0070663_100036099 | Ga0070663_1000360992 | 274 |
| 258 | 3300005458 | Ga0070681_10041436 | Ga0070681_100414364 | 274 |
| 259 | 3300005459 | Ga0068867_100178978 | Ga0068867_1001789782 | 274 |
| 260 | 3300005530 | Ga0070679_100042738 | Ga0070679_1000427384 | 274 |
| 261 | 3300005539 | Ga0068853_100028368 | Ga0068853_1000283683 | 274 |
| 262 | 3300005539 | Ga0068853_100297676 | Ga0068853_1002976762 | 274 |
| 263 | 3300005564 | Ga0070664_100138193 | Ga0070664_1001381932 | 274 |
| 264 | 3300005577 | Ga0068857_100020969 | Ga0068857_1000209695 | 274 |
| 265 | 3300005719 | Ga0068861_100136528 | Ga0068861_1001365282 | 274 |
| 266 | 3300005834 | Ga0068851_10039036 | Ga0068851_100390362 | 274 |
| 267 | 3300006881 | Ga0068865_100075594 | Ga0068865_1000755942 | 274 |
| 268 | 3300009093 | Ga0105240_10012127 | Ga0105240_100121272 | 274 |
| 269 | 3300009148 | Ga0105243_10103828 | Ga0105243_101038281 | 274 |
| 270 | 3300009545 | Ga0105237_10151724 | Ga0105237_101517242 | 274 |
| 271 | 3300009551 | Ga0105238_10002653 | Ga0105238_100026536 | 274 |
| 272 | 3300009553 | Ga0105249_10016504 | Ga0105249_100165043 | 274 |
| 273 | 3300010375 | Ga0105239_10052352 | Ga0105239_100523524 | 274 |
| 274 | 3300013104 | Ga0157370_10020086 | Ga0157370_100200864 | 274 |
| 275 | 3300013105 | Ga0157369_10010670 | Ga0157369_100106709 | 274 |
| 276 | 3300013306 | Ga0163162_10345500 | Ga0163162_103455002 | 274 |
| 277 | 3300014326 | Ga0157380_10085184 | Ga0157380_100851842 | 274 |
| 278 | 3300017792 | Ga0163161_10062877 | Ga0163161_100628772 | 274 |
| 279 | 3300025315 | Ga0207697_10050176 | Ga0207697_100501762 | 274 |
| 280 | 3300025321 | Ga0207656_10012166 | Ga0207656_100121662 | 274 |
| 281 | 3300025903 | Ga0207680_10113863 | Ga0207680_101138632 | 274 |
| 282 | 3300025909 | Ga0207705_10085966 | Ga0207705_100859662 | 274 |
| 283 | 3300025912 | Ga0207707_10016025 | Ga0207707_100160254 | 274 |
| 284 | 3300025913 | Ga0207695_10049892 | Ga0207695_100498923 | 274 |
| 285 | 3300025914 | Ga0207671_10195865 | Ga0207671_101958652 | 274 |
| 286 | 3300025917 | Ga0207660_10026443 | Ga0207660_100264433 | 274 |
| 287 | 3300025919 | Ga0207657_10007756 | Ga0207657_100077565 | 274 |
| 288 | 3300025921 | Ga0207652_10009010 | Ga0207652_100090104 | 274 |
| 289 | 3300025923 | Ga0207681_10006481 | Ga0207681_100064813 | 274 |
| 290 | 3300025924 | Ga0207694_10044983 | Ga0207694_100449832 | 274 |
| 291 | 3300025938 | Ga0207704_10114815 | Ga0207704_101148151 | 274 |
| 292 | 3300025940 | Ga0207691_10084335 | Ga0207691_100843352 | 274 |
| 293 | 3300025940 | Ga0207691_10229054 | Ga0207691_102290542 | 274 |
| 294 | 3300025949 | Ga0207667_10021341 | Ga0207667_100213414 | 274 |
| 295 | 3300025961 | Ga0207712_10018812 | Ga0207712_100188123 | 274 |
| 296 | 3300025972 | Ga0207668_10006559 | Ga0207668_100065593 | 274 |
| 297 | 3300026067 | Ga0207678_10038674 | Ga0207678_100386742 | 274 |
| 298 | 3300026088 | Ga0207641_10043575 | Ga0207641_100435752 | 274 |
| 299 | 3300026089 | Ga0207648_10205043 | Ga0207648_102050432 | 274 |
| 300 | 3300026116 | Ga0207674_10031036 | Ga0207674_100310362 | 274 |
| 301 | 3300026118 | Ga0207675_100103371 | Ga0207675_1001033712 | 274 |
| 302 | 3300026142 | Ga0207698_10078288 | Ga0207698_100782882 | 274 |
