F470296

General Info

Members Datasets Scaffolds Average Seq Length
624 324 1248 262

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0022772|Ga0466961_0022772_3038_3997
Length 319
Sequence MSSNRKPNRATTRRQRSHYSTDAQDVPPTKNIERPDERRSPGDRRQTDRPKSERNMPQFAANLTMLFNEVPFLERFEAAARAGFNAVEFLFPYPFPAAELAERLEANKLRLVLHNLPAGNWEAGERGIACLPDRVAEFRDGVGRAIEYAKALRVPQLNCLVGIPTRDVTPERARSTIVDNLRFAAAALAKENIKLLVEPCNSYDIPGFALNRSGETLEVIRDVASDNLYLQYDIYHMQRMEGELAATLQKHLPRIAHIQLADNPGRNEPGTGEINYAFLFEWLDRLGYSGHIGCEYKPRTTTLEGLTWLREIAGRRGAR

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
85 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
140 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
148 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
155 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
166 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
196 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
209 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
222 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
241 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
242 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
243 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
249 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
262 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
263 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
264 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
265 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
266 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
267 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
268 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
269 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
270 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
273 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
285 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
286 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
287 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
288 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
289 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
290 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
291 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
292 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
293 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
294 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
295 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
296 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
297 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
298 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
299 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
300 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
301 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
302 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
303 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
304 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
305 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
306 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
307 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
308 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
309 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
310 2857558681 Duganella sp. R-74565 Isolate Unclassified
311 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
312 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
313 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
314 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
315 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
316 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
317 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
318 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
319 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
320 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
321 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
322 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
323 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
324 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.59
Metatranscriptomes 0
Isolates 6.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.97
Nodule 1.92
Rhizoplane 2.4
Rhizosphere 73.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0022772 3300044693 Bacteria 4029
2 SwRhRL2b_contig_384156 2162886007 Bacteria 1603
3 JGI25155J39150_1000924 3300002704 Bacteria 3829
4 JGI25156J39149_1002329 3300002705 Bacteria 6929
5 JGI25156J39149_1002497 3300002705 Bacteria 6552
6 JGI25156J39149_1003120 3300002705 Bacteria 5587
7 JGI25156J39149_1004604 3300002705 Bacteria 4161
8 JGI25162J39368_1000007 3300002737 Bacteria 403947
9 JGI25154J39366_1003053 3300002738 Bacteria 3780
10 JGI25154J39366_1004395 3300002738 Bacteria 2541
11 JGI25157J39369_1000918 3300002741 Bacteria 14047
12 JGI25163J39215_1000087 3300002771 Bacteria 39113
13 JGI25164J39214_1000010 3300002772 Bacteria 288863
14 JGI25164J39214_1000013 3300002772 Bacteria 253470
15 JGI25159J45721_1006561 3300002987 Bacteria 3467
16 JGI25160J50197_1009997 3300003354 Bacteria 3467
17 Ga0055538_1000006 3300003751 Bacteria 403947
18 Ga0055538_1000664 3300003751 Bacteria 10790
19 Ga0055539_1000010 3300003752 Bacteria 403947
20 Ga0055539_1000557 3300003752 Bacteria 10790
21 Ga0055533_1000013 3300003756 Bacteria 403947
22 Ga0055533_1000218 3300003756 Bacteria 41729
23 Ga0055533_1000718 3300003756 Bacteria 10790
24 Ga0055533_1002094 3300003756 Bacteria 4808
25 Ga0055532_1000001 3300003758 Bacteria 1119836
26 Ga0055532_1000097 3300003758 Bacteria 98781
27 Ga0055525_1000015 3300003759 Bacteria 403947
28 Ga0055525_1000759 3300003759 Bacteria 10790
29 Ga0055527_1000002 3300003760 Bacteria 830488
30 Ga0055535_1000001 3300003761 Bacteria 1119836
31 Ga0055535_1005969 3300003761 Bacteria 2553
32 Ga0055542_1000001 3300003762 Bacteria 1119836
33 Ga0055529_1000026 3300003763 Bacteria 293254
34 Ga0055528_1005416 3300003790 Bacteria 5949
35 Ga0055541_1000007 3300003841 Bacteria 403947
36 Ga0055541_1000513 3300003841 Bacteria 10790
37 Ga0065704_10001012 3300005289 Bacteria 23775
