metagRoot

F470340

General Info

Members	Datasets	Scaffolds	Average Seq Length
625	270	625	323

Family's Representative Sequence

Representative Sequence	3300005444\|Ga0070694_100062103\|Ga0070694_1000621032
Length	370
Sequence	MKRITLPEEGIETLFGNYDENLKHLEALFNVRIRTQGHDLLIEGDSSNVDKVDRVVGQLSSLMREGMKLSNADVKTAADLIAQDASVDLRDHFLKGSLTPAGKRRVAPKTVNQRKYLDAIEQHDIVFGVGPAGTGKTYLAMAQAVAFLVAKKVSRIILARPAVEAGEKLGFLPGDLQEKVNPYLRPLYDALYDMLDAERVARYIERGTIEIAPIAFMRGRTLNDSFVILDEAQNTTSEQMKMFLTRLGFGAKAVITGDITQIDLPAGRTSGLVEAMKVVGAIEGISFVYFDDRDVVRHKLVQQIVKAYEAFSNGASPSRPSTTPRPLESLGVAPSQVEGREPKGRSEDARGTASSGRADGVQVEPVEPRA

Samples

	Sample ID	Description	Type	Environment
1	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
2	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
3	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
4	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
5	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
6	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
7	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
8	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
9	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
10	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
11	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
12	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
13	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
14	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
15	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
16	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
17	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
18	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
19	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
20	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
21	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
22	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
23	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
24	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
25	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
26	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
27	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
28	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
29	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
30	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
31	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
32	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
33	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
34	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
35	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
36	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
37	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
38	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
39	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
40	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
41	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
42	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
43	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
44	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
45	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
46	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
47	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
48	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
49	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
50	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
51	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
52	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
53	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
54	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
55	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
56	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
57	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
58	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
59	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
60	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
61	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
62	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
63	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
64	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
65	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
66	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
68	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
69	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
71	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
72	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
73	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
74	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
75	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
76	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
77	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
78	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
79	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
80	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
81	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
82	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
83	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
84	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
85	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
86	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
87	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
135	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
139	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
140	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
141	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
142	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
143	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
144	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
145	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
146	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
147	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
148	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
149	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
150	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
151	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
152	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
153	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
154	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
155	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
156	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
157	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
158	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
159	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
160	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
161	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
162	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
163	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
164	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
165	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
166	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
167	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
168	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
169	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
170	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
171	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
172	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
173	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
174	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
175	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
176	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
177	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
178	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
179	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
180	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
181	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
182	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
183	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
184	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
185	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
186	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
187	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
188	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
189	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
190	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
191	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
192	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
193	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
194	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
195	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
196	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
197	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
198	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
199	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
200	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
201	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
202	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
203	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
204	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
205	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
206	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
207	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
208	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
209	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
210	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
211	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
212	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
213	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
214	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
215	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
216	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
217	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
218	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
219	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
220	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
221	3300049522	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control	Metagenome	Rhizosphere
222	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
223	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
224	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
225	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
226	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
227	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
228	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
229	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
230	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
231	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
232	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
233	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
234	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
235	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
236	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
237	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
238	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
239	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
240	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
241	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
242	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
243	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
244	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