| 303 | 3300028380 | Ga0268265_10073695 | Ga0268265_100736953 | 274 |
| 304 | 3300046539 | Ga0495621_0003372 | Ga0495621_0003372_1898_2788 | 274 |
| 305 | 3300046539 | Ga0495621_0037223 | Ga0495621_0037223_199_1140 | 274 |
| 306 | 3300048911 | Ga0496108_0227466 | Ga0496108_0227466_413_1363 | 274 |
| 307 | 3300005331 | Ga0070670_100051866 | Ga0070670_1000518663 | 275 |
| 308 | 3300005355 | Ga0070671_100000285 | Ga0070671_1000002859 | 275 |
| 309 | 3300005618 | Ga0068864_100198788 | Ga0068864_1001987882 | 275 |
| 310 | 3300025925 | Ga0207650_10049553 | Ga0207650_100495533 | 275 |
| 311 | 3300025931 | Ga0207644_10000317 | Ga0207644_100003179 | 275 |
| 312 | 3300025941 | Ga0207711_10012299 | Ga0207711_100122996 | 275 |
| 313 | 3300026088 | Ga0207641_10035597 | Ga0207641_100355973 | 275 |
| 314 | 3300026142 | Ga0207698_10206752 | Ga0207698_102067522 | 275 |
| 315 | 3300042439 | Ga0439464_0001490 | Ga0439464_0001490_296_1237 | 275 |
| 316 | 3300048911 | Ga0496108_0165651 | Ga0496108_0165651_332_1276 | 275 |
| 317 | 3300048917 | Ga0496114_0401897 | Ga0496114_0401897_40_978 | 275 |
| 318 | 3300050493 | nmdc:mga0k408_3893_c1 | nmdc:mga0k408_3893_c1_5792_6829 | 275 |
| 319 | 3300009177 | Ga0105248_10064899 | Ga0105248_100648993 | 276 |
| 320 | 3300005331 | Ga0070670_100188471 | Ga0070670_1001884711 | 277 |
| 321 | 3300005617 | Ga0068859_100050451 | Ga0068859_1000504512 | 277 |
| 322 | 3300005985 | Ga0081539_10030355 | Ga0081539_100303552 | 277 |
| 323 | 3300006931 | Ga0097620_100050450 | Ga0097620_1000504502 | 277 |
| 324 | 3300013250 | Ga0171462_1007 | Ga0171462_1007113 | 277 |
| 325 | 3300026121 | Ga0207683_10271670 | Ga0207683_102716702 | 277 |
| 326 | 3300028379 | Ga0268266_10502313 | Ga0268266_105023131 | 277 |
| 327 | 3300031665 | Ga0316575_10031754 | Ga0316575_100317542 | 277 |
| 328 | 3300031691 | Ga0316579_10004495 | Ga0316579_100044953 | 277 |
| 329 | 3300031691 | Ga0316579_10121166 | Ga0316579_101211662 | 277 |
| 330 | 3300031727 | Ga0316576_10009720 | Ga0316576_100097203 | 277 |
| 331 | 3300031727 | Ga0316576_10322225 | Ga0316576_103222251 | 277 |
| 332 | 3300031728 | Ga0316578_10035292 | Ga0316578_100352922 | 277 |
| 333 | 3300031733 | Ga0316577_10002137 | Ga0316577_100021373 | 277 |
| 334 | 3300031733 | Ga0316577_10002905 | Ga0316577_100029055 | 277 |
| 335 | 3300031733 | Ga0316577_10037087 | Ga0316577_100370872 | 277 |
| 336 | 3300032137 | Ga0316585_10008215 | Ga0316585_100082152 | 277 |
| 337 | 3300032139 | Ga0316580_10027258 | Ga0316580_100272582 | 277 |
| 338 | 3300035398 | Ga0316574_0171084 | Ga0316574_0171084_226_1179 | 277 |
| 339 | 3300036647 | Ga0316582_0000152 | Ga0316582_0000152_9142_10095 | 277 |
| 340 | 3300036647 | Ga0316582_0051402 | Ga0316582_0051402_251_1204 | 277 |
| 341 | 3300036647 | Ga0316582_0053628 | Ga0316582_0053628_1457_2410 | 277 |
| 342 | 3300036712 | Ga0316584_0001806 | Ga0316584_0001806_10512_11465 | 277 |
| 343 | 3300036712 | Ga0316584_0008542 | Ga0316584_0008542_2894_3847 | 277 |
| 344 | 3300036712 | Ga0316584_0013977 | Ga0316584_0013977_3588_4541 | 277 |
| 345 | 3300037588 | Ga0316581_0000131 | Ga0316581_0000131_3023_3976 | 277 |
| 346 | 3300037588 | Ga0316581_0006644 | Ga0316581_0006644_959_1912 | 277 |