38 Ga0070658_10006978 3300005327 Bacteria 9124
39 Ga0070676_10172649 3300005328 Bacteria 1400
40 Ga0070690_100003489 3300005330 Bacteria 8600
41 Ga0070670_100164010 3300005331 Bacteria 1926
42 Ga0070670_100189825 3300005331 Bacteria 1785
43 Ga0070677_10000641 3300005333 Bacteria 11724
44 Ga0070677_10021135 3300005333 Bacteria 2384
45 Ga0070666_10003793 3300005335 Bacteria 9164
46 Ga0070666_10010027 3300005335 Bacteria 5913
47 Ga0070666_10020207 3300005335 Bacteria 4304
48 Ga0068868_100005608 3300005338 Bacteria 8829
49 Ga0068868_100007102 3300005338 Bacteria 7963
50 Ga0070668_100009068 3300005347 Bacteria 7388
51 Ga0070669_100109873 3300005353 Bacteria 2091
52 Ga0070669_100382665 3300005353 Bacteria 1148
53 Ga0070675_100003529 3300005354 Bacteria 11864
54 Ga0070675_100013043 3300005354 Bacteria 6527
55 Ga0070671_100008812 3300005355 Bacteria 8092
56 Ga0070671_100016300 3300005355 Bacteria 6011
57 Ga0070674_100000393 3300005356 Bacteria 21925
58 Ga0070674_100021559 3300005356 Bacteria 4140
59 Ga0070673_100002602 3300005364 Bacteria 11027
60 Ga0070673_100003255 3300005364 Bacteria 10078
61 Ga0070673_100280630 3300005364 Bacteria 1461
62 Ga0070667_100017344 3300005367 Bacteria 5965
63 Ga0070667_100017642 3300005367 Bacteria 5914
64 Ga0070667_100022079 3300005367 Bacteria 5279
65 Ga0070663_100019109 3300005455 Bacteria 4509
66 Ga0070678_100003802 3300005456 Bacteria 8468
67 Ga0070678_100026862 3300005456 Bacteria 3899
68 Ga0070678_100109912 3300005456 Bacteria 2155
69 Ga0068867_100004988 3300005459 Bacteria 9355
70 Ga0068867_100114738 3300005459 Bacteria 2074
71 Ga0068867_100148133 3300005459 Bacteria 1841
72 Ga0070706_100008196 3300005467 Bacteria 9751
73 Ga0070697_100188220 3300005536 Bacteria 1751
74 Ga0068853_100299694 3300005539 Bacteria 1485
75 Ga0070672_100000965 3300005543 Bacteria 17373
76 Ga0070672_100172437 3300005543 Bacteria 1799
77 Ga0070695_100133406 3300005545 Bacteria 1714
78 Ga0070665_100013435 3300005548 Bacteria 8238
79 Ga0070665_100067743 3300005548 Bacteria 3579
80 Ga0070665_100298738 3300005548 Bacteria 1613
81 Ga0068855_100002661 3300005563 Bacteria 22010
82 Ga0068856_100106259 3300005614 Bacteria 2801
83 Ga0070702_100238447 3300005615 Bacteria 1226
84 Ga0068852_100007767 3300005616 Bacteria 7852
85 Ga0068852_100041893 3300005616 Bacteria 3874
86 Ga0068859_100099738 3300005617 Bacteria 2960
87 Ga0068864_100004274 3300005618 Bacteria 11747
88 Ga0068864_100006133 3300005618 Bacteria 9859
89 Ga0068861_100163064 3300005719 Bacteria 1840
90 Ga0068851_10001242 3300005834 Bacteria 11079
91 Ga0068870_10059972 3300005840 Bacteria 2041
92 Ga0068863_100001708 3300005841 Bacteria 21723
93 Ga0068863_100006287 3300005841 Bacteria 11662
94 Ga0068858_100029699 3300005842 Bacteria 5077
95 Ga0068858_100119032 3300005842 Bacteria 2469
96 Ga0068860_100031872 3300005843 Bacteria 5067
97 Ga0097621_100037821 3300006237 Bacteria 3870
98 Ga0097621_100074508 3300006237 Bacteria 2812
99 Ga0068871_100015232 3300006358 Bacteria 5750
100 Ga0068871_100018818 3300006358 Bacteria 5261
101 Ga0068871_100090693 3300006358 Bacteria 2546
102 Ga0068865_100056786 3300006881 Bacteria 2729
103 Ga0097620_100099735 3300006931 Bacteria 2960
104 Ga0105251_10034928 3300009011 Bacteria 2484
105 Ga0105244_10000797 3300009036 Bacteria 26855
106 Ga0105244_10001058 3300009036 Bacteria 23011
107 Ga0105250_10000919 3300009092 Bacteria 17336
108 Ga0105248_10029286 3300009177 Bacteria 6142
109 Ga0105238_10118544 3300009551 Bacteria 2627
110 Ga0105249_10045233 3300009553 Bacteria 4003
111 Ga0157370_10047293 3300013104 Bacteria 4125
112 Ga0157369_10000205 3300013105 Bacteria 81963
113 Ga0157369_10043192 3300013105 Bacteria 4914
114 Ga0157369_10356239 3300013105 Bacteria 1519
115 Ga0157374_10080448 3300013296 Bacteria 3090
116 Ga0157378_10066112 3300013297 Bacteria 3237
117 Ga0163162_10059762 3300013306 Bacteria 3844
118 Ga0163162_10133705 3300013306 Bacteria 2590
119 Ga0157372_10113372 3300013307 Bacteria 3107
120 Ga0163163_10017295 3300014325 Bacteria 6722
121 Ga0182008_10061219 3300014497 Bacteria 1855
122 Ga0157379_10005337 3300014968 Bacteria 11041
123 Ga0157379_10510589 3300014968 Bacteria 1115
124 Ga0157376_10004661 3300014969 Bacteria 9557
125 Ga0157376_10137873 3300014969 Bacteria 2185
126 Ga0182007_10000075 3300015262 Bacteria 77567
127 Ga0182007_10002870 3300015262 Bacteria 8381
128 Ga0182007_10005932 3300015262 Bacteria 5304
129 Ga0182005_1000031 3300015265 Bacteria 202902
130 Ga0182005_1020393 3300015265 Bacteria 1824
131 Ga0183361_10008 3300016635 Bacteria 259171
132 Ga0163161_10068961 3300017792 Bacteria 2584
133 Ga0213872_10000001 3300021361 Bacteria 662532
134 Ga0213872_10019380 3300021361 Bacteria 3133
135 Ga0213872_10036293 3300021361 Bacteria 2253
136 Ga0209435_100040 3300025206 Bacteria 115475
137 Ga0209435_102010 3300025206 Bacteria 2449
138 Ga0209760_100164 3300025207 Bacteria 39146
139 Ga0209784_100002 3300025224 Bacteria 1753105
140 Ga0209784_100022 3300025224 Bacteria 403999
141 Ga0209566_100003 3300025225 Bacteria 1753105
142 Ga0209566_100021 3300025225 Bacteria 403999
143 Ga0209674_100004 3300025226 Bacteria 1753105
144 Ga0209674_100005 3300025226 Bacteria 1708125
145 Ga0209674_100038 3300025226 Bacteria 403999
146 Ga0209674_100265 3300025226 Bacteria 41160
147 Ga0209672_100001 3300025228 Bacteria 2828210
148 Ga0209672_108609 3300025228 Bacteria 1498
149 Ga0209147_100001 3300025229 Bacteria 2384371
150 Ga0209147_100141 3300025229 Bacteria 115466
151 Ga0209563_100006 3300025230 Bacteria 1753105
152 Ga0209563_100042 3300025230 Bacteria 403999
153 Ga0209563_105263 3300025230 Bacteria 2368
154 Ga0207427_100027 3300025231 Bacteria 403999
155 Ga0207427_102327 3300025231 Bacteria 5251
156 Ga0209437_100049 3300025233 Bacteria 403999
157 Ga0209437_106031 3300025233 Bacteria 2036
158 Ga0209258_100001 3300025242 Bacteria 2384269
159 Ga0209258_100346 3300025242 Bacteria 66811
160 Ga0209646_1000077 3300025246 Bacteria 208262
161 Ga0209646_1000218 3300025246 Bacteria 62078
162 Ga0209026_1000725 3300025250 Bacteria 19335
163 Ga0209677_100003 3300025253 Bacteria 1753105
164 Ga0209677_100025 3300025253 Bacteria 403999
165 Ga0209148_1000003 3300025254 Bacteria 2384288
166 Ga0209759_1000029 3300025256 Bacteria 286968