245	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
246	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
247	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
248	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
249	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
250	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
251	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
252	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
253	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
254	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
255	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
256	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
257	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
258	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
259	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
260	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
261	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
262	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
263	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
264	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
265	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
266	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
267	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
268	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
269	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
270	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.48
Nodule	0
Rhizoplane	5.28
Rhizosphere	94.24
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0065714_10114082	3300005288	Bacteria	1433
2	Ga0065704_10114616	3300005289	Bacteria	1887
3	Ga0065712_10000343	3300005290	Bacteria	17818
4	Ga0065712_10014241	3300005290	Bacteria	2927
5	Ga0065712_10148089	3300005290	Bacteria	1385
6	Ga0065715_10000269	3300005293	Bacteria	20304
7	Ga0065715_10091468	3300005293	Bacteria	5766
8	Ga0065715_10102961	3300005293	Bacteria	3053
9	Ga0065715_10129720	3300005293	Bacteria	2040
10	Ga0065715_10199238	3300005293	Bacteria	1371
11	Ga0065707_10084326	3300005295	Bacteria	7346
12	Ga0070658_10270665	3300005327	Bacteria	1445
13	Ga0070676_10003342	3300005328	Bacteria	8346
14	Ga0070683_100033165	3300005329	Bacteria	4707
15	Ga0068869_100136237	3300005334	Bacteria	1892
16	Ga0070666_10089926	3300005335	Bacteria	2108
17	Ga0070666_10108634	3300005335	Bacteria	1917
18	Ga0070666_10182176	3300005335	Bacteria	1474
19	Ga0070680_100210150	3300005336	Bacteria	1642
20	Ga0070660_100001391	3300005339	Bacteria	16464
21	Ga0070691_10015472	3300005341	Bacteria	3505
22	Ga0070669_100002231	3300005353	Bacteria	14027
23	Ga0070669_100019779	3300005353	Bacteria	4812
24	Ga0070669_100089245	3300005353	Bacteria	2309
25	Ga0070669_100110708	3300005353	Bacteria	2084
26	Ga0070675_100000409	3300005354	Bacteria	29206
27	Ga0070675_100095851	3300005354	Bacteria	2492
28	Ga0070675_100118780	3300005354	Bacteria	2245
29	Ga0070675_100195227	3300005354	Bacteria	1755
30	Ga0070675_100563618	3300005354	Bacteria	1031
31	Ga0070671_100005955	3300005355	Bacteria	9714
32	Ga0070674_100001653	3300005356	Bacteria	12028
33	Ga0070674_100066320	3300005356	Bacteria	2536
34	Ga0070673_100287084	3300005364	Bacteria	1445
35	Ga0070673_100415713	3300005364	Bacteria	1205
36	Ga0070688_100005352	3300005365	Bacteria	6750
37	Ga0070688_100196804	3300005365	Bacteria	1408
38	Ga0070659_100071584	3300005366	Bacteria	2757
39	Ga0070714_100026585	3300005435	Bacteria	4784
40	Ga0070711_100250407	3300005439	Bacteria	1389
41	Ga0070700_100194131	3300005441	Bacteria	1422
42	Ga0070694_100011045	3300005444	Bacteria	5588
43	Ga0070694_100062103	3300005444	Bacteria	2552
44	Ga0070678_100034448	3300005456	Bacteria	3527
45	Ga0070678_100046435	3300005456	Bacteria	3114
46	Ga0070662_100200224	3300005457	Bacteria	1584
47	Ga0070681_10014599	3300005458	Bacteria	7817
48	Ga0070681_10058365	3300005458	Bacteria	3839
49	Ga0068867_100142482	3300005459	Bacteria	1875
50	Ga0070706_100095469	3300005467	Bacteria	2760
51	Ga0070706_100153483	3300005467	Bacteria	2150
52	Ga0070707_100147807	3300005468	Bacteria	2287
53	Ga0070707_100234322	3300005468	Bacteria	1787
54	Ga0070698_100000242	3300005471	Bacteria	54440
55	Ga0070698_100043713	3300005471	Bacteria	4592
56	Ga0070698_100451707	3300005471	Bacteria	1221
57	Ga0070699_100000778	3300005518	Bacteria	29468
58	Ga0070699_100007944	3300005518	Bacteria	9212
59	Ga0070699_100051949	3300005518	Bacteria	3549
60	Ga0070679_100008891	3300005530	Bacteria	9477
61	Ga0068853_100188676	3300005539	Bacteria	1872
62	Ga0070672_100063496	3300005543	Bacteria	2916
63	Ga0070672_100116539	3300005543	Bacteria	2182
64	Ga0070686_100328849	3300005544	Bacteria	1142
65	Ga0070695_100007869	3300005545	Bacteria	6314
66	Ga0070695_100064422	3300005545	Bacteria	2384
67	Ga0070696_100002023	3300005546	Bacteria	13307
68	Ga0070696_100005044	3300005546	Bacteria	8820
69	Ga0070696_100268081	3300005546	Bacteria	1297
70	Ga0070665_100013471	3300005548	Bacteria	8225
71	Ga0070665_100068290	3300005548	Bacteria	3564
72	Ga0070665_100252726	3300005548	Bacteria	1763
73	Ga0070665_100305844	3300005548	Bacteria	1593
74	Ga0070664_100063944	3300005564	Bacteria	3138
75	Ga0068854_100002297	3300005578	Bacteria	11771
76	Ga0068854_100018330	3300005578	Bacteria	4699
77	Ga0070702_100000841	3300005615	Bacteria	11829
78	Ga0068859_100018140	3300005617	Bacteria	7072
79	Ga0068859_100158538	3300005617	Bacteria	2342
80	Ga0068859_100334461	3300005617	Bacteria	1609
81	Ga0068864_100093317	3300005618	Bacteria	2659
82	Ga0068864_100198580	3300005618	Bacteria	1842
83	Ga0068864_100244848	3300005618	Bacteria	1662
84	Ga0068866_10019831	3300005718	Bacteria	3069
85	Ga0068866_10059727	3300005718	Bacteria	1974
86	Ga0068861_100008055	3300005719	Bacteria	7248
87	Ga0068861_100056837	3300005719	Bacteria	2987
88	Ga0068861_100091863	3300005719	Bacteria	2397
89	Ga0068861_100254353	3300005719	Bacteria	1500
90	Ga0068870_10053512	3300005840	Bacteria	2144
91	Ga0068863_100078901	3300005841	Bacteria	3118
92	Ga0068858_100017485	3300005842	Bacteria	6726
93	Ga0068858_100218247	3300005842	Bacteria	1806
94	Ga0068858_100302520	3300005842	Bacteria	1526
95	Ga0068860_100015479	3300005843	Bacteria	7447
96	Ga0068862_100015234	3300005844	Bacteria	6384
97	Ga0068862_100016044	3300005844	Bacteria	6230
98	Ga0068862_100152513	3300005844	Bacteria	2057
99	Ga0068862_100338122	3300005844	Bacteria	1394
100	Ga0081455_10095174	3300005937	Bacteria	2404
101	Ga0081540_1116953	3300005983	Bacteria	1114
102	Ga0081539_10018397	3300005985	Bacteria	4850
103	Ga0075366_10080957	3300006195	Bacteria	1939
104	Ga0097621_100001649	3300006237	Bacteria	15278
105	Ga0097621_100027249	3300006237	Bacteria	4492
106	Ga0097621_100031149	3300006237	Bacteria	4230
107	Ga0097621_100033502	3300006237	Bacteria	4092
108	Ga0097621_100043873	3300006237	Bacteria	3606
109	Ga0097621_100064975	3300006237	Bacteria	3002
110	Ga0097621_100336999	3300006237	Bacteria	1339
111	Ga0068871_100000409	3300006358	Bacteria	29690
112	Ga0068871_100026234	3300006358	Bacteria	4545
113	Ga0068871_100033791	3300006358	Bacteria	4052
114	Ga0068871_100034049	3300006358	Bacteria	4039
115	Ga0075428_100000108	3300006844	Bacteria	70319
116	Ga0075428_100028284	3300006844	Bacteria	6200
117	Ga0075428_100037397	3300006844	Bacteria	5344
118	Ga0075428_100087697	3300006844	Bacteria	3394
119	Ga0075428_100340885	3300006844	Bacteria	1609
120	Ga0075430_100047574	3300006846	Bacteria	3622
121	Ga0075431_100011979	3300006847	Bacteria	8750
122	Ga0075431_100049355	3300006847	Bacteria	4339
123	Ga0075431_100260238	3300006847	Bacteria	1761
124	Ga0075431_100281757	3300006847	Bacteria	1683
125	Ga0075431_100362799	3300006847	Bacteria	1455
126	Ga0075433_10047327	3300006852	Bacteria	3741
127	Ga0075433_10068216	3300006852	Bacteria	3122
128	Ga0075433_10105775	3300006852	Bacteria	2494
129	Ga0075433_10111761	3300006852	Bacteria	2424
130	Ga0075434_100013793	3300006871	Bacteria	7705
131	Ga0075434_100106439	3300006871	Bacteria	2814
132	Ga0075434_100189900	3300006871	Bacteria	2074
133	Ga0075434_100191115	3300006871	Bacteria	2068
134	Ga0075434_100217697	3300006871	Bacteria	1929
135	Ga0075429_100014774	3300006880	Bacteria	6767
136	Ga0068865_100012815	3300006881	Bacteria	5285
137	Ga0068865_100033937	3300006881	Bacteria	3420
138	Ga0068865_100109384	3300006881	Bacteria	2036
139	Ga0075436_100000801	3300006914	Bacteria	20860
140	Ga0075436_100024573	3300006914	Bacteria	4142
141	Ga0075436_100027012	3300006914	Bacteria	3952
142	Ga0075436_100091406	3300006914	Bacteria	2116
143	Ga0097620_100018140	3300006931	Bacteria	7072
144	Ga0097620_100158541	3300006931	Bacteria	2342
145	Ga0097620_100334482	3300006931	Bacteria	1609
146	Ga0075435_100000009	3300007076	Bacteria	114381
147	Ga0075435_100000849	3300007076	Bacteria	19122
148	Ga0075435_100002789	3300007076	Bacteria	11671
149	Ga0075435_100004370	3300007076	Bacteria	9711
150	Ga0075435_100012667	3300007076	Bacteria	6249
151	Ga0075435_100060770	3300007076	Bacteria	3064
152	Ga0075435_100072807	3300007076	Bacteria	2808
153	Ga0075435_100130196	3300007076	Bacteria	2105
154	Ga0105240_10023988	3300009093	Bacteria	8058
155	Ga0111539_10000001	3300009094	Bacteria	1035431
156	Ga0111539_10002783	3300009094	Bacteria	23220
157	Ga0111539_10005778	3300009094	Bacteria	15991
158	Ga0111539_10006101	3300009094	Bacteria	15555
159	Ga0111539_10039623	3300009094	Bacteria	5676
160	Ga0111539_10169607	3300009094	Bacteria	2550
161	Ga0111539_10265493	3300009094	Bacteria	1998
162	Ga0105245_10021503	3300009098	Bacteria	5660
163	Ga0105245_10152745	3300009098	Bacteria	2184
164	Ga0105247_10087786	3300009101	Bacteria	1970
165	Ga0114129_10001825	3300009147	Bacteria	28997
166	Ga0114129_10002818	3300009147	Bacteria	24260
167	Ga0114129_10003225	3300009147	Bacteria	22877
168	Ga0114129_10008909	3300009147	Bacteria	14308
169	Ga0114129_10015684	3300009147	Bacteria	10774
170	Ga0114129_10018349	3300009147	Bacteria	9965
171	Ga0114129_10095315	3300009147	Bacteria	4122
172	Ga0114129_10177686	3300009147	Bacteria	2899
173	Ga0114129_10177989	3300009147	Bacteria	2896
174	Ga0114129_10289011	3300009147	Bacteria	2188
175	Ga0105243_10052685	3300009148	Bacteria	3224
176	Ga0105243_10280758	3300009148	Bacteria	1500
177	Ga0105243_10287824	3300009148	Bacteria	1483
178	Ga0105242_10004183	3300009176	Bacteria	11249
179	Ga0105242_10252444	3300009176	Bacteria	1590
180	Ga0105242_10343648	3300009176	Bacteria	1376
181	Ga0105242_10438509	3300009176	Bacteria	1228
182	Ga0105248_10047346	3300009177	Bacteria	4821
183	Ga0105248_10061061	3300009177	Bacteria	4231
184	Ga0105248_10091358	3300009177	Bacteria	3429
185	Ga0105248_10103317	3300009177	Bacteria	3212
186	Ga0105248_10164623	3300009177	Bacteria	2500
187	Ga0105248_10331747	3300009177	Bacteria	1713
188	Ga0105248_10360566	3300009177	Bacteria	1636
189	Ga0105248_10433254	3300009177	Bacteria	1481
190	Ga0105248_10469850	3300009177	Bacteria	1418
191	Ga0105249_10001034	3300009553	Bacteria	24616
192	Ga0105249_10133544	3300009553	Bacteria	2372
193	Ga0105249_10156896	3300009553	Bacteria	2195
194	Ga0105249_10403455	3300009553	Bacteria	1398
195	Ga0105246_10044044	3300011119	Bacteria	3031
196	Ga0105246_10376324	3300011119	Bacteria	1172
197	Ga0157374_10017001	3300013296	Bacteria	6404
198	Ga0163162_10032273	3300013306	Bacteria	5200
199	Ga0163162_10116439	3300013306	Bacteria	2773
200	Ga0163162_10367310	3300013306	Bacteria	1572
201	Ga0157372_10372243	3300013307	Bacteria	1664
202	Ga0157375_10049944	3300013308	Bacteria	4101
203	Ga0157375_10288059	3300013308	Bacteria	1805
204	Ga0157375_10362021	3300013308	Bacteria	1617
205	Ga0163163_10004026	3300014325	Bacteria	12532
206	Ga0163163_10112167	3300014325	Bacteria	2756
207	Ga0157380_10009700	3300014326	Bacteria	6907
208	Ga0157380_10050743	3300014326	Bacteria	3278
209	Ga0157380_10318082	3300014326	Bacteria	1442
210	Ga0157380_10401576	3300014326	Bacteria	1300