| 347 | 3300005467 | Ga0070706_100032002 | Ga0070706_1000320023 | 278 |
| 348 | 3300005471 | Ga0070698_100008329 | Ga0070698_1000083293 | 278 |
| 349 | 3300006844 | Ga0075428_100068071 | Ga0075428_1000680713 | 278 |
| 350 | 3300025922 | Ga0207646_10079522 | Ga0207646_100795222 | 278 |
| 351 | 3300027907 | Ga0207428_10013198 | Ga0207428_100131986 | 278 |
| 352 | 3300036647 | Ga0316582_0070137 | Ga0316582_0070137_1138_2112 | 278 |
| 353 | 3300037312 | Ga0395899_0062362 | Ga0395899_0062362_420_1373 | 278 |
| 354 | 3300048921 | Ga0496118_0175914 | Ga0496118_0175914_149_1048 | 278 |
| 355 | 3300048925 | Ga0496122_0016914 | Ga0496122_0016914_3887_4786 | 278 |
| 356 | 3300048926 | Ga0496123_0018808 | Ga0496123_0018808_4178_5077 | 278 |
| 357 | 3300049570 | Ga0501033_0092886 | Ga0501033_0092886_1292_2191 | 278 |
| 358 | 3300049571 | Ga0501034_0057859 | Ga0501034_0057859_1315_2214 | 278 |
| 359 | 3300049573 | Ga0501037_0027490 | Ga0501037_0027490_2280_3179 | 278 |
| 360 | 3300005841 | Ga0068863_100389571 | Ga0068863_1003895712 | 279 |
| 361 | 3300006847 | Ga0075431_100031310 | Ga0075431_1000313106 | 279 |
| 362 | 3300014326 | Ga0157380_10692160 | Ga0157380_106921601 | 279 |
| 363 | 3300035088 | Ga0373940_0007313 | Ga0373940_0007313_1016_1960 | 279 |
| 364 | 3300035691 | Ga0373931_0026627 | Ga0373931_0026627_1375_2319 | 279 |
| 365 | 3300039438 | Ga0436360_1065138 | Ga0436360_1065138_11_937 | 279 |
| 366 | 3300050507 | nmdc:mga05p37_6592_c1 | nmdc:mga05p37_6592_c1_1044_1988 | 279 |
| 367 | 3300050508 | nmdc:mga09592_12606_c1 | nmdc:mga09592_12606_c1_197_1141 | 279 |
| 368 | 3300053086 | Ga0500578_0095730 | Ga0500578_0095730_512_1414 | 279 |
| 369 | 3300053156 | Ga0500622_0036688 | Ga0500622_0036688_969_1871 | 279 |
| 370 | 3300031691 | Ga0316579_10030880 | Ga0316579_100308802 | 280 |
| 371 | 3300031733 | Ga0316577_10063247 | Ga0316577_100632471 | 280 |
| 372 | 3300037588 | Ga0316581_0021000 | Ga0316581_0021000_63_1034 | 280 |
| 373 | 3300039438 | Ga0436360_0445758 | Ga0436360_0445758_55_996 | 280 |
| 374 | 3300046680 | Ga0495646_0058442 | Ga0495646_0058442_842_1759 | 280 |
| 375 | 3300049580 | Ga0501046_0109390 | Ga0501046_0109390_1168_2103 | 280 |
| 376 | iso_pu_bacteria | 2507262055 | 2507504478 | 280 |
| 377 | iso_pu_bacteria | 2511231028 | 2511400271 | 280 |
| 378 | iso_pu_bacteria | 2513237092 | 2513624273 | 280 |
| 379 | iso_pu_bacteria | 2513237094 | 2513638760 | 280 |
| 380 | iso_pu_bacteria | 2513237096 | 2513657761 | 280 |
| 381 | iso_pu_bacteria | 2513237101 | 2513693116 | 280 |
| 382 | iso_pu_bacteria | 2513237102 | 2513701650 | 280 |
| 383 | iso_pu_bacteria | 2513237137 | 2513861559 | 280 |
| 384 | iso_pu_bacteria | 2513237145 | 2513919760 | 280 |
| 385 | iso_pu_bacteria | 2517572143 | 2517895229 | 280 |
| 386 | iso_pu_bacteria | 2524023228 | 2524536357 | 280 |
| 387 | iso_pu_bacteria | 2528768022 | 2528849479 | 280 |
| 388 | iso_pu_bacteria | 2667528175 | 2671121748 | 280 |
| 389 | iso_pu_bacteria | 2721755755 | 2723843257 | 280 |
| 390 | iso_pu_bacteria | 2791355196 | 2793059265 | 280 |
| 391 | iso_pu_bacteria | 2791355197 | 2793069178 | 280 |
| 392 | iso_pu_bacteria | 2824600985 | 2824607595 | 280 |
| 393 | iso_pu_bacteria | 2824609381 | 2824615353 | 280 |