167 Ga0209759_1000232 3300025256 Bacteria 83288
168 Ga0209759_1000284 3300025256 Bacteria 70505
169 Ga0209759_1000447 3300025256 Bacteria 47749
170 Ga0209233_1000043 3300025261 Bacteria 509723
171 Ga0209233_1000523 3300025261 Bacteria 22090
172 Ga0209455_1000001 3300025272 Bacteria 2384278
173 Ga0209455_1004598 3300025272 Bacteria 4468
174 Ga0209673_1011374 3300025273 Bacteria 3674
175 Ga0207697_10111148 3300025315 Bacteria 1173
176 Ga0207656_10008559 3300025321 Bacteria 3770
177 Ga0207696_1000976 3300025711 Bacteria 17336
178 Ga0207655_1002971 3300025728 Bacteria 13018
179 Ga0207655_1013239 3300025728 Bacteria 4750
180 Ga0207713_1000006 3300025735 Bacteria 586163
181 Ga0207713_1000287 3300025735 Bacteria 58430
182 Ga0207713_1071363 3300025735 Bacteria 1281
183 Ga0207682_10000348 3300025893 Bacteria 21135
184 Ga0207682_10040851 3300025893 Bacteria 1891
185 Ga0207680_10011430 3300025903 Bacteria 4487
186 Ga0207680_10045023 3300025903 Bacteria 2599
187 Ga0207680_10202663 3300025903 Bacteria 1353
188 Ga0207647_10057960 3300025904 Bacteria 2373
189 Ga0207647_10218487 3300025904 Bacteria 1099
190 Ga0207645_10005303 3300025907 Bacteria 9380
191 Ga0207645_10134649 3300025907 Bacteria 1609
192 Ga0207643_10029409 3300025908 Bacteria 3055
193 Ga0207643_10093601 3300025908 Bacteria 1755
194 Ga0207705_10001087 3300025909 Bacteria 22102
195 Ga0207681_10030977 3300025923 Bacteria 3491
196 Ga0207681_10090730 3300025923 Bacteria 2181
197 Ga0207650_10045512 3300025925 Bacteria 3228
198 Ga0207650_10276630 3300025925 Bacteria 1366
199 Ga0207659_10023460 3300025926 Bacteria 4118
200 Ga0207659_10060808 3300025926 Bacteria 2720
201 Ga0207644_10004737 3300025931 Bacteria 8840
202 Ga0207644_10008599 3300025931 Bacteria 6677
203 Ga0207690_10038831 3300025932 Bacteria 3101
204 Ga0207670_10029449 3300025936 Bacteria 3498
205 Ga0207669_10193325 3300025937 Bacteria 1470
206 Ga0207669_10195074 3300025937 Bacteria 1464
207 Ga0207691_10000030 3300025940 Bacteria 119013
208 Ga0207711_10010185 3300025941 Bacteria 7805
209 Ga0207711_10039914 3300025941 Bacteria 3993
210 Ga0207667_10000350 3300025949 Bacteria 62831
211 Ga0207667_10159921 3300025949 Bacteria 2317
212 Ga0207651_10001889 3300025960 Bacteria 9820
213 Ga0207651_10013928 3300025960 Bacteria 4624
214 Ga0207668_10052492 3300025972 Bacteria 2821
215 Ga0207668_10062835 3300025972 Bacteria 2616
216 Ga0207658_10013473 3300025986 Bacteria 5586
217 Ga0207658_10014105 3300025986 Bacteria 5473
218 Ga0207677_10032572 3300026023 Bacteria 3352
219 Ga0207677_10038322 3300026023 Bacteria 3142
220 Ga0207703_10002822 3300026035 Bacteria 14826
221 Ga0207639_10015060 3300026041 Bacteria 5446
222 Ga0207678_10032497 3300026067 Bacteria 4548
223 Ga0207702_10093230 3300026078 Bacteria 2641
224 Ga0207648_10002962 3300026089 Bacteria 17949
225 Ga0207648_10039836 3300026089 Bacteria 4130
226 Ga0207676_10002470 3300026095 Bacteria 13191
227 Ga0207676_10176324 3300026095 Bacteria 1867
228 Ga0207675_100233088 3300026118 Bacteria 1777
229 Ga0207675_100355689 3300026118 Bacteria 1436
230 Ga0207683_10000019 3300026121 Bacteria 119524
231 Ga0207683_10146392 3300026121 Bacteria 2130
232 Ga0207698_10007444 3300026142 Bacteria 6855
233 Ga0207698_10036256 3300026142 Bacteria 3618
234 Ga0209371_1005836 3300027312 Bacteria 4754
235 Ga0268266_10022216 3300028379 Bacteria 5406
236 Ga0268256_1005795 3300030500 Bacteria 4754
237 Ga0316181_1013099 3300030744 Bacteria 5551
238 Ga0307408_100017978 3300031548 Bacteria 4742
239 Ga0316576_10002685 3300031727 Bacteria 10171
240 Ga0316576_10042188 3300031727 Bacteria 3288
241 Ga0307516_10061724 3300031730 Bacteria 3635
242 Ga0307412_10000024 3300031911 Bacteria 235467
243 Ga0307412_10086170 3300031911 Bacteria 2185
244 Ga0307416_100011348 3300032002 Bacteria 5933
245 Ga0307416_100046829 3300032002 Bacteria 3417
246 Ga0373939_0029769 3300035114 Bacteria 1565
247 Ga0316574_0121517 3300035398 Bacteria 1677
248 Ga0316584_0039456 3300036712 Bacteria 3515
249 Ga0395899_0056146 3300037312 Bacteria 2911
250 Ga0395900_0320941 3300037418 Bacteria 1529
251 Ga0395898_0001609 3300037466 Bacteria 30768
252 Ga0395898_0009280 3300037466 Bacteria 10344
253 Ga0395898_0019625 3300037466 Bacteria 6876
254 Ga0395898_0250744 3300037466 Bacteria 1688
255 Ga0395901_0044045 3300038443 Bacteria 4628
256 Ga0436361_0014834 3300039447 Bacteria 7524
257 Ga0436361_0362643 3300039447 Bacteria 3381
258 Ga0436361_0529332 3300039447 Bacteria 100222
259 Ga0436361_0583982 3300039447 Bacteria 3560
260 Ga0436361_0601789 3300039447 Bacteria 15579
261 Ga0450893_0007786 3300042532 Bacteria 1741
262 Ga0466977_0002801 3300044666 Bacteria 8140
263 Ga0466966_0003879 3300044684 Bacteria 9877
264 Ga0466966_0011314 3300044684 Bacteria 5919
265 Ga0466961_0004681 3300044693 Bacteria 8595
266 Ga0466961_0048627 3300044693 Bacteria 2710
267 Ga0466963_0004884 3300044694 Bacteria 7816
268 Ga0466971_0003043 3300044719 Bacteria 7124
269 Ga0466968_0006059 3300044735 Bacteria 4539
270 Ga0466970_0024073 3300044765 Bacteria 3183
271 Ga0466957_0001149 3300044842 Bacteria 13693
272 Ga0466958_0001688 3300045836 Bacteria 10641
273 Ga0466958_0022819 3300045836 Bacteria 3668
274 Ga0495617_002431 3300046452 Bacteria 7407
275 Ga0495592_0057015 3300046454 Bacteria 2884
276 Ga0495592_0082481 3300046454 Bacteria 2323
277 Ga0495592_0177495 3300046454 Bacteria 1453
278 Ga0495590_0011280 3300046457 Bacteria 3344
279 Ga0495591_023929 3300046458 Bacteria 1947
280 Ga0495629_0000098 3300046459 Bacteria 75959
281 Ga0495629_0005711 3300046459 Bacteria 9290
282 Ga0495629_0017991 3300046459 Bacteria 5065
283 Ga0495638_0000316 3300046460 Bacteria 62373
284 Ga0495638_0001700 3300046460 Bacteria 19365
285 Ga0495638_0029119 3300046460 Bacteria 3562
286 Ga0495638_0040107 3300046460 Bacteria 2968
287 Ga0495641_0028474 3300046461 Bacteria 2703
288 Ga0495651_0001633 3300046462 Bacteria 17370
289 Ga0495651_0006073 3300046462 Bacteria 9224
290 Ga0495653_0000004 3300046463 Bacteria 376003
291 Ga0495653_0016004 3300046463 Bacteria 6113
292 Ga0495653_0022893 3300046463 Bacteria 5052
293 Ga0495653_0031931 3300046463 Bacteria 4184
294 Ga0495650_0000011 3300046471 Bacteria 615329