211	Ga0157380_10510265	3300014326	Bacteria	1170
212	Ga0157379_10059976	3300014968	Bacteria	3402
213	Ga0157379_10090546	3300014968	Bacteria	2744
214	Ga0157376_10011629	3300014969	Bacteria	6497
215	Ga0157376_10302182	3300014969	Bacteria	1515
216	Ga0157376_10325889	3300014969	Bacteria	1462
217	Ga0157376_10374048	3300014969	Bacteria	1370
218	Ga0163161_10007977	3300017792	Bacteria	7326
219	Ga0207682_10008407	3300025893	Bacteria	4084
220	Ga0207710_10065126	3300025900	Bacteria	1661
221	Ga0207680_10043126	3300025903	Bacteria	2644
222	Ga0207680_10073924	3300025903	Bacteria	2121
223	Ga0207680_10108659	3300025903	Bacteria	1795
224	Ga0207699_10153557	3300025906	Bacteria	1526
225	Ga0207645_10050060	3300025907	Bacteria	2668
226	Ga0207645_10058331	3300025907	Bacteria	2464
227	Ga0207705_10319231	3300025909	Bacteria	1193
228	Ga0207684_10125994	3300025910	Bacteria	2198
229	Ga0207707_10049347	3300025912	Bacteria	3667
230	Ga0207695_10035622	3300025913	Bacteria	5393
231	Ga0207695_10090085	3300025913	Bacteria	3083
232	Ga0207663_10180776	3300025916	Bacteria	1506
233	Ga0207660_10167402	3300025917	Bacteria	1699
234	Ga0207662_10167930	3300025918	Bacteria	1406
235	Ga0207657_10006192	3300025919	Bacteria	12433
236	Ga0207657_10021487	3300025919	Bacteria	6070
237	Ga0207657_10255286	3300025919	Bacteria	1396
238	Ga0207649_10072246	3300025920	Bacteria	2207
239	Ga0207649_10267189	3300025920	Bacteria	1238
240	Ga0207652_10122376	3300025921	Bacteria	2315
241	Ga0207652_10216603	3300025921	Bacteria	1725
242	Ga0207646_10047273	3300025922	Bacteria	3859
243	Ga0207646_10126596	3300025922	Bacteria	2297
244	Ga0207681_10007913	3300025923	Bacteria	6499
245	Ga0207681_10026759	3300025923	Bacteria	3724
246	Ga0207681_10058552	3300025923	Bacteria	2638
247	Ga0207681_10103508	3300025923	Bacteria	2058
248	Ga0207681_10172580	3300025923	Bacteria	1640
249	Ga0207650_10212354	3300025925	Bacteria	1554
250	Ga0207650_10249716	3300025925	Bacteria	1436
251	Ga0207650_10342085	3300025925	Bacteria	1229
252	Ga0207659_10028141	3300025926	Bacteria	3816
253	Ga0207659_10092242	3300025926	Bacteria	2264
254	Ga0207659_10496275	3300025926	Bacteria	1033
255	Ga0207687_10207555	3300025927	Bacteria	1535
256	Ga0207644_10225918	3300025931	Bacteria	1486
257	Ga0207690_10262719	3300025932	Bacteria	1338
258	Ga0207706_10076519	3300025933	Bacteria	2943
259	Ga0207686_10027463	3300025934	Bacteria	3334
260	Ga0207686_10034003	3300025934	Bacteria	3048
261	Ga0207686_10107343	3300025934	Bacteria	1876
262	Ga0207709_10074678	3300025935	Bacteria	2164
263	Ga0207669_10000305	3300025937	Bacteria	22533
264	Ga0207669_10005211	3300025937	Bacteria	5809
265	Ga0207669_10029234	3300025937	Bacteria	3045
266	Ga0207669_10032418	3300025937	Bacteria	2934
267	Ga0207669_10032588	3300025937	Bacteria	2929
268	Ga0207704_10013184	3300025938	Bacteria	4129
269	Ga0207704_10034234	3300025938	Bacteria	2897
270	Ga0207704_10049104	3300025938	Bacteria	2536
271	Ga0207691_10064437	3300025940	Bacteria	3320
272	Ga0207711_10008589	3300025941	Bacteria	8539
273	Ga0207711_10082349	3300025941	Bacteria	2813
274	Ga0207711_10131719	3300025941	Bacteria	2243
275	Ga0207711_10145760	3300025941	Bacteria	2133
276	Ga0207711_10153892	3300025941	Bacteria	2077
277	Ga0207711_10342632	3300025941	Bacteria	1383
278	Ga0207711_10532195	3300025941	Bacteria	1096
279	Ga0207689_10117004	3300025942	Bacteria	2191
280	Ga0207661_10033256	3300025944	Bacteria	4001
281	Ga0207679_10056608	3300025945	Bacteria	2896
282	Ga0207679_10075787	3300025945	Bacteria	2554
283	Ga0207679_10452418	3300025945	Bacteria	1139
284	Ga0207667_10096292	3300025949	Bacteria	3054
285	Ga0207651_10118427	3300025960	Bacteria	2003
286	Ga0207651_10333256	3300025960	Bacteria	1272
287	Ga0207712_10002893	3300025961	Bacteria	10974
288	Ga0207712_10168672	3300025961	Bacteria	1709
289	Ga0207668_10372347	3300025972	Bacteria	1200
290	Ga0207640_10018780	3300025981	Bacteria	4069
291	Ga0207677_10014266	3300026023	Bacteria	4634
292	Ga0207703_10065616	3300026035	Bacteria	2984
293	Ga0207703_10134074	3300026035	Bacteria	2142
294	Ga0207703_10150503	3300026035	Bacteria	2029
295	Ga0207639_10151142	3300026041	Bacteria	1945
296	Ga0207708_10262435	3300026075	Bacteria	1394
297	Ga0207708_10325506	3300026075	Bacteria	1255
298	Ga0207641_10007543	3300026088	Bacteria	9048
299	Ga0207648_10004126	3300026089	Bacteria	15026
300	Ga0207648_10094453	3300026089	Bacteria	2615
301	Ga0207648_10205624	3300026089	Bacteria	1747
302	Ga0207648_10217178	3300026089	Bacteria	1699
303	Ga0207648_10250806	3300026089	Bacteria	1578
304	Ga0207676_10364657	3300026095	Bacteria	1340
305	Ga0207675_100003439	3300026118	Bacteria	15480
306	Ga0207675_100051381	3300026118	Bacteria	3846
307	Ga0207675_100069785	3300026118	Bacteria	3284
308	Ga0207675_100109370	3300026118	Bacteria	2608
309	Ga0207675_100112704	3300026118	Bacteria	2567
310	Ga0207675_100221260	3300026118	Bacteria	1824
311	Ga0207675_100319011	3300026118	Bacteria	1517
312	Ga0207675_100483862	3300026118	Bacteria	1230
313	Ga0207683_10023780	3300026121	Bacteria	5271
314	Ga0207683_10028653	3300026121	Bacteria	4816
315	Ga0207683_10120568	3300026121	Bacteria	2354
316	Ga0207698_10405266	3300026142	Bacteria	1304
317	Ga0207428_10000002	3300027907	Bacteria	854851
318	Ga0207428_10005172	3300027907	Bacteria	12213
319	Ga0207428_10008456	3300027907	Bacteria	9293
320	Ga0207428_10060838	3300027907	Bacteria	2992
321	Ga0207428_10083553	3300027907	Bacteria	2490
322	Ga0268266_10042800	3300028379	Bacteria	3869
323	Ga0268266_10159858	3300028379	Bacteria	2037
324	Ga0268266_10559422	3300028379	Bacteria	1096
325	Ga0268265_10015207	3300028380	Bacteria	5261
326	Ga0268265_10017891	3300028380	Bacteria	4901
327	Ga0268265_10238029	3300028380	Bacteria	1604
328	Ga0268265_10273284	3300028380	Bacteria	1508
329	Ga0268265_10397308	3300028380	Bacteria	1273
330	Ga0268264_10011434	3300028381	Bacteria	7331
331	Ga0307408_100020577	3300031548	Bacteria	4456
332	Ga0307408_100025812	3300031548	Bacteria	4027
333	Ga0307408_100031481	3300031548	Bacteria	3694
334	Ga0307405_10007416	3300031731	Bacteria	5483
335	Ga0307413_10014665	3300031824	Bacteria	3990
336	Ga0307413_10131702	3300031824	Bacteria	1713
337	Ga0307413_10280097	3300031824	Bacteria	1254
338	Ga0307410_10004394	3300031852	Bacteria	7282
339	Ga0307410_10017547	3300031852	Bacteria	4302
340	Ga0307410_10033944	3300031852	Bacteria	3299
341	Ga0307410_10061905	3300031852	Bacteria	2562
342	Ga0307410_10151866	3300031852	Bacteria	1725
343	Ga0307406_10028135	3300031901	Bacteria	3394
344	Ga0307406_10046782	3300031901	Bacteria	2724
345	Ga0307407_10023545	3300031903	Bacteria	3215
346	Ga0307407_10024858	3300031903	Bacteria	3148
347	Ga0307412_10012993	3300031911	Bacteria	4868
348	Ga0307412_10032348	3300031911	Bacteria	3313
349	Ga0307412_10199320	3300031911	Bacteria	1519
350	Ga0307409_100007417	3300031995	Bacteria	6557
351	Ga0307409_100015445	3300031995	Bacteria	5013
352	Ga0307409_100024112	3300031995	Bacteria	4235
353	Ga0307416_100035512	3300032002	Bacteria	3808
354	Ga0307416_100082628	3300032002	Bacteria	2722
355	Ga0307416_100095836	3300032002	Bacteria	2564
356	Ga0307416_100099504	3300032002	Bacteria	2525
357	Ga0307416_100286316	3300032002	Bacteria	1628
358	Ga0307414_10013274	3300032004	Bacteria	4901
359	Ga0307414_10119012	3300032004	Bacteria	2027
360	Ga0307411_10004122	3300032005	Bacteria	6897
361	Ga0307411_10081225	3300032005	Bacteria	2232
362	Ga0307411_10154621	3300032005	Bacteria	1709
363	Ga0307415_100004221	3300032126	Bacteria	7424
364	Ga0373930_0003227	3300034816	Bacteria	2576
365	Ga0373948_0001914	3300034817	Bacteria	2987
366	Ga0373950_0002238	3300034818	Bacteria	2643
367	Ga0373958_0002618	3300034819	Bacteria	2539
368	Ga0373938_0000850	3300034957	Bacteria	4930
369	Ga0373928_0001702	3300035084	Bacteria	4265
370	Ga0373929_0001252	3300035085	Bacteria	4910
371	Ga0373940_0003861	3300035088	Bacteria	3110
372	Ga0373949_0004047	3300035090	Bacteria	3396
373	Ga0373951_0000861	3300035091	Bacteria	8209
374	Ga0373952_0000441	3300035092	Bacteria	7209
375	Ga0373923_0032795	3300035111	Bacteria	2100
376	Ga0373932_0001914	3300035112	Bacteria	5553
377	Ga0373939_0000245	3300035114	Bacteria	14645
378	Ga0373941_0000417	3300035115	Bacteria	8452
379	Ga0373956_0011575	3300035119	Bacteria	3638
380	Ga0373943_0001891	3300035170	Bacteria	9469
381	Ga0373943_0109996	3300035170	Bacteria	1452
382	Ga0373946_0037735	3300035171	Bacteria	1965
383	Ga0373955_0095298	3300035172	Bacteria	1702
384	Ga0373942_0004901	3300035207	Bacteria	3102
385	Ga0373961_0010923	3300035241	Bacteria	2246
386	Ga0373924_0060444	3300035410	Bacteria	1584
387	Ga0373924_0083868	3300035410	Bacteria	1358
388	Ga0373931_0016778	3300035691	Bacteria	3610
389	Ga0373947_0157058	3300035725	Bacteria	1468
390	Ga0373937_0151144	3300036401	Bacteria	2175
391	Ga0373925_0057639	3300037068	Bacteria	2911
392	Ga0373925_0095030	3300037068	Bacteria	2283
393	Ga0316581_0037849	3300037588	Bacteria	1466
394	Ga0450920_022810	3300042122	Bacteria	1213
395	Ga0439446_0013873	3300042156	Bacteria	2218
396	Ga0439434_0027930	3300042435	Bacteria	1708
397	Ga0450918_016949	3300042531	Bacteria	1268
398	Ga0451577_0059930	3300042876	Bacteria	3393
399	Ga0495603_0054290	3300046455	Bacteria	2375
400	Ga0495603_0067256	3300046455	Bacteria	2110
401	Ga0495629_0004294	3300046459	Bacteria	10683
402	Ga0495629_0086961	3300046459	Bacteria	2181
403	Ga0495629_0159753	3300046459	Bacteria	1566
404	Ga0495638_0010376	3300046460	Bacteria	6475
405	Ga0495653_0061676	3300046463	Bacteria	2836
406	Ga0495582_0054756	3300046473	Bacteria	2199
407	Ga0495639_0021307	3300046475	Bacteria	2836
408	Ga0495639_0063249	3300046475	Bacteria	1699
409	Ga0495664_0080384	3300046477	Bacteria	1954
410	Ga0495594_0015094	3300046499	Bacteria	4055
411	Ga0495608_0125647	3300046511	Bacteria	1643
412	Ga0495630_0001261	3300046517	Bacteria	17462
413	Ga0495652_0260406	3300046529	Bacteria	1281
414	Ga0495586_0078028	3300046535	Bacteria	1817
415	Ga0495587_0098153	3300046536	Bacteria	1689
416	Ga0495645_0126532	3300046543	Bacteria	1795
417	Ga0495667_0157375	3300046559	Bacteria	1462
418	Ga0495634_0047346	3300046642	Bacteria	2898
419	Ga0495635_0098329	3300046663	Bacteria	2000
420	Ga0495635_0109169	3300046663	Bacteria	1890
421	Ga0495659_0073698	3300046664	Bacteria	1284
422	Ga0495599_0215790	3300046678	Bacteria	1175
423	Ga0495658_0088613	3300046683	Bacteria	1829
424	Ga0495658_0095515	3300046683	Bacteria	1767
425	Ga0495613_0002633	3300046689	Bacteria	13495
426	Ga0495613_0074910	3300046689	Bacteria	2464
427	Ga0495636_0109390	3300047318	Bacteria	1215
428	Ga0495674_0032656	3300047319	Bacteria	4719
429	Ga0495676_0088242	3300047321	Bacteria	2327
430	Ga0495680_0168644	3300047322	Bacteria	1586
431	Ga0495680_0243260	3300047322	Bacteria	1277
432	Ga0495684_0000550	3300047471	Bacteria	30400
433	Ga0495684_0208834	3300047471	Bacteria	1437
434	Ga0496100_0027682	3300048903	Bacteria	3488
435	Ga0496101_0001572	3300048904	Bacteria	13684
436	Ga0496101_0069030	3300048904	Bacteria	2585
437	Ga0496104_0004524	3300048907	Bacteria	12117
438	Ga0496104_0128261	3300048907	Bacteria	2436
439	Ga0496104_0380816	3300048907	Bacteria	1323
440	Ga0496104_0414445	3300048907	Bacteria	1259
441	Ga0496105_0067725	3300048908	Bacteria	2948
442	Ga0496105_0071239	3300048908	Bacteria	2873
443	Ga0496105_0237524	3300048908	Bacteria	1480
444	Ga0496106_0096896	3300048909	Bacteria	2283
445	Ga0496106_0120811	3300048909	Bacteria	2048
446	Ga0496107_0024952	3300048910	Bacteria	4231
447	Ga0496108_0009473	3300048911	Bacteria	7886
448	Ga0496108_0013709	3300048911	Bacteria	6615
449	Ga0496108_0069206	3300048911	Bacteria	2978
450	Ga0496109_0088183	3300048912	Bacteria	2867
451	Ga0496109_0097983	3300048912	Bacteria	2718
452	Ga0496109_0167307	3300048912	Bacteria	2062
453	Ga0496110_0052389	3300048913	Bacteria	3586
454	Ga0496110_0101759	3300048913	Bacteria	2576
455	Ga0496111_0118661	3300048914	Bacteria	1953
456	Ga0496111_0311154	3300048914	Bacteria	1167