| 394 | iso_pu_bacteria | 2824617872 | 2824618804 | 280 |
| 395 | iso_pu_bacteria | 2824626560 | 2824628910 | 280 |
| 396 | iso_pu_bacteria | 2824635225 | 2824638421 | 280 |
| 397 | iso_pu_bacteria | 2824644064 | 2824648053 | 280 |
| 398 | iso_pu_bacteria | 2824653114 | 2824657974 | 280 |
| 399 | iso_pu_bacteria | 2824714736 | 2824718610 | 280 |
| 400 | iso_pu_bacteria | 2824723954 | 2824726012 | 280 |
| 401 | iso_pu_bacteria | 2844315083 | 2844321461 | 280 |
| 402 | iso_pu_bacteria | 2874604998 | 2874607749 | 280 |
| 403 | iso_pu_bacteria | 2874628541 | 2874629599 | 280 |
| 404 | iso_pu_bacteria | 2879099564 | 2879102267 | 280 |
| 405 | iso_pu_bacteria | 2879110137 | 2879110816 | 280 |
| 406 | iso_pu_bacteria | 2881364244 | 2881364588 | 280 |
| 407 | iso_pu_bacteria | 2885374607 | 2885374896 | 280 |
| 408 | iso_pu_bacteria | 2888419890 | 2888426984 | 280 |
| 409 | iso_pu_bacteria | 2903748898 | 2903754310 | 280 |
| 410 | iso_pu_bacteria | 2906610324 | 2906611907 | 280 |
| 411 | iso_pu_bacteria | 2906635258 | 2906636354 | 280 |
| 412 | iso_pu_bacteria | 2906660503 | 2906665421 | 280 |
| 413 | iso_pu_bacteria | 2908739725 | 2908740581 | 280 |
| 414 | iso_pu_bacteria | 2922361189 | 2922361532 | 280 |
| 415 | iso_pu_bacteria | 2922393267 | 2922400113 | 280 |
| 416 | iso_pu_bacteria | 2922425934 | 2922427394 | 280 |
| 417 | iso_pu_bacteria | 2932794094 | 2932801191 | 280 |
| 418 | iso_pu_bacteria | 2935630451 | 2935637562 | 280 |
| 419 | iso_pu_bacteria | 2941507105 | 2941514065 | 280 |
| 420 | iso_pu_bacteria | 2941515067 | 2941522026 | 280 |
| 421 | iso_pu_bacteria | 2941523033 | 2941529764 | 280 |
| 422 | iso_pu_bacteria | 3005474847 | 3005477114 | 280 |
| 423 | iso_pu_bacteria | 3005506211 | 3005506534 | 280 |
| 424 | iso_pu_bacteria | 3005710791 | 3005717565 | 280 |
| 425 | iso_pu_bacteria | 8006933436 | 8006938324 | 280 |
| 426 | iso_pu_bacteria | 8006973647 | 8006978401 | 280 |
| 427 | iso_pu_bacteria | 8006984368 | 8006985103 | 280 |
| 428 | iso_pu_bacteria | 8019555841 | 8019560705 | 280 |
| 429 | iso_pu_bacteria | 8019565922 | 8019570788 | 280 |
| 430 | iso_pu_bacteria | 8056673599 | 8056677562 | 280 |
| 431 | iso_pu_bacteria | 8056689827 | 8056695595 | 280 |
| 432 | 3300005290 | Ga0065712_10015931 | Ga0065712_100159312 | 281 |
| 433 | 3300005331 | Ga0070670_100006587 | Ga0070670_1000065872 | 281 |
| 434 | 3300005333 | Ga0070677_10002073 | Ga0070677_100020736 | 281 |
| 435 | 3300005353 | Ga0070669_100046884 | Ga0070669_1000468842 | 281 |
| 436 | 3300005354 | Ga0070675_100004170 | Ga0070675_1000041703 | 281 |
| 437 | 3300005355 | Ga0070671_100019127 | Ga0070671_1000191273 | 281 |
| 438 | 3300005356 | Ga0070674_100002835 | Ga0070674_10000283511 | 281 |
| 439 | 3300005364 | Ga0070673_100069351 | Ga0070673_1000693513 | 281 |
| 440 | 3300005367 | Ga0070667_100072899 | Ga0070667_1000728992 | 281 |
| 441 | 3300005456 | Ga0070678_100001849 | Ga0070678_1000018492 | 281 |
| 442 | 3300005543 | Ga0070672_100009725 | Ga0070672_1000097255 | 281 |
| 443 | 3300005618 | Ga0068864_100051817 | Ga0068864_1000518172 | 281 |
| 444 | 3300006237 | Ga0097621_100142282 | Ga0097621_1001422822 | 281 |
| 445 | 3300021441 | Ga0213871_10004272 | Ga0213871_100042722 | 281 |
| 446 | 3300025893 | Ga0207682_10020446 | Ga0207682_100204463 | 281 |