295 Ga0495650_0000039 3300046471 Bacteria 375501
296 Ga0495650_0000042 3300046471 Bacteria 357244
297 Ga0495650_0000383 3300046471 Bacteria 75998
298 Ga0495650_0003050 3300046471 Bacteria 12619
299 Ga0495650_0004297 3300046471 Bacteria 9832
300 Ga0495650_0030276 3300046471 Bacteria 2454
301 Ga0495650_0037570 3300046471 Bacteria 2106
302 Ga0495580_0000171 3300046472 Bacteria 48150
303 Ga0495580_0004558 3300046472 Bacteria 11632
304 Ga0495580_0004693 3300046472 Bacteria 11461
305 Ga0495580_0011894 3300046472 Bacteria 6711
306 Ga0495580_0017327 3300046472 Bacteria 5388
307 Ga0495580_0175274 3300046472 Bacteria 1481
308 Ga0495582_0006099 3300046473 Bacteria 6712
309 Ga0495582_0051509 3300046473 Bacteria 2270
310 Ga0495582_0108607 3300046473 Bacteria 1558
311 Ga0495605_0000665 3300046474 Bacteria 26127
312 Ga0495605_0005296 3300046474 Bacteria 7526
313 Ga0495605_0022422 3300046474 Bacteria 3335
314 Ga0495605_0053645 3300046474 Bacteria 1955
315 Ga0495605_0076635 3300046474 Bacteria 1570
316 Ga0495639_0042590 3300046475 Bacteria 2048
317 Ga0495662_0012275 3300046476 Bacteria 4184
318 Ga0495662_0213037 3300046476 Bacteria 952
319 Ga0495664_0013512 3300046477 Bacteria 4630
320 Ga0495584_0000573 3300046491 Bacteria 24792
321 Ga0495584_0110237 3300046491 Bacteria 1392
322 Ga0495584_0115381 3300046491 Bacteria 1359
323 Ga0495585_0019615 3300046492 Bacteria 3897
324 Ga0495585_0192187 3300046492 Bacteria 1043
325 Ga0495594_0162822 3300046499 Bacteria 1268
326 Ga0495596_0003413 3300046500 Bacteria 8055
327 Ga0495596_0003923 3300046500 Bacteria 7374
328 Ga0495596_0008939 3300046500 Bacteria 4427
329 Ga0495607_0001824 3300046501 Bacteria 18169
330 Ga0495583_0000045 3300046506 Bacteria 220503
331 Ga0495583_0001241 3300046506 Bacteria 27079
332 Ga0495583_0056257 3300046506 Bacteria 1775
333 Ga0495583_0061982 3300046506 Bacteria 1666
334 Ga0495606_0000059 3300046507 Bacteria 186886
335 Ga0495606_0000189 3300046507 Bacteria 108007
336 Ga0495606_0000396 3300046507 Bacteria 73433
337 Ga0495606_0042438 3300046507 Bacteria 3041
338 Ga0495606_0069955 3300046507 Bacteria 2215
339 Ga0495608_0009704 3300046511 Bacteria 6718
340 Ga0495608_0022443 3300046511 Bacteria 4326
341 Ga0495608_0115802 3300046511 Bacteria 1720
342 Ga0495610_0005113 3300046512 Bacteria 9436
343 Ga0495616_0010104 3300046513 Bacteria 5477
344 Ga0495616_0016974 3300046513 Bacteria 4020
345 Ga0495618_0002757 3300046514 Bacteria 11167
346 Ga0495618_0037109 3300046514 Bacteria 3059
347 Ga0495618_0060564 3300046514 Bacteria 2400
348 Ga0495618_0229720 3300046514 Bacteria 1168
349 Ga0495620_0022172 3300046515 Bacteria 3066
350 Ga0495628_0002356 3300046516 Bacteria 17046
351 Ga0495628_0002536 3300046516 Bacteria 16432
352 Ga0495628_0074239 3300046516 Bacteria 2649
353 Ga0495628_0165798 3300046516 Bacteria 1677
354 Ga0495628_0223756 3300046516 Bacteria 1412
355 Ga0495630_0019548 3300046517 Bacteria 4980
356 Ga0495637_0064131 3300046520 Bacteria 1499
357 Ga0495643_0000323 3300046522 Bacteria 65626
358 Ga0495643_0000573 3300046522 Bacteria 45191
359 Ga0495643_0173842 3300046522 Bacteria 1051
360 Ga0495644_0000135 3300046523 Bacteria 35398
361 Ga0495644_0004017 3300046523 Bacteria 5785
362 Ga0495648_0000054 3300046524 Bacteria 159674
363 Ga0495648_0000659 3300046524 Bacteria 36898
364 Ga0495648_0006023 3300046524 Bacteria 9959
365 Ga0495648_0010133 3300046524 Bacteria 7214
366 Ga0495648_0014554 3300046524 Bacteria 5752
367 Ga0495648_0018375 3300046524 Bacteria 4950
368 Ga0495648_0044192 3300046524 Bacteria 2783
369 Ga0495648_0047035 3300046524 Bacteria 2670
370 Ga0495666_0007336 3300046526 Bacteria 5527
371 Ga0495666_0015787 3300046526 Bacteria 3762
372 Ga0495666_0040099 3300046526 Bacteria 2271
373 Ga0495666_0101105 3300046526 Bacteria 1358
374 Ga0495642_0019532 3300046528 Bacteria 2657
375 Ga0495642_0055643 3300046528 Bacteria 1633
376 Ga0495652_0003297 3300046529 Bacteria 16061
377 Ga0495652_0018130 3300046529 Bacteria 6282
378 Ga0495652_0030735 3300046529 Bacteria 4706
379 Ga0495652_0113471 3300046529 Bacteria 2175
380 Ga0495654_0068662 3300046530 Bacteria 1684
381 Ga0495665_0010059 3300046531 Bacteria 5125
382 Ga0495665_0031026 3300046531 Bacteria 2860
383 Ga0495665_0158413 3300046531 Bacteria 1180
384 Ga0495640_0003061 3300046533 Bacteria 13456
385 Ga0495640_0008275 3300046533 Bacteria 8160
386 Ga0495640_0041161 3300046533 Bacteria 3230
387 Ga0495586_0009707 3300046535 Bacteria 5125
388 Ga0495587_0007810 3300046536 Bacteria 6911
389 Ga0495587_0034308 3300046536 Bacteria 3060
390 Ga0495609_0000582 3300046538 Bacteria 28727
391 Ga0495609_0000604 3300046538 Bacteria 28136
392 Ga0495609_0000992 3300046538 Bacteria 20251
393 Ga0495609_0100032 3300046538 Bacteria 1257
394 Ga0495597_0000695 3300046542 Bacteria 27033
395 Ga0495597_0005843 3300046542 Bacteria 6435
396 Ga0495597_0015880 3300046542 Bacteria 3561
397 Ga0495597_0053199 3300046542 Bacteria 1781
398 Ga0495645_0071741 3300046543 Bacteria 2497
399 Ga0495622_0000562 3300046557 Bacteria 22316
400 Ga0495622_0020320 3300046557 Bacteria 3092
401 Ga0495622_0021156 3300046557 Bacteria 3031
402 Ga0495633_0000066 3300046558 Bacteria 139193
403 Ga0495633_0000349 3300046558 Bacteria 50979
404 Ga0495633_0000448 3300046558 Bacteria 42585
405 Ga0495633_0000625 3300046558 Bacteria 33168
406 Ga0495633_0012066 3300046558 Bacteria 4614
407 Ga0495633_0057090 3300046558 Bacteria 1834
408 Ga0495667_0389429 3300046559 Bacteria 878
409 Ga0495668_0000089 3300046616 Bacteria 145477
410 Ga0495668_0000285 3300046616 Bacteria 70023
411 Ga0495668_0005654 3300046616 Bacteria 8383
412 Ga0495668_0011977 3300046616 Bacteria 5163
413 Ga0495668_0083484 3300046616 Bacteria 1752
414 Ga0495634_0008824 3300046642 Bacteria 7477
415 Ga0495634_0019086 3300046642 Bacteria 4873
416 Ga0495611_0018908 3300046648 Bacteria 2957
417 Ga0495625_0001004 3300046660 Bacteria 37269
418 Ga0495625_0001045 3300046660 Bacteria 36364
419 Ga0495625_0013489 3300046660 Bacteria 6563
420 Ga0495625_0142858 3300046660 Bacteria 1614
421 Ga0495635_0002582 3300046663 Bacteria 12394
422 Ga0495635_0011795 3300046663 Bacteria 6128
423 Ga0495635_0013539 3300046663 Bacteria 5708
424 Ga0495659_0000294 3300046664 Bacteria 19839
425 Ga0495661_0009392 3300046665 Bacteria 6713