457	Ga0496112_0000420	3300048915	Bacteria	27956
458	Ga0496112_0001633	3300048915	Bacteria	17370
459	Ga0496112_0014861	3300048915	Bacteria	7242
460	Ga0496112_0080510	3300048915	Bacteria	3221
461	Ga0496112_0096301	3300048915	Bacteria	2930
462	Ga0496113_0003692	3300048916	Bacteria	9223
463	Ga0496114_0000310	3300048917	Bacteria	35609
464	Ga0496114_0001016	3300048917	Bacteria	21060
465	Ga0496114_0085262	3300048917	Bacteria	2675
466	Ga0496114_0098972	3300048917	Bacteria	2487
467	Ga0501299_002844	3300049522	Bacteria	2446
468	Ga0501031_0005625	3300049568	Bacteria	8165
469	Ga0501031_0055828	3300049568	Bacteria	2573
470	Ga0501031_0104095	3300049568	Bacteria	1852
471	Ga0501032_0006096	3300049569	Bacteria	8881
472	Ga0501032_0006429	3300049569	Bacteria	8647
473	Ga0501032_0036930	3300049569	Bacteria	3333
474	Ga0501033_0002589	3300049570	Bacteria	15245
475	Ga0501033_0003111	3300049570	Bacteria	13774
476	Ga0501033_0009796	3300049570	Bacteria	7357
477	Ga0501034_0043081	3300049571	Bacteria	4568
478	Ga0501036_0019728	3300049572	Bacteria	5660
479	Ga0501036_0057012	3300049572	Bacteria	3309
480	Ga0501036_0059276	3300049572	Bacteria	3244
481	Ga0501037_0002630	3300049573	Bacteria	12956
482	Ga0501037_0061536	3300049573	Bacteria	2737
483	Ga0501037_0074714	3300049573	Bacteria	2462
484	Ga0501038_0003572	3300049574	Bacteria	14468
485	Ga0501038_0007055	3300049574	Bacteria	10373
486	Ga0501039_0016043	3300049575	Bacteria	5738
487	Ga0501040_0001813	3300049576	Bacteria	13726
488	Ga0501040_0037921	3300049576	Bacteria	3276
489	Ga0501040_0216977	3300049576	Bacteria	1361
490	Ga0501041_0002041	3300049577	Bacteria	11362
491	Ga0501041_0076200	3300049577	Bacteria	2063
492	Ga0501041_0081634	3300049577	Bacteria	1991
493	Ga0501042_0007851	3300049578	Bacteria	7015
494	Ga0501042_0012885	3300049578	Bacteria	5678
495	Ga0501042_0074994	3300049578	Bacteria	2420
496	Ga0501043_0059717	3300049579	Bacteria	2993
497	Ga0501043_0070090	3300049579	Bacteria	2754
498	Ga0501043_0083001	3300049579	Bacteria	2519
499	Ga0501046_0002936	3300049580	Bacteria	15766
500	Ga0501046_0012214	3300049580	Bacteria	7318
501	Ga0501046_0015384	3300049580	Bacteria	6431
502	Ga0501046_0029917	3300049580	Bacteria	4424
503	Ga0501047_0009879	3300049581	Bacteria	9020
504	Ga0501047_0012447	3300049581	Bacteria	8054
505	Ga0501047_0050450	3300049581	Bacteria	4018
506	Ga0501047_0110067	3300049581	Bacteria	2637
507	Ga0501048_0006094	3300049582	Bacteria	9185
508	Ga0501048_0013038	3300049582	Bacteria	6174
509	Ga0501048_0026975	3300049582	Bacteria	4179
510	Ga0501048_0027342	3300049582	Bacteria	4147
511	Ga0501048_0068817	3300049582	Bacteria	2500
512	Ga0501067_0002490	3300049583	Bacteria	10175
513	Ga0501067_0033364	3300049583	Bacteria	2856
514	Ga0501068_0007267	3300049584	Bacteria	6135
515	Ga0501068_0073834	3300049584	Bacteria	2084
516	Ga0501068_0130451	3300049584	Bacteria	1571
517	Ga0501070_0012708	3300049586	Bacteria	7101
518	Ga0501070_0038040	3300049586	Bacteria	4015
519	Ga0501071_0004994	3300049587	Bacteria	8478
520	Ga0501071_0346862	3300049587	Bacteria	1129
521	Ga0501072_0011542	3300049588	Bacteria	6752
522	Ga0501072_0012388	3300049588	Bacteria	6516
523	Ga0501072_0090523	3300049588	Bacteria	2429
524	Ga0501073_0002562	3300049589	Bacteria	13584
525	Ga0501073_0025302	3300049589	Bacteria	4258
526	Ga0501074_0005912	3300049590	Bacteria	8821
527	Ga0501074_0011030	3300049590	Bacteria	6559
528	Ga0501075_0004045	3300049591	Bacteria	9894
529	Ga0501075_0039505	3300049591	Bacteria	3532
530	Ga0501075_0078559	3300049591	Bacteria	2498
531	Ga0501076_0013993	3300049592	Bacteria	6029
532	Ga0501076_0017353	3300049592	Bacteria	5470
533	Ga0501076_0041770	3300049592	Bacteria	3609
534	Ga0501076_0049106	3300049592	Bacteria	3336
535	Ga0501076_0081048	3300049592	Bacteria	2605
536	Ga0501076_0114191	3300049592	Bacteria	2185
537	Ga0501079_0006613	3300049741	Bacteria	8725
538	Ga0501079_0009847	3300049741	Bacteria	7251
539	Ga0501079_0013881	3300049741	Bacteria	6145
540	Ga0501079_0054164	3300049741	Bacteria	3094
541	Ga0501080_0009580	3300049742	Bacteria	8843
542	Ga0501080_0010787	3300049742	Bacteria	8361
543	Ga0501080_0111872	3300049742	Bacteria	2531
544	Ga0501081_0002428	3300049743	Bacteria	11762
545	Ga0501081_0030712	3300049743	Bacteria	3639
546	Ga0501083_0005836	3300049744	Bacteria	8718
547	Ga0501035_0011728	3300049822	Bacteria	8119
548	Ga0501035_0033179	3300049822	Bacteria	4695
549	Ga0501035_0046173	3300049822	Bacteria	3917
550	Ga0501044_0031603	3300049823	Bacteria	5571
551	Ga0501045_0001051	3300049824	Bacteria	18183
552	nmdc:mga00v17_40300_c1	3300050491	Bacteria	2801
553	nmdc:mga05p37_115170_c1	3300050507	Bacteria	3305
554	nmdc:mga05p37_161033_c1	3300050507	Bacteria	2741
555	nmdc:mga05p37_21642_c1	3300050507	Bacteria	7790
556	nmdc:mga05p37_41507_c1	3300050507	Bacteria	5648
557	nmdc:mga05p37_41843_c1	3300050507	Bacteria	5627
558	nmdc:mga05p37_51424_c1	3300050507	Bacteria	5067
559	nmdc:mga05p37_59416_c1	3300050507	Bacteria	4708
560	nmdc:mga05p37_61701_c1	3300050507	Bacteria	4615
561	nmdc:mga05p37_84214_c1	3300050507	Bacteria	3917
562	nmdc:mga05p37_9528_c1	3300050507	Bacteria	11497
563	nmdc:mga0qj67_2331_c1	3300050509	Bacteria	13498
564	nmdc:mga0qj67_64610_c1	3300050509	Bacteria	2911
565	nmdc:mga06r32_241695_c1	3300050510	Bacteria	1793
566	nmdc:mga06r32_25093_c1	3300050510	Bacteria	5540
567	nmdc:mga06r32_44481_c1	3300050510	Bacteria	4228
568	nmdc:mga06r32_7501_c1	3300050510	Bacteria	9811
569	nmdc:mga06r32_87390_c1	3300050510	Bacteria	3042
570	nmdc:mga08y16_156397_c1	3300050511	Bacteria	2369
571	nmdc:mga08y16_179791_c1	3300050511	Bacteria	2196
572	nmdc:mga08y16_30958_c1	3300050511	Bacteria	5627
573	nmdc:mga08y16_335669_c1	3300050511	Bacteria	1554
574	nmdc:mga08y16_3_c1	3300050511	Bacteria	936907
575	nmdc:mga08y16_5107_c1	3300050511	Bacteria	13711
576	nmdc:mga08y16_524_c1	3300050511	Bacteria	35438
577	nmdc:mga0n895_3475_c1	3300050512	Bacteria	12714
578	nmdc:mga0n895_36679_c1	3300050512	Bacteria	4736
579	nmdc:mga0n895_56048_c1	3300050512	Bacteria	3881
580	nmdc:mga0n895_644453_c1	3300050512	Bacteria	1059
581	nmdc:mga0n895_6498_c1	3300050512	Bacteria	9938
582	nmdc:mga0n895_67_c1	3300050512	Bacteria	61603
583	nmdc:mga0n895_9091_c1	3300050512	Bacteria	8668
584	nmdc:mga0n895_91346_c1	3300050512	Bacteria	3047
585	nmdc:mga0rr50_25_c1	3300050513	Bacteria	114931
586	nmdc:mga0rr50_3136_c1	3300050513	Bacteria	9440
587	nmdc:mga0rr50_46289_c1	3300050513	Bacteria	3203
588	nmdc:mga0rr50_73446_c1	3300050513	Bacteria	2615
589	nmdc:mga0rr50_96749_c1	3300050513	Bacteria	2310
590	nmdc:mga08x19_105262_c1	3300050514	Bacteria	1876
591	nmdc:mga08x19_110624_c1	3300050514	Bacteria	1832
592	nmdc:mga08x19_111318_c1	3300050514	Bacteria	1827
593	nmdc:mga08x19_213_c1	3300050514	Bacteria	44077
594	nmdc:mga08x19_3059_c1	3300050514	Bacteria	10053
595	nmdc:mga08x19_5150_c1	3300050514	Bacteria	7731
596	nmdc:mga0a205_116755_c1	3300050515	Bacteria	2567
597	nmdc:mga0a205_23898_c1	3300050515	Bacteria	5801
598	nmdc:mga0a205_256041_c1	3300050515	Bacteria	1629
599	nmdc:mga0a205_276734_c1	3300050515	Bacteria	1554
600	nmdc:mga0a205_67689_c1	3300050515	Bacteria	3450
601	nmdc:mga0a205_8756_c1	3300050515	Bacteria	9217
602	Ga0495601_0043705	3300053077	Bacteria	2814
603	Ga0495601_0183450	3300053077	Bacteria	1368
604	Ga0495619_0010658	3300053085	Bacteria	5786
605	Ga0495619_0026085	3300053085	Bacteria	3758
606	Ga0500592_005332	3300053116	Bacteria	2046
607	Ga0501084_0001248	3300054114	Bacteria	20008
608	Ga0501084_0009843	3300054114	Bacteria	7900
609	Ga0501084_0023883	3300054114	Bacteria	5100
610	Ga0501084_0025595	3300054114	Bacteria	4922
611	Ga0501084_0204638	3300054114	Bacteria	1666
612	Ga0590071_000060	3300059421	Bacteria	29173
613	Ga0590071_001017	3300059421	Bacteria	7633
614	Ga0590075_000043	3300059424	Bacteria	33018
615	Ga0590075_000598	3300059424	Bacteria	9691
616	Ga0590075_000898	3300059424	Bacteria	7757
617	Ga0590077_000073	3300059426	Bacteria	25304
618	Ga0590077_000569	3300059426	Bacteria	10181
619	Ga0590077_002267	3300059426	Bacteria	4152
620	Ga0590077_027636	3300059426	Bacteria	1230
621	Ga0501082_0000929	3300060353	Bacteria	25893
622	Ga0501082_0006033	3300060353	Bacteria	10510
623	Ga0501082_0073721	3300060353	Bacteria	2939
624	Ga0530510_0007416	3300061734	Bacteria	7634
625	Ga0530510_0104729	3300061734	Bacteria	2070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005617	Ga0068859_100334461	Ga0068859_1003344612	287
2	3300006931	Ga0097620_100334482	Ga0097620_1003344822	287
3	3300009553	Ga0105249_10403455	Ga0105249_104034552	296
4	3300026089	Ga0207648_10217178	Ga0207648_102171782	302
5	3300005458	Ga0070681_10058365	Ga0070681_100583653	303
6	3300025912	Ga0207707_10049347	Ga0207707_100493472	303
7	3300014326	Ga0157380_10401576	Ga0157380_104015762	304
8	3300048907	Ga0496104_0414445	Ga0496104_0414445_295_1248	304
9	3300037588	Ga0316581_0037849	Ga0316581_0037849_196_1179	306
10	3300046455	Ga0495603_0067256	Ga0495603_0067256_758_1834	307
11	3300046460	Ga0495638_0010376	Ga0495638_0010376_1182_2156	307
12	3300053116	Ga0500592_005332	Ga0500592_005332_1000_1974	307
13	3300009176	Ga0105242_10438509	Ga0105242_104385092	310
14	3300050510	nmdc:mga06r32_7501_c1	nmdc:mga06r32_7501_c1_7112_8152	310
15	3300006847	Ga0075431_100281757	Ga0075431_1002817572	311
16	3300007076	Ga0075435_100000009	Ga0075435_10000000911	311
17	3300026075	Ga0207708_10262435	Ga0207708_102624352	311
18	3300031548	Ga0307408_100025812	Ga0307408_1000258123	311
19	3300034819	Ga0373958_0002618	Ga0373958_0002618_407_1357	311
20	3300046689	Ga0495613_0074910	Ga0495613_0074910_743_1762	311
21	3300049568	Ga0501031_0005625	Ga0501031_0005625_1200_2147	311
22	3300049568	Ga0501031_0055828	Ga0501031_0055828_1371_2318	311
23	3300049568	Ga0501031_0104095	Ga0501031_0104095_194_1141	311
24	3300049569	Ga0501032_0006096	Ga0501032_0006096_6128_7075	311
25	3300049569	Ga0501032_0006429	Ga0501032_0006429_4314_5261	311
26	3300049569	Ga0501032_0036930	Ga0501032_0036930_751_1698	311
27	3300049570	Ga0501033_0002589	Ga0501033_0002589_6426_7373	311
28	3300049570	Ga0501033_0003111	Ga0501033_0003111_7582_8529	311
29	3300049570	Ga0501033_0009796	Ga0501033_0009796_1605_2552	311
30	3300049571	Ga0501034_0043081	Ga0501034_0043081_2093_3040	311
31	3300049572	Ga0501036_0019728	Ga0501036_0019728_1457_2404	311
32	3300049572	Ga0501036_0057012	Ga0501036_0057012_1220_2167	311
33	3300049573	Ga0501037_0002630	Ga0501037_0002630_8999_9946	311
34	3300049573	Ga0501037_0061536	Ga0501037_0061536_753_1700	311
35	3300049573	Ga0501037_0074714	Ga0501037_0074714_1271_2218	311
36	3300049574	Ga0501038_0003572	Ga0501038_0003572_12245_13192	311
37	3300049574	Ga0501038_0007055	Ga0501038_0007055_1589_2536	311
38	3300049578	Ga0501042_0074994	Ga0501042_0074994_19_966	311
39	3300049579	Ga0501043_0083001	Ga0501043_0083001_1328_2275	311
40	3300049580	Ga0501046_0012214	Ga0501046_0012214_2113_3060	311
41	3300049580	Ga0501046_0015384	Ga0501046_0015384_4314_5261	311
42	3300049580	Ga0501046_0029917	Ga0501046_0029917_1037_1984	311
43	3300049581	Ga0501047_0012447	Ga0501047_0012447_2313_3260	311
44	3300049581	Ga0501047_0050450	Ga0501047_0050450_2108_3055	311
45	3300049581	Ga0501047_0110067	Ga0501047_0110067_1591_2538	311
46	3300049582	Ga0501048_0006094	Ga0501048_0006094_5413_6360	311
47	3300049582	Ga0501048_0013038	Ga0501048_0013038_448_1395	311
48	3300049582	Ga0501048_0026975	Ga0501048_0026975_1277_2224	311
49	3300049583	Ga0501067_0002490	Ga0501067_0002490_515_1462	311
50	3300049583	Ga0501067_0033364	Ga0501067_0033364_1221_2168	311
51	3300049584	Ga0501068_0007267	Ga0501068_0007267_4933_5880	311
52	3300049584	Ga0501068_0073834	Ga0501068_0073834_795_1742	311
53	3300049584	Ga0501068_0130451	Ga0501068_0130451_519_1466	311
54	3300049586	Ga0501070_0012708	Ga0501070_0012708_741_1688	311
55	3300049586	Ga0501070_0038040	Ga0501070_0038040_2557_3504	311
56	3300049587	Ga0501071_0004994	Ga0501071_0004994_1641_2588	311