| 447 | 3300025925 | Ga0207650_10001226 | Ga0207650_100012269 | 281 |
| 448 | 3300025926 | Ga0207659_10047511 | Ga0207659_100475113 | 281 |
| 449 | 3300025931 | Ga0207644_10012920 | Ga0207644_100129202 | 281 |
| 450 | 3300025937 | Ga0207669_10041226 | Ga0207669_100412262 | 281 |
| 451 | 3300025940 | Ga0207691_10000090 | Ga0207691_100000902 | 281 |
| 452 | 3300025960 | Ga0207651_10004608 | Ga0207651_100046084 | 281 |
| 453 | 3300025986 | Ga0207658_10031398 | Ga0207658_100313983 | 281 |
| 454 | 3300026095 | Ga0207676_10060408 | Ga0207676_100604083 | 281 |
| 455 | 3300026121 | Ga0207683_10019166 | Ga0207683_100191665 | 281 |
| 456 | 3300026142 | Ga0207698_10343841 | Ga0207698_103438412 | 281 |
| 457 | 3300028794 | Ga0307515_10038014 | Ga0307515_100380142 | 281 |
| 458 | 3300039438 | Ga0436360_0208407 | Ga0436360_0208407_1569_2498 | 281 |
| 459 | 3300039447 | Ga0436361_0513491 | Ga0436361_0513491_2414_3343 | 281 |
| 460 | iso_pu_bacteria | 2904690495 | 2904693232 | 281 |
| 461 | iso_pu_bacteria | 2908756301 | 2908759304 | 281 |
| 462 | 3300005937 | Ga0081455_10000370 | Ga0081455_1000037021 | 282 |
| 463 | 3300025960 | Ga0207651_10000327 | Ga0207651_1000032711 | 282 |
| 464 | 3300048928 | Ga0496125_0000243 | Ga0496125_0000243_70307_71224 | 282 |
| 465 | iso_pu_bacteria | 2545555834 | 2545673368 | 282 |
| 466 | iso_pu_bacteria | 641522639 | 641641200 | 282 |
| 467 | iso_pu_bacteria | 643348564 | 643599095 | 282 |
| 468 | 3300005354 | Ga0070675_100095804 | Ga0070675_1000958043 | 283 |
| 469 | 3300005445 | Ga0070708_100138448 | Ga0070708_1001384483 | 283 |
| 470 | 3300005564 | Ga0070664_100134690 | Ga0070664_1001346902 | 283 |
| 471 | 3300006852 | Ga0075433_10008607 | Ga0075433_100086075 | 283 |
| 472 | 3300006871 | Ga0075434_100017089 | Ga0075434_1000170895 | 283 |
| 473 | 3300006880 | Ga0075429_100033217 | Ga0075429_1000332174 | 283 |
| 474 | 3300007076 | Ga0075435_100047972 | Ga0075435_1000479723 | 283 |
| 475 | 3300025893 | Ga0207682_10054720 | Ga0207682_100547202 | 283 |
| 476 | 3300025910 | Ga0207684_10030377 | Ga0207684_100303772 | 283 |
| 477 | 3300025926 | Ga0207659_10043645 | Ga0207659_100436452 | 283 |
| 478 | 3300025940 | Ga0207691_10149401 | Ga0207691_101494012 | 283 |
| 479 | 3300031731 | Ga0307405_10143789 | Ga0307405_101437892 | 283 |
| 480 | 3300031852 | Ga0307410_10239673 | Ga0307410_102396732 | 283 |
| 481 | 3300031995 | Ga0307409_100006230 | Ga0307409_1000062304 | 283 |
| 482 | 3300032002 | Ga0307416_100046020 | Ga0307416_1000460202 | 283 |
| 483 | 3300050507 | nmdc:mga05p37_242228_c1 | nmdc:mga05p37_242228_c1_674_1615 | 283 |
| 484 | 3300050508 | nmdc:mga09592_218707_c1 | nmdc:mga09592_218707_c1_622_1563 | 283 |
| 485 | 3300050513 | nmdc:mga0rr50_160607_c1 | nmdc:mga0rr50_160607_c1_780_1721 | 283 |
| 486 | 3300050515 | nmdc:mga0a205_4287_c1 | nmdc:mga0a205_4287_c1_8843_9784 | 283 |
| 487 | iso_pu_bacteria | 3003665799 | 3003666615 | 283 |
| 488 | 3300005457 | Ga0070662_100278217 | Ga0070662_1002782172 | 284 |
| 489 | 3300009094 | Ga0111539_10016141 | Ga0111539_100161419 | 284 |
| 490 | 3300009147 | Ga0114129_10028131 | Ga0114129_100281312 | 284 |
| 491 | 3300013308 | Ga0157375_10040120 | Ga0157375_100401202 | 284 |