426 Ga0495661_0014666 3300046665 Bacteria 5247
427 Ga0495661_0069249 3300046665 Bacteria 2068
428 Ga0495661_0106668 3300046665 Bacteria 1567
429 Ga0495588_0071884 3300046674 Bacteria 1799
430 Ga0495657_0235939 3300046675 Bacteria 1105
431 Ga0495599_0004125 3300046678 Bacteria 8578
432 Ga0495599_0162398 3300046678 Bacteria 1380
433 Ga0495623_0002075 3300046679 Bacteria 13422
434 Ga0495623_0009617 3300046679 Bacteria 6276
435 Ga0495623_0043606 3300046679 Bacteria 2853
436 Ga0495623_0046244 3300046679 Bacteria 2763
437 Ga0495623_0101210 3300046679 Bacteria 1755
438 Ga0495646_0011087 3300046680 Bacteria 5721
439 Ga0495646_0023056 3300046680 Bacteria 3920
440 Ga0495646_0042302 3300046680 Bacteria 2796
441 Ga0495646_0110192 3300046680 Bacteria 1568
442 Ga0495613_0017427 3300046689 Bacteria 5349
443 Ga0495624_0020450 3300046690 Bacteria 4404
444 Ga0495624_0096753 3300046690 Bacteria 1818
445 Ga0495670_0000252 3300046691 Bacteria 24908
446 Ga0495670_0058753 3300046691 Bacteria 1930
447 Ga0495649_0017506 3300046694 Bacteria 4042
448 Ga0495649_0122546 3300046694 Bacteria 1374
449 Ga0495589_0132768 3300046794 Bacteria 1195
450 Ga0495600_0002579 3300046809 Bacteria 10440
451 Ga0495660_0000061 3300046810 Bacteria 129945
452 Ga0495660_0017018 3300046810 Bacteria 4187
453 Ga0495581_0002407 3300047315 Bacteria 10576
454 Ga0495581_0057259 3300047315 Bacteria 2249
455 Ga0495581_0086507 3300047315 Bacteria 1817
456 Ga0495604_0033974 3300047317 Bacteria 4035
457 Ga0495604_0061279 3300047317 Bacteria 2878
458 Ga0495604_0072785 3300047317 Bacteria 2596
459 Ga0495636_0000318 3300047318 Bacteria 18481
460 Ga0495674_0015392 3300047319 Bacteria 7152
461 Ga0495674_0061086 3300047319 Bacteria 3286
462 Ga0495674_0082063 3300047319 Bacteria 2764
463 Ga0495674_0145541 3300047319 Bacteria 1989
464 Ga0495672_0000130 3300047320 Bacteria 111611
465 Ga0495672_0000257 3300047320 Bacteria 74176
466 Ga0495676_0037739 3300047321 Bacteria 4018
467 Ga0495676_0042526 3300047321 Bacteria 3729
468 Ga0495676_0078272 3300047321 Bacteria 2518
469 Ga0495676_0195017 3300047321 Bacteria 1410
470 Ga0495680_0015443 3300047322 Bacteria 6588
471 Ga0495680_0175537 3300047322 Bacteria 1549
472 Ga0495683_0065407 3300047323 Bacteria 1793
473 Ga0495683_0066669 3300047323 Bacteria 1773
474 Ga0495687_000677 3300047443 Bacteria 38715
475 Ga0495687_009723 3300047443 Bacteria 5346
476 Ga0495687_011593 3300047443 Bacteria 4726
477 Ga0495687_053664 3300047443 Bacteria 1696
478 Ga0495675_0007652 3300047444 Bacteria 6661
479 Ga0495675_0011677 3300047444 Bacteria 5515
480 Ga0495675_0040173 3300047444 Bacteria 2980
481 Ga0495675_0082018 3300047444 Bacteria 2031
482 Ga0495677_0004961 3300047445 Bacteria 5075
483 Ga0495679_000025 3300047446 Bacteria 198386
484 Ga0495679_003322 3300047446 Bacteria 7778
485 Ga0495679_004332 3300047446 Bacteria 6573
486 Ga0495679_050482 3300047446 Bacteria 1251
487 Ga0495685_000093 3300047447 Bacteria 32265
488 Ga0495673_0005367 3300047469 Bacteria 7765
489 Ga0495673_0014475 3300047469 Bacteria 4099
490 Ga0495673_0016749 3300047469 Bacteria 3738
491 Ga0495684_0045593 3300047471 Bacteria 3355
492 Ga0495686_0052417 3300047472 Bacteria 2558
493 Ga0495686_0066510 3300047472 Bacteria 2227
494 Ga0495686_0069660 3300047472 Bacteria 2168
495 Ga0495593_0006606 3300047673 Bacteria 6786
496 Ga0495593_0006888 3300047673 Bacteria 6656
497 Ga0495593_0028797 3300047673 Bacteria 3049
498 Ga0495593_0126217 3300047673 Bacteria 1300
499 Ga0495602_0011805 3300048088 Bacteria 9019
500 Ga0495602_0025709 3300048088 Bacteria 5692
501 Ga0495602_0192490 3300048088 Bacteria 1562
502 Ga0495614_0001934 3300048089 Bacteria 9096
503 Ga0495614_0036303 3300048089 Bacteria 2116
504 Ga0495626_0025776 3300048091 Bacteria 2872
505 Ga0495626_0066817 3300048091 Bacteria 1625
506 Ga0496100_0196824 3300048903 Bacteria 1466
507 Ga0496101_0090955 3300048904 Bacteria 2270
508 Ga0496102_0164520 3300048905 Bacteria 2087
509 Ga0496103_0075178 3300048906 Bacteria 2118
510 Ga0496104_0000075 3300048907 Bacteria 102426
511 Ga0496104_0100519 3300048907 Bacteria 2768
512 Ga0496108_0128697 3300048911 Bacteria 2175
513 Ga0496109_0707042 3300048912 Bacteria 945
514 Ga0496110_0252171 3300048913 Bacteria 1606
515 Ga0496112_0001121 3300048915 Bacteria 19909
516 Ga0496113_0017103 3300048916 Bacteria 5027
517 Ga0496114_0035353 3300048917 Bacteria 4126
518 Ga0496114_0053163 3300048917 Bacteria 3376
519 Ga0496116_0000095 3300048919 Bacteria 202967
520 Ga0496116_0020463 3300048919 Bacteria 5025
521 Ga0496116_0051416 3300048919 Bacteria 2737
522 Ga0496117_0000032 3300048920 Bacteria 375533
523 Ga0496117_0009889 3300048920 Bacteria 8781
524 Ga0496117_0066094 3300048920 Bacteria 2454
525 Ga0496117_0066828 3300048920 Bacteria 2436
526 Ga0496117_0177083 3300048920 Bacteria 1230
527 Ga0496118_0000027 3300048921 Bacteria 375533
528 Ga0496118_0004422 3300048921 Bacteria 16677
529 Ga0496118_0006600 3300048921 Bacteria 12672
530 Ga0496118_0079938 3300048921 Bacteria 2304
531 Ga0496118_0229993 3300048921 Bacteria 1071
532 Ga0496119_0001970 3300048922 Bacteria 23359
533 Ga0496119_0018872 3300048922 Bacteria 5108
534 Ga0496120_0001876 3300048923 Bacteria 23403
535 Ga0496120_0003355 3300048923 Bacteria 14693
536 Ga0496121_0010777 3300048924 Bacteria 10247
537 Ga0496121_0019730 3300048924 Bacteria 6723
538 Ga0496121_0032418 3300048924 Bacteria 4749
539 Ga0496121_0039708 3300048924 Bacteria 4140
540 Ga0496121_0063109 3300048924 Bacteria 3030
541 Ga0496121_0074182 3300048924 Bacteria 2723
542 Ga0496121_0104910 3300048924 Bacteria 2170
543 Ga0496121_0155352 3300048924 Bacteria 1679
544 Ga0496122_0000131 3300048925 Bacteria 172577
545 Ga0496122_0000892 3300048925 Bacteria 55236
546 Ga0496122_0003391 3300048925 Bacteria 20976
547 Ga0496122_0006497 3300048925 Bacteria 13401
548 Ga0496122_0140809 3300048925 Bacteria 1509
549 Ga0496123_0000098 3300048926 Bacteria 173279
550 Ga0496123_0000842 3300048926 Bacteria 48999
551 Ga0496123_0003952 3300048926 Bacteria 16068
552 Ga0496123_0006577 3300048926 Bacteria 11229
553 Ga0496123_0007507 3300048926 Bacteria 10239
554 Ga0496123_0027332 3300048926 Bacteria 4252
555 Ga0496124_0000168 3300048927 Bacteria 131698