57	3300049588	Ga0501072_0090523	Ga0501072_0090523_987_1934	311
58	3300049589	Ga0501073_0002562	Ga0501073_0002562_4207_5154	311
59	3300049589	Ga0501073_0025302	Ga0501073_0025302_2488_3435	311
60	3300049590	Ga0501074_0005912	Ga0501074_0005912_4903_5850	311
61	3300049590	Ga0501074_0011030	Ga0501074_0011030_4314_5261	311
62	3300049592	Ga0501076_0013993	Ga0501076_0013993_4914_5861	311
63	3300049592	Ga0501076_0017353	Ga0501076_0017353_3364_4311	311
64	3300049592	Ga0501076_0049106	Ga0501076_0049106_2256_3203	311
65	3300049741	Ga0501079_0006613	Ga0501079_0006613_4952_5899	311
66	3300049741	Ga0501079_0013881	Ga0501079_0013881_2701_3648	311
67	3300049742	Ga0501080_0009580	Ga0501080_0009580_6178_7125	311
68	3300049742	Ga0501080_0010787	Ga0501080_0010787_4974_5921	311
69	3300049743	Ga0501081_0030712	Ga0501081_0030712_1903_2850	311
70	3300049744	Ga0501083_0005836	Ga0501083_0005836_6988_7935	311
71	3300049822	Ga0501035_0011728	Ga0501035_0011728_4922_5869	311
72	3300049822	Ga0501035_0033179	Ga0501035_0033179_3649_4596	311
73	3300049822	Ga0501035_0046173	Ga0501035_0046173_2135_3082	311
74	3300049823	Ga0501044_0031603	Ga0501044_0031603_2254_3201	311
75	3300050491	nmdc:mga00v17_40300_c1	nmdc:mga00v17_40300_c1_376_1341	311
76	3300050509	nmdc:mga0qj67_64610_c1	nmdc:mga0qj67_64610_c1_217_1164	311
77	3300050510	nmdc:mga06r32_241695_c1	nmdc:mga06r32_241695_c1_370_1317	311
78	3300054114	Ga0501084_0009843	Ga0501084_0009843_4817_5764	311
79	3300054114	Ga0501084_0023883	Ga0501084_0023883_349_1296	311
80	3300054114	Ga0501084_0025595	Ga0501084_0025595_685_1632	311
81	3300059421	Ga0590071_001017	Ga0590071_001017_217_1164	311
82	3300059424	Ga0590075_000043	Ga0590075_000043_25726_26673	311
83	3300059426	Ga0590077_000073	Ga0590077_000073_22146_23093	311
84	3300060353	Ga0501082_0006033	Ga0501082_0006033_5226_6173	311
85	3300060353	Ga0501082_0073721	Ga0501082_0073721_1939_2886	311
86	3300005293	Ga0065715_10102961	Ga0065715_101029612	312
87	3300005293	Ga0065715_10129720	Ga0065715_101297202	312
88	3300005353	Ga0070669_100002231	Ga0070669_10000223113	312
89	3300005354	Ga0070675_100118780	Ga0070675_1001187803	312
90	3300005364	Ga0070673_100287084	Ga0070673_1002870842	312
91	3300005366	Ga0070659_100071584	Ga0070659_1000715842	312
92	3300005544	Ga0070686_100328849	Ga0070686_1003288491	312
93	3300005844	Ga0068862_100016044	Ga0068862_1000160442	312
94	3300006195	Ga0075366_10080957	Ga0075366_100809572	312
95	3300006844	Ga0075428_100087697	Ga0075428_1000876972	312
96	3300006847	Ga0075431_100049355	Ga0075431_1000493554	312
97	3300006852	Ga0075433_10111761	Ga0075433_101117613	312
98	3300009094	Ga0111539_10005778	Ga0111539_100057783	312
99	3300009147	Ga0114129_10002818	Ga0114129_1000281815	312
100	3300009147	Ga0114129_10015684	Ga0114129_100156846	312
101	3300009177	Ga0105248_10103317	Ga0105248_101033173	312
102	3300009553	Ga0105249_10001034	Ga0105249_100010348	312
103	3300013308	Ga0157375_10362021	Ga0157375_103620211	312
104	3300025919	Ga0207657_10255286	Ga0207657_102552862	312
105	3300025923	Ga0207681_10007913	Ga0207681_100079135	312
106	3300025932	Ga0207690_10262719	Ga0207690_102627191	312
107	3300025941	Ga0207711_10153892	Ga0207711_101538922	312
108	3300025945	Ga0207679_10452418	Ga0207679_104524181	312
109	3300025961	Ga0207712_10002893	Ga0207712_100028935	312
110	3300026095	Ga0207676_10364657	Ga0207676_103646572	312
111	3300027907	Ga0207428_10005172	Ga0207428_100051725	312
112	3300028380	Ga0268265_10017891	Ga0268265_100178914	312
113	3300042156	Ga0439446_0013873	Ga0439446_0013873_824_1774	312
114	3300042435	Ga0439434_0027930	Ga0439434_0027930_166_1116	312
115	3300046475	Ga0495639_0063249	Ga0495639_0063249_185_1150	312
116	3300046543	Ga0495645_0126532	Ga0495645_0126532_432_1397	312
117	3300047471	Ga0495684_0208834	Ga0495684_0208834_91_1056	312
118	3300050510	nmdc:mga06r32_25093_c1	nmdc:mga06r32_25093_c1_838_1788	312
119	3300050511	nmdc:mga08y16_30958_c1	nmdc:mga08y16_30958_c1_1368_2318	312
120	3300050512	nmdc:mga0n895_91346_c1	nmdc:mga0n895_91346_c1_249_1199	312
121	3300050515	nmdc:mga0a205_23898_c1	nmdc:mga0a205_23898_c1_3209_4159	312
122	3300005290	Ga0065712_10014241	Ga0065712_100142412	313
123	3300005293	Ga0065715_10199238	Ga0065715_101992381	313
124	3300005356	Ga0070674_100001653	Ga0070674_1000016535	313
125	3300005356	Ga0070674_100066320	Ga0070674_1000663202	313
126	3300005456	Ga0070678_100034448	Ga0070678_1000344482	313
127	3300005471	Ga0070698_100043713	Ga0070698_1000437132	313
128	3300005718	Ga0068866_10059727	Ga0068866_100597272	313
129	3300006237	Ga0097621_100027249	Ga0097621_1000272493	313
130	3300006844	Ga0075428_100000108	Ga0075428_10000010822	313
131	3300006844	Ga0075428_100028284	Ga0075428_1000282843	313
132	3300006846	Ga0075430_100047574	Ga0075430_1000475743	313
133	3300006847	Ga0075431_100011979	Ga0075431_1000119796	313
134	3300006847	Ga0075431_100260238	Ga0075431_1002602382	313
135	3300006880	Ga0075429_100014774	Ga0075429_1000147746	313
136	3300009094	Ga0111539_10000001	Ga0111539_10000001219	313
137	3300009094	Ga0111539_10039623	Ga0111539_100396234	313
138	3300009094	Ga0111539_10265493	Ga0111539_102654932	313
139	3300009177	Ga0105248_10047346	Ga0105248_100473461	313
140	3300014326	Ga0157380_10050743	Ga0157380_100507432	313
141	3300014326	Ga0157380_10318082	Ga0157380_103180822	313
142	3300014969	Ga0157376_10374048	Ga0157376_103740481	313
143	3300025893	Ga0207682_10008407	Ga0207682_100084072	313
144	3300025923	Ga0207681_10103508	Ga0207681_101035082	313
145	3300025937	Ga0207669_10000305	Ga0207669_1000030510	313
146	3300025937	Ga0207669_10032418	Ga0207669_100324182	313
147	3300025941	Ga0207711_10145760	Ga0207711_101457602	313
148	3300025972	Ga0207668_10372347	Ga0207668_103723472	313
149	3300026121	Ga0207683_10028653	Ga0207683_100286533	313
150	3300027907	Ga0207428_10000002	Ga0207428_10000002232	313
151	3300031548	Ga0307408_100031481	Ga0307408_1000314812	313
152	3300031824	Ga0307413_10131702	Ga0307413_101317022	313
153	3300031852	Ga0307410_10061905	Ga0307410_100619051	313
154	3300031901	Ga0307406_10028135	Ga0307406_100281351	313
155	3300031903	Ga0307407_10023545	Ga0307407_100235452	313
156	3300031911	Ga0307412_10012993	Ga0307412_100129933	313
157	3300032002	Ga0307416_100286316	Ga0307416_1002863162	313
158	3300032005	Ga0307411_10081225	Ga0307411_100812252	313
159	3300035119	Ga0373956_0011575	Ga0373956_0011575_1014_1988	313
160	3300036401	Ga0373937_0151144	Ga0373937_0151144_522_1502	313
161	3300037068	Ga0373925_0057639	Ga0373925_0057639_1263_2243	313
162	3300046463	Ga0495653_0061676	Ga0495653_0061676_502_1473	313
163	3300046473	Ga0495582_0054756	Ga0495582_0054756_354_1328	313
164	3300046477	Ga0495664_0080384	Ga0495664_0080384_864_1838	313
165	3300046517	Ga0495630_0001261	Ga0495630_0001261_2258_3232	313
166	3300046536	Ga0495587_0098153	Ga0495587_0098153_357_1331	313
167	3300046559	Ga0495667_0157375	Ga0495667_0157375_447_1427	313
168	3300046663	Ga0495635_0098329	Ga0495635_0098329_670_1644	313
169	3300046678	Ga0495599_0215790	Ga0495599_0215790_172_1146	313
170	3300046689	Ga0495613_0002633	Ga0495613_0002633_5435_6409	313
171	3300047319	Ga0495674_0032656	Ga0495674_0032656_2504_3478	313
172	3300047471	Ga0495684_0000550	Ga0495684_0000550_22377_23351	313
173	3300048912	Ga0496109_0088183	Ga0496109_0088183_1515_2495	313
174	3300048913	Ga0496110_0101759	Ga0496110_0101759_1352_2332	313
175	3300048914	Ga0496111_0118661	Ga0496111_0118661_655_1635	313
176	3300049572	Ga0501036_0059276	Ga0501036_0059276_1677_2636	313
177	3300049576	Ga0501040_0037921	Ga0501040_0037921_2048_3007	313
178	3300049576	Ga0501040_0216977	Ga0501040_0216977_308_1267	313
179	3300049577	Ga0501041_0076200	Ga0501041_0076200_694_1653	313
180	3300049578	Ga0501042_0012885	Ga0501042_0012885_4506_5465	313
181	3300049582	Ga0501048_0027342	Ga0501048_0027342_702_1661	313
182	3300049588	Ga0501072_0011542	Ga0501072_0011542_3943_4902	313
183	3300049591	Ga0501075_0039505	Ga0501075_0039505_1624_2583	313
184	3300049592	Ga0501076_0041770	Ga0501076_0041770_1472_2431	313
185	3300049741	Ga0501079_0054164	Ga0501079_0054164_884_1843	313
186	3300050507	nmdc:mga05p37_41507_c1	nmdc:mga05p37_41507_c1_2678_3637	313
187	3300050509	nmdc:mga0qj67_2331_c1	nmdc:mga0qj67_2331_c1_9106_10065	313
188	3300050511	nmdc:mga08y16_179791_c1	nmdc:mga08y16_179791_c1_705_1664	313
189	3300050511	nmdc:mga08y16_3_c1	nmdc:mga08y16_3_c1_245222_246178	313
190	3300050512	nmdc:mga0n895_56048_c1	nmdc:mga0n895_56048_c1_640_1620	313
191	3300050514	nmdc:mga08x19_5150_c1	nmdc:mga08x19_5150_c1_130_1086	313
192	3300053085	Ga0495619_0010658	Ga0495619_0010658_92_1072	313
193	3300054114	Ga0501084_0204638	Ga0501084_0204638_149_1108	313
194	3300061734	Ga0530510_0104729	Ga0530510_0104729_601_1560	313
195	3300005288	Ga0065714_10114082	Ga0065714_101140822	314
196	3300005289	Ga0065704_10114616	Ga0065704_101146162	314
197	3300005290	Ga0065712_10000343	Ga0065712_100003433	314
198	3300005290	Ga0065712_10148089	Ga0065712_101480892	314
199	3300005293	Ga0065715_10000269	Ga0065715_100002695	314
200	3300005293	Ga0065715_10091468	Ga0065715_100914683	314
201	3300005295	Ga0065707_10084326	Ga0065707_100843264	314
202	3300005327	Ga0070658_10270665	Ga0070658_102706652	314
203	3300005328	Ga0070676_10003342	Ga0070676_100033422	314
204	3300005329	Ga0070683_100033165	Ga0070683_1000331655	314
205	3300005334	Ga0068869_100136237	Ga0068869_1001362372	314
206	3300005335	Ga0070666_10089926	Ga0070666_100899262	314
207	3300005335	Ga0070666_10108634	Ga0070666_101086342	314
208	3300005335	Ga0070666_10182176	Ga0070666_101821762	314
209	3300005336	Ga0070680_100210150	Ga0070680_1002101502	314
210	3300005339	Ga0070660_100001391	Ga0070660_1000013917	314
211	3300005341	Ga0070691_10015472	Ga0070691_100154724	314
212	3300005353	Ga0070669_100019779	Ga0070669_1000197793	314
213	3300005353	Ga0070669_100089245	Ga0070669_1000892452	314
214	3300005353	Ga0070669_100110708	Ga0070669_1001107083	314
215	3300005354	Ga0070675_100000409	Ga0070675_1000004092	314
216	3300005354	Ga0070675_100095851	Ga0070675_1000958512	314
217	3300005354	Ga0070675_100195227	Ga0070675_1001952272	314
218	3300005354	Ga0070675_100563618	Ga0070675_1005636181	314
219	3300005355	Ga0070671_100005955	Ga0070671_1000059556	314
220	3300005364	Ga0070673_100415713	Ga0070673_1004157132	314
221	3300005365	Ga0070688_100005352	Ga0070688_1000053523	314
222	3300005365	Ga0070688_100196804	Ga0070688_1001968042	314
223	3300005435	Ga0070714_100026585	Ga0070714_1000265853	314
224	3300005439	Ga0070711_100250407	Ga0070711_1002504072	314
225	3300005441	Ga0070700_100194131	Ga0070700_1001941312	314
226	3300005444	Ga0070694_100011045	Ga0070694_1000110455	314
227	3300005444	Ga0070694_100062103	Ga0070694_1000621032	314
228	3300005456	Ga0070678_100046435	Ga0070678_1000464353	314
229	3300005457	Ga0070662_100200224	Ga0070662_1002002241	314
230	3300005458	Ga0070681_10014599	Ga0070681_100145994	314
231	3300005459	Ga0068867_100142482	Ga0068867_1001424822	314
232	3300005467	Ga0070706_100095469	Ga0070706_1000954693	314
233	3300005467	Ga0070706_100153483	Ga0070706_1001534833	314
234	3300005468	Ga0070707_100147807	Ga0070707_1001478073	314
235	3300005468	Ga0070707_100234322	Ga0070707_1002343221	314
236	3300005471	Ga0070698_100000242	Ga0070698_10000024212	314
237	3300005471	Ga0070698_100451707	Ga0070698_1004517071	314
238	3300005518	Ga0070699_100000778	Ga0070699_10000077812	314
239	3300005518	Ga0070699_100007944	Ga0070699_1000079443	314
240	3300005518	Ga0070699_100051949	Ga0070699_1000519494	314
241	3300005530	Ga0070679_100008891	Ga0070679_1000088914	314
242	3300005539	Ga0068853_100188676	Ga0068853_1001886762	314
243	3300005543	Ga0070672_100063496	Ga0070672_1000634962	314
244	3300005543	Ga0070672_100116539	Ga0070672_1001165392	314
245	3300005545	Ga0070695_100007869	Ga0070695_1000078696	314
246	3300005545	Ga0070695_100064422	Ga0070695_1000644222	314