| 492 | 3300025933 | Ga0207706_10064655 | Ga0207706_100646552 | 284 |
| 493 | 3300026089 | Ga0207648_10167642 | Ga0207648_101676422 | 284 |
| 494 | 3300027907 | Ga0207428_10000049 | Ga0207428_10000049103 | 284 |
| 495 | 3300028381 | Ga0268264_10413319 | Ga0268264_104133191 | 284 |
| 496 | 3300028666 | Ga0265336_10000042 | Ga0265336_1000004252 | 284 |
| 497 | 3300029957 | Ga0265324_10000213 | Ga0265324_1000021338 | 284 |
| 498 | 3300035112 | Ga0373932_0050939 | Ga0373932_0050939_27_971 | 284 |
| 499 | 3300045051 | Ga0451576_0005513 | Ga0451576_0005513_7886_8824 | 284 |
| 500 | 3300046539 | Ga0495621_0066412 | Ga0495621_0066412_227_1165 | 284 |
| 501 | 3300048909 | Ga0496106_0057156 | Ga0496106_0057156_90_1028 | 284 |
| 502 | 3300049580 | Ga0501046_0019777 | Ga0501046_0019777_3770_4705 | 284 |
| 503 | 3300050511 | nmdc:mga08y16_190_c1 | nmdc:mga08y16_190_c1_45501_46445 | 284 |
| 504 | 3300003203 | JGI25406J46586_10001538 | JGI25406J46586_100015387 | 285 |
| 505 | 3300005435 | Ga0070714_100089254 | Ga0070714_1000892542 | 285 |
| 506 | 3300005437 | Ga0070710_10008027 | Ga0070710_100080273 | 285 |
| 507 | 3300005441 | Ga0070700_100270760 | Ga0070700_1002707601 | 285 |
| 508 | 3300005445 | Ga0070708_100314990 | Ga0070708_1003149902 | 285 |
| 509 | 3300005467 | Ga0070706_100025976 | Ga0070706_1000259761 | 285 |
| 510 | 3300005467 | Ga0070706_100241516 | Ga0070706_1002415162 | 285 |
| 511 | 3300005468 | Ga0070707_100002379 | Ga0070707_10000237918 | 285 |
| 512 | 3300005616 | Ga0068852_100245630 | Ga0068852_1002456302 | 285 |
| 513 | 3300005985 | Ga0081539_10003824 | Ga0081539_1000382410 | 285 |
| 514 | 3300006028 | Ga0070717_10046109 | Ga0070717_100461092 | 285 |
| 515 | 3300025910 | Ga0207684_10017603 | Ga0207684_100176037 | 285 |
| 516 | 3300025910 | Ga0207684_10133541 | Ga0207684_101335412 | 285 |
| 517 | 3300025922 | Ga0207646_10001470 | Ga0207646_100014703 | 285 |
| 518 | 3300025931 | Ga0207644_10032611 | Ga0207644_100326114 | 285 |
| 519 | 3300025933 | Ga0207706_10178533 | Ga0207706_101785331 | 285 |
| 520 | 3300026142 | Ga0207698_10036041 | Ga0207698_100360413 | 285 |
| 521 | 3300031731 | Ga0307405_10014886 | Ga0307405_100148864 | 285 |
| 522 | 3300031824 | Ga0307413_10127217 | Ga0307413_101272172 | 285 |
| 523 | 3300031852 | Ga0307410_10018143 | Ga0307410_100181432 | 285 |
| 524 | 3300031903 | Ga0307407_10046631 | Ga0307407_100466312 | 285 |
| 525 | 3300031911 | Ga0307412_10024623 | Ga0307412_100246233 | 285 |
| 526 | 3300032004 | Ga0307414_10010416 | Ga0307414_100104165 | 285 |
| 527 | 3300035171 | Ga0373946_0057075 | Ga0373946_0057075_487_1425 | 285 |
| 528 | 3300036401 | Ga0373937_0161024 | Ga0373937_0161024_382_1320 | 285 |
| 529 | 3300044712 | Ga0453684_0262500 | Ga0453684_0262500_608_1540 | 285 |
| 530 | 3300046683 | Ga0495658_0058042 | Ga0495658_0058042_1233_2171 | 285 |
| 531 | 3300046809 | Ga0495600_0159626 | Ga0495600_0159626_122_1060 | 285 |
| 532 | 3300048905 | Ga0496102_0471551 | Ga0496102_0471551_131_1072 | 285 |
| 533 | 3300048912 | Ga0496109_0318562 | Ga0496109_0318562_252_1193 | 285 |
| 534 | 3300049571 | Ga0501034_0020767 | Ga0501034_0020767_3157_4095 | 285 |
| 535 | 3300049572 | Ga0501036_0151388 | Ga0501036_0151388_555_1493 | 285 |