556 Ga0496124_0017230 3300048927 Bacteria 6816
557 Ga0496124_0050238 3300048927 Bacteria 3555
558 Ga0496125_0000100 3300048928 Bacteria 202713
559 Ga0496125_0002058 3300048928 Bacteria 27177
560 Ga0496125_0002222 3300048928 Bacteria 25860
561 Ga0496125_0011901 3300048928 Bacteria 8667
562 Ga0496125_0026967 3300048928 Bacteria 5216
563 Ga0496125_0121665 3300048928 Bacteria 1860
564 Ga0496126_0001346 3300048929 Bacteria 39017
565 Ga0496126_0003845 3300048929 Bacteria 18577
566 Ga0495678_002136 3300049459 Bacteria 13979
567 Ga0495678_013027 3300049459 Bacteria 3919
568 Ga0495678_047962 3300049459 Bacteria 1669
569 Ga0495678_057419 3300049459 Bacteria 1475
570 Ga0495682_0000121 3300049460 Bacteria 68179
571 Ga0495682_0000195 3300049460 Bacteria 48762
572 Ga0495682_0019298 3300049460 Bacteria 2564
573 Ga0495682_0074168 3300049460 Bacteria 1224
574 Ga0501036_0156769 3300049572 Bacteria 1920
575 Ga0501038_0193833 3300049574 Bacteria 1634
576 Ga0501039_0174916 3300049575 Bacteria 1688
577 Ga0501042_0097530 3300049578 Bacteria 2113
578 Ga0501048_0393301 3300049582 Bacteria 990
579 Ga0501075_0075861 3300049591 Bacteria 2542
580 Ga0501076_0030081 3300049592 Bacteria 4229
581 Ga0501079_0243323 3300049741 Bacteria 1406
582 Ga0501080_0417205 3300049742 Bacteria 1206
583 Ga0501081_0489052 3300049743 Bacteria 916
584 Ga0466962_0011553 3300061719 Bacteria 4253
585 2509128655 2508501125 Bacteria 7208311
586 2510250860 2510065045 Bacteria 7761063
587 2513960951 2513237151 Bacteria 6309801
588 2515679693 2515154122 Bacteria 8609520
589 2521559186 2521172590 Bacteria 5047645
590 2527075189 2526164713 Bacteria 6780608
591 2600809765 2600255067 Bacteria 6795583
592 2601671801 2600255292 Bacteria 6300551
593 2719639997 2718217991 Bacteria 7829542
594 2723877387 2721755763 Bacteria 4464185
595 2738820741 2738541296 Bacteria 7285013
596 2738833221 2738541298 Bacteria 7286732
597 2738874749 2738541306 Bacteria 7284992
598 2739186378 2738543002 Bacteria 7284546
599 2739221347 2738543008 Bacteria 7282815
600 2746089616 2744054900 Bacteria 8399525
601 2746098475 2744054901 Bacteria 8397047
602 2753566681 2751185846 Bacteria 7242164
603 2808969932 2808606384 Bacteria 8474373
604 2809004423 2808606390 Bacteria 8476311
605 2809011638 2808606391 Bacteria 8308166
606 2842328118 2842324504 Bacteria 9364110
607 2842352435 2842348783 Bacteria 9002918
608 2842459471 2842454564 Bacteria 8730687
609 2857552111 2857547612 Bacteria 6179999
610 2857562675 2857558681 Bacteria 6617694
611 2885278761 2885270888 Bacteria 9831543
612 2900635075 2900634093 Bacteria 10263517
613 2902689659 2902682994 Bacteria 8951596
614 2904605499 2904601388 Bacteria 5884906
615 2919530619 2919527303 Bacteria 7718827
616 2928505329 2928503688 Bacteria 7268108
617 2932413813 2932410948 Bacteria 6312192
618 2932417873 2932416698 Bacteria 6315112
619 2945936974 2945934425 Bacteria 7444609
620 2990706298 2990703756 Bacteria 7715990
621 642423121 641736151 Bacteria 7477263
622 643600785 643348564 Bacteria 8839022
623 8055268304 8055266321 Bacteria 7999742
624 8055302378 8055301274 Bacteria 8587385
625 Ga0466961_0022772
626 SwRhRL2b_contig_384156
627 JGI25155J39150_1000924
628 JGI25156J39149_1002329
629 JGI25156J39149_1002497
630 JGI25156J39149_1003120
631 JGI25156J39149_1004604
632 JGI25162J39368_1000007
633 JGI25154J39366_1003053
634 JGI25154J39366_1004395
635 JGI25157J39369_1000918
636 JGI25163J39215_1000087
637 JGI25164J39214_1000010
638 JGI25164J39214_1000013
639 JGI25159J45721_1006561
640 JGI25160J50197_1009997
641 Ga0055538_1000006
642 Ga0055538_1000664
643 Ga0055539_1000010
644 Ga0055539_1000557
645 Ga0055533_1000013
646 Ga0055533_1000218
647 Ga0055533_1000718
648 Ga0055533_1002094
649 Ga0055532_1000001
650 Ga0055532_1000097
651 Ga0055525_1000015
652 Ga0055525_1000759
653 Ga0055527_1000002
654 Ga0055535_1000001
655 Ga0055535_1005969
656 Ga0055542_1000001
657 Ga0055529_1000026
658 Ga0055528_1005416
659 Ga0055541_1000007
660 Ga0055541_1000513
661 Ga0065704_10001012
662 Ga0070658_10006978
663 Ga0070676_10172649
664 Ga0070690_100003489
665 Ga0070670_100164010
666 Ga0070670_100189825
667 Ga0070677_10000641
668 Ga0070677_10021135
669 Ga0070666_10003793
670 Ga0070666_10010027
671 Ga0070666_10020207
672 Ga0068868_100005608
673 Ga0068868_100007102
674 Ga0070668_100009068
675 Ga0070669_100109873
676 Ga0070669_100382665
677 Ga0070675_100003529
678 Ga0070675_100013043
679 Ga0070671_100008812
680 Ga0070671_100016300
681 Ga0070674_100000393
682 Ga0070674_100021559
683 Ga0070673_100002602
684 Ga0070673_100003255
685 Ga0070673_100280630
686 Ga0070667_100017344
687 Ga0070667_100017642
688 Ga0070667_100022079
689 Ga0070663_100019109
690 Ga0070678_100003802
691 Ga0070678_100026862
692 Ga0070678_100109912
693 Ga0068867_100004988
694 Ga0068867_100114738
695 Ga0068867_100148133
696 Ga0070706_100008196
697 Ga0070697_100188220
698 Ga0068853_100299694
699 Ga0070672_100000965
700 Ga0070672_100172437
701 Ga0070695_100133406
702 Ga0070665_100013435
703 Ga0070665_100067743
704 Ga0070665_100298738
705 Ga0068855_100002661
706 Ga0068856_100106259
707 Ga0070702_100238447
708 Ga0068852_100007767
709 Ga0068852_100041893
710 Ga0068859_100099738
711 Ga0068864_100004274
712 Ga0068864_100006133
713 Ga0068861_100163064
714 Ga0068851_10001242
715 Ga0068870_10059972
716 Ga0068863_100001708
717 Ga0068863_100006287
718 Ga0068858_100029699
719 Ga0068858_100119032
720 Ga0068860_100031872
721 Ga0097621_100037821
722 Ga0097621_100074508
723 Ga0068871_100015232
724 Ga0068871_100018818
725 Ga0068871_100090693
726 Ga0068865_100056786
727 Ga0097620_100099735
728 Ga0105251_10034928
729 Ga0105244_10000797
730 Ga0105244_10001058
731 Ga0105250_10000919
732 Ga0105248_10029286
733 Ga0105238_10118544
734 Ga0105249_10045233
735 Ga0157370_10047293
736 Ga0157369_10000205
737 Ga0157369_10043192
738 Ga0157369_10356239
739 Ga0157374_10080448
740 Ga0157378_10066112
741 Ga0163162_10059762
742 Ga0163162_10133705
743 Ga0157372_10113372
744 Ga0163163_10017295
745 Ga0182008_10061219
746 Ga0157379_10005337
747 Ga0157379_10510589
748 Ga0157376_10004661
749 Ga0157376_10137873
750 Ga0182007_10000075
751 Ga0182007_10002870
752 Ga0182007_10005932
753 Ga0182005_1000031
754 Ga0182005_1020393
755 Ga0183361_10008