247	3300005546	Ga0070696_100002023	Ga0070696_1000020236	314
248	3300005546	Ga0070696_100005044	Ga0070696_1000050442	314
249	3300005546	Ga0070696_100268081	Ga0070696_1002680811	314
250	3300005548	Ga0070665_100013471	Ga0070665_1000134712	314
251	3300005548	Ga0070665_100068290	Ga0070665_1000682904	314
252	3300005548	Ga0070665_100252726	Ga0070665_1002527262	314
253	3300005548	Ga0070665_100305844	Ga0070665_1003058441	314
254	3300005564	Ga0070664_100063944	Ga0070664_1000639444	314
255	3300005578	Ga0068854_100002297	Ga0068854_10000229710	314
256	3300005578	Ga0068854_100018330	Ga0068854_1000183305	314
257	3300005615	Ga0070702_100000841	Ga0070702_1000008417	314
258	3300005617	Ga0068859_100018140	Ga0068859_1000181405	314
259	3300005617	Ga0068859_100158538	Ga0068859_1001585382	314
260	3300005618	Ga0068864_100093317	Ga0068864_1000933172	314
261	3300005618	Ga0068864_100198580	Ga0068864_1001985802	314
262	3300005618	Ga0068864_100244848	Ga0068864_1002448482	314
263	3300005718	Ga0068866_10019831	Ga0068866_100198312	314
264	3300005719	Ga0068861_100008055	Ga0068861_1000080552	314
265	3300005719	Ga0068861_100056837	Ga0068861_1000568372	314
266	3300005719	Ga0068861_100091863	Ga0068861_1000918632	314
267	3300005719	Ga0068861_100254353	Ga0068861_1002543531	314
268	3300005840	Ga0068870_10053512	Ga0068870_100535121	314
269	3300005841	Ga0068863_100078901	Ga0068863_1000789013	314
270	3300005842	Ga0068858_100017485	Ga0068858_1000174855	314
271	3300005842	Ga0068858_100218247	Ga0068858_1002182472	314
272	3300005842	Ga0068858_100302520	Ga0068858_1003025202	314
273	3300005843	Ga0068860_100015479	Ga0068860_1000154793	314
274	3300005844	Ga0068862_100015234	Ga0068862_1000152342	314
275	3300005844	Ga0068862_100152513	Ga0068862_1001525133	314
276	3300005844	Ga0068862_100338122	Ga0068862_1003381221	314
277	3300005937	Ga0081455_10095174	Ga0081455_100951742	314
278	3300005983	Ga0081540_1116953	Ga0081540_11169531	314
279	3300005985	Ga0081539_10018397	Ga0081539_100183972	314
280	3300006237	Ga0097621_100001649	Ga0097621_10000164913	314
281	3300006237	Ga0097621_100031149	Ga0097621_1000311492	314
282	3300006237	Ga0097621_100033502	Ga0097621_1000335021	314
283	3300006237	Ga0097621_100043873	Ga0097621_1000438734	314
284	3300006237	Ga0097621_100064975	Ga0097621_1000649752	314
285	3300006237	Ga0097621_100336999	Ga0097621_1003369992	314
286	3300006358	Ga0068871_100000409	Ga0068871_10000040910	314
287	3300006358	Ga0068871_100026234	Ga0068871_1000262343	314
288	3300006358	Ga0068871_100033791	Ga0068871_1000337911	314
289	3300006358	Ga0068871_100034049	Ga0068871_1000340493	314
290	3300006844	Ga0075428_100037397	Ga0075428_1000373972	314
291	3300006844	Ga0075428_100340885	Ga0075428_1003408851	314
292	3300006847	Ga0075431_100362799	Ga0075431_1003627992	314
293	3300006852	Ga0075433_10047327	Ga0075433_100473272	314
294	3300006852	Ga0075433_10068216	Ga0075433_100682163	314
295	3300006852	Ga0075433_10105775	Ga0075433_101057752	314
296	3300006871	Ga0075434_100013793	Ga0075434_1000137934	314
297	3300006871	Ga0075434_100106439	Ga0075434_1001064392	314
298	3300006871	Ga0075434_100189900	Ga0075434_1001899002	314
299	3300006871	Ga0075434_100191115	Ga0075434_1001911151	314
300	3300006871	Ga0075434_100217697	Ga0075434_1002176972	314
301	3300006881	Ga0068865_100012815	Ga0068865_1000128155	314
302	3300006881	Ga0068865_100033937	Ga0068865_1000339371	314
303	3300006881	Ga0068865_100109384	Ga0068865_1001093842	314
304	3300006914	Ga0075436_100000801	Ga0075436_1000008012	314
305	3300006914	Ga0075436_100024573	Ga0075436_1000245733	314
306	3300006914	Ga0075436_100027012	Ga0075436_1000270121	314
307	3300006914	Ga0075436_100091406	Ga0075436_1000914062	314
308	3300006931	Ga0097620_100018140	Ga0097620_1000181405	314
309	3300006931	Ga0097620_100158541	Ga0097620_1001585412	314
310	3300007076	Ga0075435_100000849	Ga0075435_10000084912	314
311	3300007076	Ga0075435_100002789	Ga0075435_1000027892	314
312	3300007076	Ga0075435_100004370	Ga0075435_1000043705	314
313	3300007076	Ga0075435_100012667	Ga0075435_1000126672	314
314	3300007076	Ga0075435_100060770	Ga0075435_1000607704	314
315	3300007076	Ga0075435_100072807	Ga0075435_1000728073	314
316	3300007076	Ga0075435_100130196	Ga0075435_1001301963	314
317	3300009093	Ga0105240_10023988	Ga0105240_100239883	314
318	3300009094	Ga0111539_10002783	Ga0111539_1000278319	314
319	3300009094	Ga0111539_10006101	Ga0111539_1000610110	314
320	3300009094	Ga0111539_10169607	Ga0111539_101696072	314
321	3300009098	Ga0105245_10021503	Ga0105245_100215034	314
322	3300009098	Ga0105245_10152745	Ga0105245_101527452	314
323	3300009101	Ga0105247_10087786	Ga0105247_100877862	314
324	3300009147	Ga0114129_10001825	Ga0114129_100018258	314
325	3300009147	Ga0114129_10003225	Ga0114129_1000322513	314
326	3300009147	Ga0114129_10008909	Ga0114129_1000890912	314
327	3300009147	Ga0114129_10018349	Ga0114129_100183498	314
328	3300009147	Ga0114129_10095315	Ga0114129_100953154	314
329	3300009147	Ga0114129_10177686	Ga0114129_101776863	314
330	3300009147	Ga0114129_10177989	Ga0114129_101779892	314
331	3300009147	Ga0114129_10289011	Ga0114129_102890112	314
332	3300009148	Ga0105243_10052685	Ga0105243_100526852	314
333	3300009148	Ga0105243_10280758	Ga0105243_102807581	314
334	3300009148	Ga0105243_10287824	Ga0105243_102878242	314
335	3300009176	Ga0105242_10004183	Ga0105242_100041832	314
336	3300009176	Ga0105242_10252444	Ga0105242_102524442	314
337	3300009176	Ga0105242_10343648	Ga0105242_103436482	314
338	3300009177	Ga0105248_10061061	Ga0105248_100610612	314
339	3300009177	Ga0105248_10091358	Ga0105248_100913581	314
340	3300009177	Ga0105248_10164623	Ga0105248_101646233	314
341	3300009177	Ga0105248_10331747	Ga0105248_103317472	314
342	3300009177	Ga0105248_10360566	Ga0105248_103605661	314
343	3300009177	Ga0105248_10433254	Ga0105248_104332542	314
344	3300009177	Ga0105248_10469850	Ga0105248_104698501	314
345	3300009553	Ga0105249_10133544	Ga0105249_101335442	314
346	3300009553	Ga0105249_10156896	Ga0105249_101568962	314
347	3300011119	Ga0105246_10044044	Ga0105246_100440442	314
348	3300011119	Ga0105246_10376324	Ga0105246_103763241	314
349	3300013296	Ga0157374_10017001	Ga0157374_100170012	314
350	3300013306	Ga0163162_10032273	Ga0163162_100322733	314
351	3300013306	Ga0163162_10116439	Ga0163162_101164393	314
352	3300013306	Ga0163162_10367310	Ga0163162_103673102	314
353	3300013307	Ga0157372_10372243	Ga0157372_103722431	314
354	3300013308	Ga0157375_10049944	Ga0157375_100499443	314
355	3300013308	Ga0157375_10288059	Ga0157375_102880592	314
356	3300014325	Ga0163163_10004026	Ga0163163_100040262	314
357	3300014325	Ga0163163_10112167	Ga0163163_101121673	314
358	3300014326	Ga0157380_10009700	Ga0157380_100097005	314
359	3300014326	Ga0157380_10510265	Ga0157380_105102652	314
360	3300014968	Ga0157379_10059976	Ga0157379_100599762	314
361	3300014968	Ga0157379_10090546	Ga0157379_100905462	314
362	3300014969	Ga0157376_10011629	Ga0157376_100116293	314
363	3300014969	Ga0157376_10302182	Ga0157376_103021822	314
364	3300014969	Ga0157376_10325889	Ga0157376_103258892	314
365	3300017792	Ga0163161_10007977	Ga0163161_100079778	314
366	3300025900	Ga0207710_10065126	Ga0207710_100651262	314
367	3300025903	Ga0207680_10043126	Ga0207680_100431262	314
368	3300025903	Ga0207680_10073924	Ga0207680_100739242	314
369	3300025903	Ga0207680_10108659	Ga0207680_101086592	314
370	3300025906	Ga0207699_10153557	Ga0207699_101535572	314
371	3300025907	Ga0207645_10050060	Ga0207645_100500602	314
372	3300025907	Ga0207645_10058331	Ga0207645_100583312	314
373	3300025909	Ga0207705_10319231	Ga0207705_103192312	314
374	3300025910	Ga0207684_10125994	Ga0207684_101259942	314
375	3300025913	Ga0207695_10035622	Ga0207695_100356222	314
376	3300025913	Ga0207695_10090085	Ga0207695_100900852	314
377	3300025916	Ga0207663_10180776	Ga0207663_101807762	314
378	3300025917	Ga0207660_10167402	Ga0207660_101674022	314
379	3300025918	Ga0207662_10167930	Ga0207662_101679302	314
380	3300025919	Ga0207657_10006192	Ga0207657_100061922	314
381	3300025919	Ga0207657_10021487	Ga0207657_100214873	314
382	3300025920	Ga0207649_10072246	Ga0207649_100722463	314
383	3300025920	Ga0207649_10267189	Ga0207649_102671892	314
384	3300025921	Ga0207652_10122376	Ga0207652_101223763	314
385	3300025921	Ga0207652_10216603	Ga0207652_102166032	314
386	3300025922	Ga0207646_10047273	Ga0207646_100472733	314
387	3300025922	Ga0207646_10126596	Ga0207646_101265963	314
388	3300025923	Ga0207681_10026759	Ga0207681_100267592	314
389	3300025923	Ga0207681_10058552	Ga0207681_100585523	314
390	3300025923	Ga0207681_10172580	Ga0207681_101725802	314
391	3300025925	Ga0207650_10212354	Ga0207650_102123541	314
392	3300025925	Ga0207650_10249716	Ga0207650_102497162	314
393	3300025925	Ga0207650_10342085	Ga0207650_103420851	314
394	3300025926	Ga0207659_10028141	Ga0207659_100281412	314
395	3300025926	Ga0207659_10092242	Ga0207659_100922422	314
396	3300025926	Ga0207659_10496275	Ga0207659_104962751	314
397	3300025927	Ga0207687_10207555	Ga0207687_102075552	314
398	3300025931	Ga0207644_10225918	Ga0207644_102259182	314
399	3300025933	Ga0207706_10076519	Ga0207706_100765192	314
400	3300025934	Ga0207686_10027463	Ga0207686_100274632	314
401	3300025934	Ga0207686_10034003	Ga0207686_100340032	314
402	3300025934	Ga0207686_10107343	Ga0207686_101073432	314
403	3300025935	Ga0207709_10074678	Ga0207709_100746781	314
404	3300025937	Ga0207669_10005211	Ga0207669_100052112	314
405	3300025937	Ga0207669_10029234	Ga0207669_100292341	314
406	3300025937	Ga0207669_10032588	Ga0207669_100325883	314
407	3300025938	Ga0207704_10013184	Ga0207704_100131844	314
408	3300025938	Ga0207704_10034234	Ga0207704_100342342	314
409	3300025938	Ga0207704_10049104	Ga0207704_100491042	314
410	3300025940	Ga0207691_10064437	Ga0207691_100644372	314
411	3300025941	Ga0207711_10008589	Ga0207711_100085896	314
412	3300025941	Ga0207711_10082349	Ga0207711_100823492	314
413	3300025941	Ga0207711_10131719	Ga0207711_101317192	314
414	3300025941	Ga0207711_10342632	Ga0207711_103426322	314
415	3300025941	Ga0207711_10532195	Ga0207711_105321951	314
416	3300025942	Ga0207689_10117004	Ga0207689_101170042	314
417	3300025944	Ga0207661_10033256	Ga0207661_100332562	314
418	3300025945	Ga0207679_10056608	Ga0207679_100566082	314
419	3300025945	Ga0207679_10075787	Ga0207679_100757872	314
420	3300025949	Ga0207667_10096292	Ga0207667_100962921	314
421	3300025960	Ga0207651_10118427	Ga0207651_101184272	314
422	3300025960	Ga0207651_10333256	Ga0207651_103332561	314
423	3300025961	Ga0207712_10168672	Ga0207712_101686722	314
424	3300025981	Ga0207640_10018780	Ga0207640_100187802	314
425	3300026023	Ga0207677_10014266	Ga0207677_100142663	314
426	3300026035	Ga0207703_10065616	Ga0207703_100656162	314
427	3300026035	Ga0207703_10134074	Ga0207703_101340743	314
428	3300026035	Ga0207703_10150503	Ga0207703_101505032	314
429	3300026041	Ga0207639_10151142	Ga0207639_101511422	314
430	3300026075	Ga0207708_10325506	Ga0207708_103255062	314
431	3300026088	Ga0207641_10007543	Ga0207641_100075438	314
432	3300026089	Ga0207648_10004126	Ga0207648_100041269	314
433	3300026089	Ga0207648_10094453	Ga0207648_100944532	314
434	3300026089	Ga0207648_10205624	Ga0207648_102056242	314
435	3300026089	Ga0207648_10250806	Ga0207648_102508062	314
436	3300026118	Ga0207675_100003439	Ga0207675_1000034398	314
437	3300026118	Ga0207675_100051381	Ga0207675_1000513812	314
438	3300026118	Ga0207675_100069785	Ga0207675_1000697853	314
439	3300026118	Ga0207675_100109370	Ga0207675_1001093703	314
440	3300026118	Ga0207675_100112704	Ga0207675_1001127042	314
441	3300026118	Ga0207675_100221260	Ga0207675_1002212602	314
442	3300026118	Ga0207675_100319011	Ga0207675_1003190111	314
443	3300026118	Ga0207675_100483862	Ga0207675_1004838622	314
444	3300026121	Ga0207683_10023780	Ga0207683_100237802	314
445	3300026121	Ga0207683_10120568	Ga0207683_101205683	314
446	3300026142	Ga0207698_10405266	Ga0207698_104052661	314