| 536 | 3300049579 | Ga0501043_0006665 | Ga0501043_0006665_3857_4795 | 285 |
| 537 | 3300049581 | Ga0501047_0007815 | Ga0501047_0007815_5280_6218 | 285 |
| 538 | 3300049582 | Ga0501048_0092331 | Ga0501048_0092331_1096_2040 | 285 |
| 539 | 3300049823 | Ga0501044_0051179 | Ga0501044_0051179_149_1087 | 285 |
| 540 | 3300013307 | Ga0157372_10501756 | Ga0157372_105017562 | 286 |
| 541 | 3300026116 | Ga0207674_10208280 | Ga0207674_102082802 | 286 |
| 542 | 3300028379 | Ga0268266_10141537 | Ga0268266_101415372 | 286 |
| 543 | 3300028380 | Ga0268265_10077977 | Ga0268265_100779772 | 286 |
| 544 | 3300031649 | Ga0307514_10000339 | Ga0307514_10000339118 | 286 |
| 545 | 3300031852 | Ga0307410_10176361 | Ga0307410_101763612 | 286 |
| 546 | 3300032004 | Ga0307414_10415387 | Ga0307414_104153872 | 286 |
| 547 | 3300035695 | Ga0373927_0261672 | Ga0373927_0261672_115_1062 | 286 |
| 548 | 3300037418 | Ga0395900_0046685 | Ga0395900_0046685_2073_3029 | 286 |
| 549 | 3300037466 | Ga0395898_0002205 | Ga0395898_0002205_19722_20678 | 286 |
| 550 | 3300048908 | Ga0496105_0400806 | Ga0496105_0400806_23_970 | 286 |
| 551 | 3300048917 | Ga0496114_0026107 | Ga0496114_0026107_3361_4308 | 286 |
| 552 | iso_pu_bacteria | 2889914905 | 2889918365 | 286 |
| 553 | 3300005435 | Ga0070714_100016146 | Ga0070714_1000161464 | 287 |
| 554 | 3300005518 | Ga0070699_100267726 | Ga0070699_1002677262 | 287 |
| 555 | 3300005536 | Ga0070697_100092399 | Ga0070697_1000923992 | 287 |
| 556 | 3300005545 | Ga0070695_100056862 | Ga0070695_1000568623 | 287 |
| 557 | 3300005548 | Ga0070665_100024707 | Ga0070665_1000247072 | 287 |
| 558 | 3300005617 | Ga0068859_100026986 | Ga0068859_1000269862 | 287 |
| 559 | 3300006931 | Ga0097620_100026987 | Ga0097620_1000269872 | 287 |
| 560 | 3300009553 | Ga0105249_10272884 | Ga0105249_102728842 | 287 |
| 561 | 3300025910 | Ga0207684_10172713 | Ga0207684_101727132 | 287 |
| 562 | 3300025961 | Ga0207712_10356591 | Ga0207712_103565911 | 287 |
| 563 | 3300028379 | Ga0268266_10011882 | Ga0268266_100118822 | 287 |
| 564 | 3300028379 | Ga0268266_10231960 | Ga0268266_102319602 | 287 |
| 565 | 3300035086 | Ga0373934_0126211 | Ga0373934_0126211_56_1000 | 287 |
| 566 | 3300035691 | Ga0373931_0086664 | Ga0373931_0086664_111_1067 | 287 |
| 567 | 3300050511 | nmdc:mga08y16_378652_c1 | nmdc:mga08y16_378652_c1_480_1421 | 287 |
| 568 | 3300005614 | Ga0068856_100154080 | Ga0068856_1001540802 | 288 |
| 569 | 3300014497 | Ga0182008_10020965 | Ga0182008_100209652 | 288 |
| 570 | 3300025928 | Ga0207700_10311710 | Ga0207700_103117102 | 288 |
| 571 | 3300026035 | Ga0207703_10147413 | Ga0207703_101474132 | 288 |
| 572 | 3300035117 | Ga0373953_0014557 | Ga0373953_0014557_945_1889 | 288 |
| 573 | 3300035170 | Ga0373943_0034790 | Ga0373943_0034790_271_1221 | 288 |
| 574 | 3300035172 | Ga0373955_0040933 | Ga0373955_0040933_320_1264 | 288 |
| 575 | 3300035724 | Ga0373933_0004917 | Ga0373933_0004917_3316_4260 | 288 |
| 576 | 3300036401 | Ga0373937_0016046 | Ga0373937_0016046_1732_2676 | 288 |
| 577 | 3300046533 | Ga0495640_0030571 | Ga0495640_0030571_2657_3601 | 288 |
| 578 | 3300046663 | Ga0495635_0180323 | Ga0495635_0180323_169_1119 | 288 |
| 579 | 3300047444 | Ga0495675_0286733 | Ga0495675_0286733_14_958 | 288 |