756 Ga0163161_10068961
757 Ga0213872_10000001
758 Ga0213872_10019380
759 Ga0213872_10036293
760 Ga0209435_100040
761 Ga0209435_102010
762 Ga0209760_100164
763 Ga0209784_100002
764 Ga0209784_100022
765 Ga0209566_100003
766 Ga0209566_100021
767 Ga0209674_100004
768 Ga0209674_100005
769 Ga0209674_100038
770 Ga0209674_100265
771 Ga0209672_100001
772 Ga0209672_108609
773 Ga0209147_100001
774 Ga0209147_100141
775 Ga0209563_100006
776 Ga0209563_100042
777 Ga0209563_105263
778 Ga0207427_100027
779 Ga0207427_102327
780 Ga0209437_100049
781 Ga0209437_106031
782 Ga0209258_100001
783 Ga0209258_100346
784 Ga0209646_1000077
785 Ga0209646_1000218
786 Ga0209026_1000725
787 Ga0209677_100003
788 Ga0209677_100025
789 Ga0209148_1000003
790 Ga0209759_1000029
791 Ga0209759_1000232
792 Ga0209759_1000284
793 Ga0209759_1000447
794 Ga0209233_1000043
795 Ga0209233_1000523
796 Ga0209455_1000001
797 Ga0209455_1004598
798 Ga0209673_1011374
799 Ga0207697_10111148
800 Ga0207656_10008559
801 Ga0207696_1000976
802 Ga0207655_1002971
803 Ga0207655_1013239
804 Ga0207713_1000006
805 Ga0207713_1000287
806 Ga0207713_1071363
807 Ga0207682_10000348
808 Ga0207682_10040851
809 Ga0207680_10011430
810 Ga0207680_10045023
811 Ga0207680_10202663
812 Ga0207647_10057960
813 Ga0207647_10218487
814 Ga0207645_10005303
815 Ga0207645_10134649
816 Ga0207643_10029409
817 Ga0207643_10093601
818 Ga0207705_10001087
819 Ga0207681_10030977
820 Ga0207681_10090730
821 Ga0207650_10045512
822 Ga0207650_10276630
823 Ga0207659_10023460
824 Ga0207659_10060808
825 Ga0207644_10004737
826 Ga0207644_10008599
827 Ga0207690_10038831
828 Ga0207670_10029449
829 Ga0207669_10193325
830 Ga0207669_10195074
831 Ga0207691_10000030
832 Ga0207711_10010185
833 Ga0207711_10039914
834 Ga0207667_10000350
835 Ga0207667_10159921
836 Ga0207651_10001889
837 Ga0207651_10013928
838 Ga0207668_10052492
839 Ga0207668_10062835
840 Ga0207658_10013473
841 Ga0207658_10014105
842 Ga0207677_10032572
843 Ga0207677_10038322
844 Ga0207703_10002822
845 Ga0207639_10015060
846 Ga0207678_10032497
847 Ga0207702_10093230
848 Ga0207648_10002962
849 Ga0207648_10039836
850 Ga0207676_10002470
851 Ga0207676_10176324
852 Ga0207675_100233088
853 Ga0207675_100355689
854 Ga0207683_10000019
855 Ga0207683_10146392
856 Ga0207698_10007444
857 Ga0207698_10036256
858 Ga0209371_1005836
859 Ga0268266_10022216
860 Ga0268256_1005795
861 Ga0316181_1013099
862 Ga0307408_100017978
863 Ga0316576_10002685
864 Ga0316576_10042188
865 Ga0307516_10061724
866 Ga0307412_10000024
867 Ga0307412_10086170
868 Ga0307416_100011348
869 Ga0307416_100046829
870 Ga0373939_0029769
871 Ga0316574_0121517
872 Ga0316584_0039456
873 Ga0395899_0056146
874 Ga0395900_0320941
875 Ga0395898_0001609
876 Ga0395898_0009280
877 Ga0395898_0019625
878 Ga0395898_0250744
879 Ga0395901_0044045
880 Ga0436361_0014834
881 Ga0436361_0362643
882 Ga0436361_0529332
883 Ga0436361_0583982
884 Ga0436361_0601789
885 Ga0450893_0007786
886 Ga0466977_0002801
887 Ga0466966_0003879
888 Ga0466966_0011314
889 Ga0466961_0004681
890 Ga0466961_0048627
891 Ga0466963_0004884
892 Ga0466971_0003043
893 Ga0466968_0006059
894 Ga0466970_0024073
895 Ga0466957_0001149
896 Ga0466958_0001688
897 Ga0466958_0022819
898 Ga0495617_002431
899 Ga0495592_0057015
900 Ga0495592_0082481
901 Ga0495592_0177495
902 Ga0495590_0011280
903 Ga0495591_023929
904 Ga0495629_0000098
905 Ga0495629_0005711
906 Ga0495629_0017991
907 Ga0495638_0000316
908 Ga0495638_0001700
909 Ga0495638_0029119
910 Ga0495638_0040107
911 Ga0495641_0028474
912 Ga0495651_0001633
913 Ga0495651_0006073
914 Ga0495653_0000004
915 Ga0495653_0016004
916 Ga0495653_0022893
917 Ga0495653_0031931
918 Ga0495650_0000011
919 Ga0495650_0000039
920 Ga0495650_0000042
921 Ga0495650_0000383
922 Ga0495650_0003050
923 Ga0495650_0004297
924 Ga0495650_0030276
925 Ga0495650_0037570
926 Ga0495580_0000171
927 Ga0495580_0004558
928 Ga0495580_0004693
929 Ga0495580_0011894
930 Ga0495580_0017327
931 Ga0495580_0175274
932 Ga0495582_0006099
933 Ga0495582_0051509
934 Ga0495582_0108607
935 Ga0495605_0000665
936 Ga0495605_0005296
937 Ga0495605_0022422
938 Ga0495605_0053645
939 Ga0495605_0076635
940 Ga0495639_0042590
941 Ga0495662_0012275
942 Ga0495662_0213037
943 Ga0495664_0013512
944 Ga0495584_0000573
945 Ga0495584_0110237
946 Ga0495584_0115381
947 Ga0495585_0019615
948 Ga0495585_0192187
949 Ga0495594_0162822
950 Ga0495596_0003413
951 Ga0495596_0003923
952 Ga0495596_0008939
953 Ga0495607_0001824
954 Ga0495583_0000045
955 Ga0495583_0001241
956 Ga0495583_0056257
957 Ga0495583_0061982
958 Ga0495606_0000059
959 Ga0495606_0000189
960 Ga0495606_0000396
961 Ga0495606_0042438
962 Ga0495606_0069955
963 Ga0495608_0009704
964 Ga0495608_0022443
965 Ga0495608_0115802
966 Ga0495610_0005113
967 Ga0495616_0010104
968 Ga0495616_0016974
969 Ga0495618_0002757
970 Ga0495618_0037109
971 Ga0495618_0060564
972 Ga0495618_0229720
973 Ga0495620_0022172
974 Ga0495628_0002356
975 Ga0495628_0002536
976 Ga0495628_0074239
977 Ga0495628_0165798
978 Ga0495628_0223756
979 Ga0495630_0019548
980 Ga0495637_0064131
981 Ga0495643_0000323
982 Ga0495643_0000573
983 Ga0495643_0173842
984 Ga0495644_0000135
985 Ga0495644_0004017
986 Ga0495648_0000054
987 Ga0495648_0000659
988 Ga0495648_0006023
989 Ga0495648_0010133
990 Ga0495648_0014554
991 Ga0495648_0018375
992 Ga0495648_0044192
993 Ga0495648_0047035
994 Ga0495666_0007336
995 Ga0495666_0015787
996 Ga0495666_0040099
997 Ga0495666_0101105
998 Ga0495642_0019532
999 Ga0495642_0055643
1000 Ga0495652_0003297
1001 Ga0495652_0018130
1002 Ga0495652_0030735
1003 Ga0495652_0113471
1004 Ga0495654_0068662
1005 Ga0495665_0010059
1006 Ga0495665_0031026
1007 Ga0495665_0158413
1008 Ga0495640_0003061
1009 Ga0495640_0008275
1010 Ga0495640_0041161
1011 Ga0495586_0009707
1012 Ga0495587_0007810
1013 Ga0495587_0034308
1014 Ga0495609_0000582
1015 Ga0495609_0000604
1016 Ga0495609_0000992
1017 Ga0495609_0100032
1018 Ga0495597_0000695
1019 Ga0495597_0005843
1020 Ga0495597_0015880
1021 Ga0495597_0053199
1022 Ga0495645_0071741
1023 Ga0495622_0000562
1024 Ga0495622_0020320
1025 Ga0495622_0021156
1026 Ga0495633_0000066
1027 Ga0495633_0000349
1028 Ga0495633_0000448
1029 Ga0495633_0000625
1030 Ga0495633_0012066
1031 Ga0495633_0057090
1032 Ga0495667_0389429
1033 Ga0495668_0000089
1034 Ga0495668_0000285
1035 Ga0495668_0005654
1036 Ga0495668_0011977
1037 Ga0495668_0083484
1038 Ga0495634_0008824
1039 Ga0495634_0019086
1040 Ga0495611_0018908
1041 Ga0495625_0001004
1042 Ga0495625_0001045
1043 Ga0495625_0013489
1044 Ga0495625_0142858
1045 Ga0495635_0002582
1046 Ga0495635_0011795
1047 Ga0495635_0013539
1048 Ga0495659_0000294
1049 Ga0495661_0009392
1050 Ga0495661_0014666
1051 Ga0495661_0069249
1052 Ga0495661_0106668
1053 Ga0495588_0071884
1054 Ga0495657_0235939
1055 Ga0495599_0004125
1056 Ga0495599_0162398
1057 Ga0495623_0002075
1058 Ga0495623_0009617
1059 Ga0495623_0043606
1060 Ga0495623_0046244
1061 Ga0495623_0101210
1062 Ga0495646_0011087
1063 Ga0495646_0023056
1064 Ga0495646_0042302
1065 Ga0495646_0110192
1066 Ga0495613_0017427
1067 Ga0495624_0020450
1068 Ga0495624_0096753
1069 Ga0495670_0000252
1070 Ga0495670_0058753
1071 Ga0495649_0017506
1072 Ga0495649_0122546
1073 Ga0495589_0132768
1074 Ga0495600_0002579
1075 Ga0495660_0000061
1076 Ga0495660_0017018
1077 Ga0495581_0002407
1078 Ga0495581_0057259
1079 Ga0495581_0086507
1080 Ga0495604_0033974
1081 Ga0495604_0061279
1082 Ga0495604_0072785
1083 Ga0495636_0000318
1084 Ga0495674_0015392
1085 Ga0495674_0061086
1086 Ga0495674_0082063
1087 Ga0495674_0145541
1088 Ga0495672_0000130
1089 Ga0495672_0000257
1090 Ga0495676_0037739
1091 Ga0495676_0042526
1092 Ga0495676_0078272
1093 Ga0495676_0195017
1094 Ga0495680_0015443
1095 Ga0495680_0175537
1096 Ga0495683_0065407
1097 Ga0495683_0066669
1098 Ga0495687_000677
1099 Ga0495687_009723
1100 Ga0495687_011593
1101 Ga0495687_053664
1102 Ga0495675_0007652
1103 Ga0495675_0011677
1104 Ga0495675_0040173
1105 Ga0495675_0082018
1106 Ga0495677_0004961
1107 Ga0495679_000025
1108 Ga0495679_003322
1109 Ga0495679_004332
1110 Ga0495679_050482
1111 Ga0495685_000093
1112 Ga0495673_0005367
1113 Ga0495673_0014475
1114 Ga0495673_0016749
1115 Ga0495684_0045593
1116 Ga0495686_0052417
1117 Ga0495686_0066510
1118 Ga0495686_0069660
1119 Ga0495593_0006606
1120 Ga0495593_0006888
1121 Ga0495593_0028797
1122 Ga0495593_0126217
1123 Ga0495602_0011805
1124 Ga0495602_0025709
1125 Ga0495602_0192490
1126 Ga0495614_0001934
1127 Ga0495614_0036303
1128 Ga0495626_0025776
1129 Ga0495626_0066817
1130 Ga0496100_0196824
1131 Ga0496101_0090955
1132 Ga0496102_0164520
1133 Ga0496103_0075178
1134 Ga0496104_0000075
1135 Ga0496104_0100519
1136 Ga0496108_0128697
1137 Ga0496109_0707042
1138 Ga0496110_0252171
1139 Ga0496112_0001121
1140 Ga0496113_0017103
1141 Ga0496114_0035353
1142 Ga0496114_0053163
1143 Ga0496116_0000095
1144 Ga0496116_0020463
1145 Ga0496116_0051416
1146 Ga0496117_0000032
1147 Ga0496117_0009889
1148 Ga0496117_0066094
1149 Ga0496117_0066828
1150 Ga0496117_0177083
1151 Ga0496118_0000027
1152 Ga0496118_0004422
1153 Ga0496118_0006600
1154 Ga0496118_0079938
1155 Ga0496118_0229993
1156 Ga0496119_0001970
1157 Ga0496119_0018872
1158 Ga0496120_0001876
1159 Ga0496120_0003355
1160 Ga0496121_0010777
1161 Ga0496121_0019730
1162 Ga0496121_0032418
1163 Ga0496121_0039708
1164 Ga0496121_0063109
1165 Ga0496121_0074182
1166 Ga0496121_0104910
1167 Ga0496121_0155352
1168 Ga0496122_0000131
1169 Ga0496122_0000892
1170 Ga0496122_0003391
1171 Ga0496122_0006497
1172 Ga0496122_0140809
1173 Ga0496123_0000098
1174 Ga0496123_0000842
1175 Ga0496123_0003952
1176 Ga0496123_0006577
1177 Ga0496123_0007507
1178 Ga0496123_0027332
1179 Ga0496124_0000168
1180 Ga0496124_0017230
1181 Ga0496124_0050238
1182 Ga0496125_0000100
1183 Ga0496125_0002058
1184 Ga0496125_0002222
1185 Ga0496125_0011901
1186 Ga0496125_0026967
1187 Ga0496125_0121665
1188 Ga0496126_0001346
1189 Ga0496126_0003845
1190 Ga0495678_002136
1191 Ga0495678_013027
1192 Ga0495678_047962
1193 Ga0495678_057419
1194 Ga0495682_0000121
1195 Ga0495682_0000195
1196 Ga0495682_0019298
1197 Ga0495682_0074168
1198 Ga0501036_0156769
1199 Ga0501038_0193833
1200 Ga0501039_0174916
1201 Ga0501042_0097530
1202 Ga0501048_0393301
1203 Ga0501075_0075861
1204 Ga0501076_0030081
1205 Ga0501079_0243323
1206 Ga0501080_0417205
1207 Ga0501081_0489052
1208 Ga0466962_0011553
1209 2509128655
1210 2510250860
1211 2513960951
1212 2515679693
1213 2521559186
1214 2527075189
1215 2600809765
1216 2601671801
1217 2719639997
1218 2723877387
1219 2738820741
1220 2738833221
1221 2738874749
1222 2739186378
1223 2739221347
1224 2746089616
1225 2746098475
1226 2753566681
1227 2808969932
1228 2809004423
1229 2809011638
1230 2842328118
1231 2842352435
1232 2842459471
1233 2857552111
1234 2857562675
1235 2885278761
1236 2900635075
1237 2902689659
1238 2904605499
1239 2919530619
1240 2928505329
1241 2932413813
1242 2932417873
1243 2945936974
1244 2990706298
1245 642423121
1246 643600785
1247 8055268304
1248 8055302378

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

76

312

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.9588 1 258
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.9542 1 258
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.9507 1 258
2zvr-assembly1.cif.gz_B crystal structure of a d-tagatose 3-epimerase-related protein from thermotoga maritima 0.8337 4 257
5h6h-assembly2.cif.gz_B crystal structure of hyperthermophilic thermotoga maritima l-ribulose 3-epimerase with mn2+ 0.8313 1 257
ID Description Score Start End Superfamily
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9664 1 258 3.20.20.150
af_Q7T3H9_4_269_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9529 2 257 3.20.20.150
1k77A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9524 3 258 3.20.20.150
af_Q7T3H9_4_269_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9422 2 257 3.20.20.150
1k77A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9381 3 258 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A380B6Y8-F1-model_v4 Hydroxypyruvate isomerase (EC 5.3.1.22) 0.9903 1 108 GO:0008903
GO:0046487
AF-A0A382WZG8-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.987 1 107 GO:0008903
GO:0046487
AF-A0A2D0JZ34-F1-model_v4 Hydroxypyruvate isomerase 0.9847 1 111 GO:0008903
GO:0046487
AF-A0A6L7WR56-F1-model_v4 TIM barrel protein 0.9841 1 98 GO:0008903
GO:0046487
AF-A0A6J4M2P7-F1-model_v4 Hydroxypyruvate isomerase (EC 5.3.1.22) 0.984 1 114 GO:0008903
GO:0046487

Map