447	3300027907	Ga0207428_10008456	Ga0207428_100084565	314
448	3300027907	Ga0207428_10060838	Ga0207428_100608382	314
449	3300027907	Ga0207428_10083553	Ga0207428_100835532	314
450	3300028379	Ga0268266_10042800	Ga0268266_100428002	314
451	3300028379	Ga0268266_10159858	Ga0268266_101598582	314
452	3300028379	Ga0268266_10559422	Ga0268266_105594222	314
453	3300028380	Ga0268265_10015207	Ga0268265_100152072	314
454	3300028380	Ga0268265_10238029	Ga0268265_102380292	314
455	3300028380	Ga0268265_10273284	Ga0268265_102732841	314
456	3300028380	Ga0268265_10397308	Ga0268265_103973081	314
457	3300028381	Ga0268264_10011434	Ga0268264_100114347	314
458	3300031548	Ga0307408_100020577	Ga0307408_1000205775	314
459	3300031731	Ga0307405_10007416	Ga0307405_100074164	314
460	3300031824	Ga0307413_10014665	Ga0307413_100146652	314
461	3300031824	Ga0307413_10280097	Ga0307413_102800972	314
462	3300031852	Ga0307410_10004394	Ga0307410_100043946	314
463	3300031852	Ga0307410_10017547	Ga0307410_100175472	314
464	3300031852	Ga0307410_10033944	Ga0307410_100339442	314
465	3300031852	Ga0307410_10151866	Ga0307410_101518662	314
466	3300031901	Ga0307406_10046782	Ga0307406_100467822	314
467	3300031903	Ga0307407_10024858	Ga0307407_100248583	314
468	3300031911	Ga0307412_10032348	Ga0307412_100323483	314
469	3300031911	Ga0307412_10199320	Ga0307412_101993202	314
470	3300031995	Ga0307409_100007417	Ga0307409_1000074175	314
471	3300031995	Ga0307409_100015445	Ga0307409_1000154452	314
472	3300031995	Ga0307409_100024112	Ga0307409_1000241125	314
473	3300032002	Ga0307416_100035512	Ga0307416_1000355125	314
474	3300032002	Ga0307416_100082628	Ga0307416_1000826282	314
475	3300032002	Ga0307416_100095836	Ga0307416_1000958362	314
476	3300032002	Ga0307416_100099504	Ga0307416_1000995042	314
477	3300032004	Ga0307414_10013274	Ga0307414_100132743	314
478	3300032004	Ga0307414_10119012	Ga0307414_101190122	314
479	3300032005	Ga0307411_10004122	Ga0307411_100041223	314
480	3300032005	Ga0307411_10154621	Ga0307411_101546212	314
481	3300032126	Ga0307415_100004221	Ga0307415_1000042217	314
482	3300034816	Ga0373930_0003227	Ga0373930_0003227_443_1402	314
483	3300034817	Ga0373948_0001914	Ga0373948_0001914_424_1383	314
484	3300034818	Ga0373950_0002238	Ga0373950_0002238_532_1491	314
485	3300034957	Ga0373938_0000850	Ga0373938_0000850_1047_2006	314
486	3300035084	Ga0373928_0001702	Ga0373928_0001702_2253_3212	314
487	3300035085	Ga0373929_0001252	Ga0373929_0001252_3403_4362	314
488	3300035088	Ga0373940_0003861	Ga0373940_0003861_928_1887	314
489	3300035090	Ga0373949_0004047	Ga0373949_0004047_612_1571	314
490	3300035091	Ga0373951_0000861	Ga0373951_0000861_3507_4466	314
491	3300035092	Ga0373952_0000441	Ga0373952_0000441_5736_6695	314
492	3300035111	Ga0373923_0032795	Ga0373923_0032795_218_1195	314
493	3300035112	Ga0373932_0001914	Ga0373932_0001914_1207_2166	314
494	3300035114	Ga0373939_0000245	Ga0373939_0000245_6974_7933	314
495	3300035115	Ga0373941_0000417	Ga0373941_0000417_1234_2193	314
496	3300035170	Ga0373943_0001891	Ga0373943_0001891_1967_2944	314
497	3300035170	Ga0373943_0109996	Ga0373943_0109996_71_1033	314
498	3300035171	Ga0373946_0037735	Ga0373946_0037735_655_1632	314
499	3300035172	Ga0373955_0095298	Ga0373955_0095298_584_1546	314
500	3300035207	Ga0373942_0004901	Ga0373942_0004901_1883_2842	314
501	3300035241	Ga0373961_0010923	Ga0373961_0010923_472_1431	314
502	3300035410	Ga0373924_0060444	Ga0373924_0060444_225_1202	314
503	3300035410	Ga0373924_0083868	Ga0373924_0083868_324_1343	314
504	3300035691	Ga0373931_0016778	Ga0373931_0016778_1298_2257	314
505	3300035725	Ga0373947_0157058	Ga0373947_0157058_220_1197	314
506	3300037068	Ga0373925_0095030	Ga0373925_0095030_420_1517	314
507	3300042122	Ga0450920_022810	Ga0450920_022810_76_1035	314
508	3300042531	Ga0450918_016949	Ga0450918_016949_145_1104	314
509	3300042876	Ga0451577_0059930	Ga0451577_0059930_2076_3047	314
510	3300046455	Ga0495603_0054290	Ga0495603_0054290_986_1933	314
511	3300046459	Ga0495629_0004294	Ga0495629_0004294_7469_8416	314
512	3300046459	Ga0495629_0086961	Ga0495629_0086961_749_1846	314
513	3300046459	Ga0495629_0159753	Ga0495629_0159753_24_1043	314
514	3300046475	Ga0495639_0021307	Ga0495639_0021307_238_1203	314
515	3300046499	Ga0495594_0015094	Ga0495594_0015094_1708_2655	314
516	3300046511	Ga0495608_0125647	Ga0495608_0125647_288_1301	314
517	3300046529	Ga0495652_0260406	Ga0495652_0260406_116_1129	314
518	3300046535	Ga0495586_0078028	Ga0495586_0078028_224_1273	314
519	3300046642	Ga0495634_0047346	Ga0495634_0047346_300_1349	314
520	3300046663	Ga0495635_0109169	Ga0495635_0109169_680_1693	314
521	3300046664	Ga0495659_0073698	Ga0495659_0073698_21_980	314
522	3300046683	Ga0495658_0088613	Ga0495658_0088613_510_1607	314
523	3300046683	Ga0495658_0095515	Ga0495658_0095515_485_1453	314
524	3300047318	Ga0495636_0109390	Ga0495636_0109390_169_1116	314
525	3300047321	Ga0495676_0088242	Ga0495676_0088242_174_1121	314
526	3300047322	Ga0495680_0168644	Ga0495680_0168644_309_1322	314
527	3300047322	Ga0495680_0243260	Ga0495680_0243260_103_1065	314
528	3300048903	Ga0496100_0027682	Ga0496100_0027682_1224_2192	314
529	3300048904	Ga0496101_0001572	Ga0496101_0001572_9113_10081	314
530	3300048904	Ga0496101_0069030	Ga0496101_0069030_67_1029	314
531	3300048907	Ga0496104_0004524	Ga0496104_0004524_1963_2925	314
532	3300048907	Ga0496104_0128261	Ga0496104_0128261_1199_2230	314
533	3300048907	Ga0496104_0380816	Ga0496104_0380816_194_1153	314
534	3300048908	Ga0496105_0067725	Ga0496105_0067725_181_1140	314
535	3300048908	Ga0496105_0071239	Ga0496105_0071239_1266_2234	314
536	3300048908	Ga0496105_0237524	Ga0496105_0237524_437_1450	314
537	3300048909	Ga0496106_0096896	Ga0496106_0096896_318_1286	314
538	3300048909	Ga0496106_0120811	Ga0496106_0120811_257_1219	314
539	3300048910	Ga0496107_0024952	Ga0496107_0024952_143_1111	314
540	3300048911	Ga0496108_0009473	Ga0496108_0009473_3217_4176	314
541	3300048911	Ga0496108_0013709	Ga0496108_0013709_2411_3373	314
542	3300048911	Ga0496108_0069206	Ga0496108_0069206_859_1890	314
543	3300048912	Ga0496109_0097983	Ga0496109_0097983_986_2017	314
544	3300048912	Ga0496109_0167307	Ga0496109_0167307_103_1191	314
545	3300048913	Ga0496110_0052389	Ga0496110_0052389_2551_3513	314
546	3300048914	Ga0496111_0311154	Ga0496111_0311154_79_1110	314
547	3300048915	Ga0496112_0000420	Ga0496112_0000420_10973_12004	314
548	3300048915	Ga0496112_0001633	Ga0496112_0001633_3851_4810	314
549	3300048915	Ga0496112_0014861	Ga0496112_0014861_283_1269	314
550	3300048915	Ga0496112_0080510	Ga0496112_0080510_224_1207	314
551	3300048915	Ga0496112_0096301	Ga0496112_0096301_1177_2295	314
552	3300048916	Ga0496113_0003692	Ga0496113_0003692_5670_6629	314
553	3300048917	Ga0496114_0000310	Ga0496114_0000310_11864_12832	314
554	3300048917	Ga0496114_0001016	Ga0496114_0001016_8043_9005	314
555	3300048917	Ga0496114_0085262	Ga0496114_0085262_826_1788	314
556	3300048917	Ga0496114_0098972	Ga0496114_0098972_208_1281	314
557	3300049522	Ga0501299_002844	Ga0501299_002844_1272_2228	314
558	3300049575	Ga0501039_0016043	Ga0501039_0016043_2521_3483	314
559	3300049576	Ga0501040_0001813	Ga0501040_0001813_5467_6429	314
560	3300049577	Ga0501041_0002041	Ga0501041_0002041_166_1128	314
561	3300049577	Ga0501041_0081634	Ga0501041_0081634_838_1797	314
562	3300049578	Ga0501042_0007851	Ga0501042_0007851_866_1828	314
563	3300049579	Ga0501043_0059717	Ga0501043_0059717_1704_2690	314
564	3300049579	Ga0501043_0070090	Ga0501043_0070090_480_1442	314
565	3300049580	Ga0501046_0002936	Ga0501046_0002936_13437_14399	314
566	3300049581	Ga0501047_0009879	Ga0501047_0009879_7497_8483	314
567	3300049582	Ga0501048_0068817	Ga0501048_0068817_948_1910	314
568	3300049587	Ga0501071_0346862	Ga0501071_0346862_146_1108	314
569	3300049588	Ga0501072_0012388	Ga0501072_0012388_177_1139	314
570	3300049591	Ga0501075_0004045	Ga0501075_0004045_7464_8426	314
571	3300049591	Ga0501075_0078559	Ga0501075_0078559_840_1799	314
572	3300049592	Ga0501076_0081048	Ga0501076_0081048_214_1176	314
573	3300049592	Ga0501076_0114191	Ga0501076_0114191_969_1928	314
574	3300049741	Ga0501079_0009847	Ga0501079_0009847_2367_3329	314
575	3300049742	Ga0501080_0111872	Ga0501080_0111872_1527_2489	314
576	3300049743	Ga0501081_0002428	Ga0501081_0002428_3303_4265	314
577	3300049824	Ga0501045_0001051	Ga0501045_0001051_14657_15619	314
578	3300050507	nmdc:mga05p37_115170_c1	nmdc:mga05p37_115170_c1_581_1537	314
579	3300050507	nmdc:mga05p37_161033_c1	nmdc:mga05p37_161033_c1_1611_2558	314
580	3300050507	nmdc:mga05p37_21642_c1	nmdc:mga05p37_21642_c1_2045_3001	314
581	3300050507	nmdc:mga05p37_41843_c1	nmdc:mga05p37_41843_c1_3183_4163	314
582	3300050507	nmdc:mga05p37_51424_c1	nmdc:mga05p37_51424_c1_2383_3345	314
583	3300050507	nmdc:mga05p37_59416_c1	nmdc:mga05p37_59416_c1_96_1052	314
584	3300050507	nmdc:mga05p37_61701_c1	nmdc:mga05p37_61701_c1_2947_3903	314
585	3300050507	nmdc:mga05p37_84214_c1	nmdc:mga05p37_84214_c1_828_1802	314
586	3300050507	nmdc:mga05p37_9528_c1	nmdc:mga05p37_9528_c1_5818_6780	314
587	3300050510	nmdc:mga06r32_44481_c1	nmdc:mga06r32_44481_c1_367_1329	314
588	3300050510	nmdc:mga06r32_87390_c1	nmdc:mga06r32_87390_c1_1493_2467	314
589	3300050511	nmdc:mga08y16_156397_c1	nmdc:mga08y16_156397_c1_363_1385	314
590	3300050511	nmdc:mga08y16_335669_c1	nmdc:mga08y16_335669_c1_76_1032	314
591	3300050511	nmdc:mga08y16_5107_c1	nmdc:mga08y16_5107_c1_131_1105	314
592	3300050511	nmdc:mga08y16_524_c1	nmdc:mga08y16_524_c1_20871_21848	314
593	3300050512	nmdc:mga0n895_3475_c1	nmdc:mga0n895_3475_c1_10459_11433	314
594	3300050512	nmdc:mga0n895_36679_c1	nmdc:mga0n895_36679_c1_3644_4708	314
595	3300050512	nmdc:mga0n895_644453_c1	nmdc:mga0n895_644453_c1_23_979	314
596	3300050512	nmdc:mga0n895_6498_c1	nmdc:mga0n895_6498_c1_2975_3934	314
597	3300050512	nmdc:mga0n895_67_c1	nmdc:mga0n895_67_c1_37981_38940	314
598	3300050512	nmdc:mga0n895_9091_c1	nmdc:mga0n895_9091_c1_4231_5193	314
599	3300050513	nmdc:mga0rr50_25_c1	nmdc:mga0rr50_25_c1_95572_96531	314
600	3300050513	nmdc:mga0rr50_3136_c1	nmdc:mga0rr50_3136_c1_6106_7080	314
601	3300050513	nmdc:mga0rr50_46289_c1	nmdc:mga0rr50_46289_c1_489_1448	314
602	3300050513	nmdc:mga0rr50_73446_c1	nmdc:mga0rr50_73446_c1_749_1711	314
603	3300050513	nmdc:mga0rr50_96749_c1	nmdc:mga0rr50_96749_c1_148_1104	314
604	3300050514	nmdc:mga08x19_105262_c1	nmdc:mga08x19_105262_c1_585_1571	314
605	3300050514	nmdc:mga08x19_110624_c1	nmdc:mga08x19_110624_c1_240_1304	314
606	3300050514	nmdc:mga08x19_111318_c1	nmdc:mga08x19_111318_c1_477_1571	314
607	3300050514	nmdc:mga08x19_213_c1	nmdc:mga08x19_213_c1_17253_18212	314
608	3300050514	nmdc:mga08x19_3059_c1	nmdc:mga08x19_3059_c1_1530_2504	314
609	3300050515	nmdc:mga0a205_116755_c1	nmdc:mga0a205_116755_c1_1421_2377	314
610	3300050515	nmdc:mga0a205_256041_c1	nmdc:mga0a205_256041_c1_134_1090	314
611	3300050515	nmdc:mga0a205_276734_c1	nmdc:mga0a205_276734_c1_478_1470	314
612	3300050515	nmdc:mga0a205_67689_c1	nmdc:mga0a205_67689_c1_1990_2964	314
613	3300050515	nmdc:mga0a205_8756_c1	nmdc:mga0a205_8756_c1_7980_8936	314
614	3300053077	Ga0495601_0043705	Ga0495601_0043705_1437_2399	314
615	3300053077	Ga0495601_0183450	Ga0495601_0183450_315_1328	314
616	3300053085	Ga0495619_0026085	Ga0495619_0026085_1968_2930	314
617	3300054114	Ga0501084_0001248	Ga0501084_0001248_15227_16189	314
618	3300059421	Ga0590071_000060	Ga0590071_000060_15412_16368	314
619	3300059424	Ga0590075_000598	Ga0590075_000598_5072_6028	314
620	3300059424	Ga0590075_000898	Ga0590075_000898_2637_3593	314
621	3300059426	Ga0590077_000569	Ga0590077_000569_8339_9295	314
622	3300059426	Ga0590077_002267	Ga0590077_002267_1106_2062	314
623	3300059426	Ga0590077_027636	Ga0590077_027636_149_1105	314
624	3300060353	Ga0501082_0000929	Ga0501082_0000929_15792_16754	314
625	3300061734	Ga0530510_0007416	Ga0530510_0007416_1067_2029	314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02562

PhoH

PhoH-like protein

105

309

0.99 PF13245

AAA_19

AAA domain

113

267

0.84 PF13604

AAA_30

AAA domain

109

317

0.8 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3b85-assembly1.cif.gz_B	crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum	0.9433	106	308
3b85-assembly1.cif.gz_A	crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum	0.931	106	308
3b85-assembly1.cif.gz_B	crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum	0.9286	106	308
3b85-assembly1.cif.gz_A	crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum	0.9164	106	308
6y2d-assembly1.cif.gz_A	crystal structure of the second kh domain of fubp1	0.8217	2	59

ID	Description	Score	Start	End	Superfamily
af_Q2FY01_105_312_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9598	104	308	3.40.50.300
af_Q2FY01_105_312_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9418	104	308	3.40.50.300
3b85B00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9383	106	308	3.40.50.300
af_P0A9K1_146_354_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.929	104	308	3.40.50.300
3b85B00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9232	106	308	3.40.50.300

ID	Description	Score	Start	End	GO Terms
AF-A0A3S5JYU4-F1-model_v4	PhoH-like protein	0.9886	186	313	GO:0005524 GO:0005829
AF-A0A7W1SZF0-F1-model_v4	PhoH-like protein	0.9885	195	313	GO:0005524 GO:0005829
AF-A0A7W1G000-F1-model_v4	PhoH-like protein	0.9882	218	310	GO:0005524 GO:0005829
AF-A0A6I1VZW7-F1-model_v4	PhoH-like protein	0.9839	182	302	GO:0005524 GO:0005829
AF-A0A356U6Y2-F1-model_v4	PhoH-like protein	0.9813	209	313	GO:0005524 GO:0005829

Feature Viewer

pLDDT	pTM	Quality
82.47	0.7	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F470340

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02562

PhoH

PhoH-like protein

105

309

0.99

PF13245

AAA_19

AAA domain

113

267

0.84

PF13604

AAA_30

AAA domain

109

317

0.8

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map