| 580 | 3300049586 | Ga0501070_0059866 | Ga0501070_0059866_1422_2363 | 288 |
| 581 | 3300049742 | Ga0501080_0021641 | Ga0501080_0021641_334_1275 | 288 |
| 582 | 3300049744 | Ga0501083_0109311 | Ga0501083_0109311_492_1433 | 288 |
| 583 | 3300053085 | Ga0495619_0132043 | Ga0495619_0132043_491_1435 | 288 |
| 584 | iso_pu_bacteria | 2643221733 | 2644730340 | 288 |
| 585 | iso_pu_bacteria | 2643221734 | 2644736311 | 288 |
| 586 | iso_pu_bacteria | 2643221736 | 2644746059 | 288 |
| 587 | iso_pu_bacteria | 2818991467 | 2819720409 | 288 |
| 588 | iso_pu_bacteria | 2841760612 | 2841765282 | 288 |
| 589 | iso_pu_bacteria | 2844104063 | 2844106892 | 288 |
| 590 | iso_pu_bacteria | 2851182111 | 2851185881 | 288 |
| 591 | iso_pu_bacteria | 2851246043 | 2851248932 | 288 |
| 592 | iso_pu_bacteria | 2917699015 | 2917702327 | 288 |
| 593 | iso_pu_bacteria | 8057529695 | 8057532542 | 288 |
| 594 | 3300005456 | Ga0070678_100011698 | Ga0070678_1000116982 | 290 |
| 595 | 3300025940 | Ga0207691_10047951 | Ga0207691_100479513 | 290 |
| 596 | 3300026121 | Ga0207683_10105910 | Ga0207683_101059102 | 290 |
| 597 | 3300003771 | Ga0055526_1002615 | Ga0055526_10026153 | 291 |
| 598 | 3300005436 | Ga0070713_100061563 | Ga0070713_1000615631 | 291 |
| 599 | 3300005439 | Ga0070711_100026370 | Ga0070711_1000263702 | 291 |
| 600 | 3300006175 | Ga0070712_100209611 | Ga0070712_1002096112 | 291 |
| 601 | 3300025294 | Ga0209025_1001592 | Ga0209025_10015927 | 291 |
| 602 | 3300025294 | Ga0209025_1051603 | Ga0209025_10516031 | 291 |
| 603 | 3300025295 | Ga0209564_1000074 | Ga0209564_1000074113 | 291 |
| 604 | 3300025906 | Ga0207699_10046945 | Ga0207699_100469453 | 291 |
| 605 | 3300025915 | Ga0207693_10026247 | Ga0207693_100262472 | 291 |
| 606 | 3300035170 | Ga0373943_0122772 | Ga0373943_0122772_23_973 | 291 |
| 607 | 3300035692 | Ga0373935_0089391 | Ga0373935_0089391_227_1177 | 291 |
| 608 | 3300035695 | Ga0373927_0111726 | Ga0373927_0111726_666_1616 | 291 |
| 609 | 3300036401 | Ga0373937_0003711 | Ga0373937_0003711_5096_6046 | 291 |
| 610 | 3300037068 | Ga0373925_0098325 | Ga0373925_0098325_674_1624 | 291 |
| 611 | 3300046463 | Ga0495653_0282749 | Ga0495653_0282749_50_1000 | 291 |
| 612 | 3300048920 | Ga0496117_0041047 | Ga0496117_0041047_1186_2133 | 291 |
| 613 | 3300003187 | JGI25151J46595_10000015 | JGI25151J46595_10000015167 | 292 |
| 614 | 3300003775 | Ga0055524_1000051 | Ga0055524_100005139 | 292 |
| 615 | 3300005262 | Ga0065165_1000014 | Ga0065165_1000014170 | 292 |
| 616 | 3300005436 | Ga0070713_100083082 | Ga0070713_1000830821 | 292 |
| 617 | 3300025284 | Ga0209130_1000024 | Ga0209130_1000024104 | 292 |
| 618 | 3300025291 | Ga0209675_1000378 | Ga0209675_100037825 | 292 |
| 619 | 3300025294 | Ga0209025_1000010 | Ga0209025_1000010693 | 292 |
| 620 | 3300025295 | Ga0209564_1000048 | Ga0209564_1000048225 | 292 |
| 621 | 3300025299 | Ga0209256_1000041 | Ga0209256_1000041225 | 292 |
| 622 | 3300025299 | Ga0209256_1000109 | Ga0209256_1000109150 | 292 |
| 623 | 3300031901 | Ga0307406_10059842 | Ga0307406_100598423 | 292 |
| 624 | 3300048925 | Ga0496122_0020976 | Ga0496122_0020976_607_1557 | 292 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
129
321
0.95
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar