metagRoot

F470355

General Info

Members	Datasets	Scaffolds	Average Seq Length
625	251	620	326

Family's Representative Sequence

Representative Sequence	3300009147\|Ga0114129_10685675\|Ga0114129_106856751
Length	379
Sequence	MLHQRKKALVNQAPSTHDPKRALAGLKSRSAAVSCVSRRAILLVASTWEDCAVKRREFITLLGGATAWPLAARAQQGERVRRIGVLMYLPADDPEGQARIAAFLQALQQLGWSDGRNLQIDTRWATASDIRKHASELVALAPDVLVAGTGTASVAPLLDETRTVPIVFVTVTDPVGAGFVTSLAQPGGNATGFTIFEYGMSGKWLELLREIAPRVTRAAVLRDPAVASGIGQFGAIQAVAPSLGVELGPVDVRHAGEIERAITAFARGPNGGLIVTATALAFVHQDLIISLASRHRLPAVFWNRRFIPHGGLISYGPDTIDPFRLAAGYVDRILKGEKPANLPVQHPTKFELLINLKTAKTLGLDVPATLLARADEVIE

Samples

	Sample ID	Description	Type	Environment
1	2209111006	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1	Metagenome	Rhizosphere
2	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
3	3300000042	Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young	Metagenome	Rhizosphere
4	3300000043	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere	Metagenome	Rhizosphere
5	3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old	Metagenome	Rhizosphere
6	3300000652	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA	Metagenome	Rhizosphere
7	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
8	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
9	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
10	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
11	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
12	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
13	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
14	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
15	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
16	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
17	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
18	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
19	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
20	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
21	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
22	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
23	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
24	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
25	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
26	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
27	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
28	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
29	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
30	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
31	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
32	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
33	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
34	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
35	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
36	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
37	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
38	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
39	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
40	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
41	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
42	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
43	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
44	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
45	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
46	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
47	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
48	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
49	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
50	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
51	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
52	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
53	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
54	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
55	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
56	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
57	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
58	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
59	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
60	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
61	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
62	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
63	3300006194	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Metagenome	Rhizosphere
64	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
65	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
66	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
67	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
68	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
69	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
70	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
71	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
72	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
73	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
74	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
76	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
77	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
79	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
80	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
82	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
83	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
84	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
85	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
86	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
87	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
88	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
89	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
90	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
91	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
92	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
93	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
94	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
95	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
96	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
97	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
98	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
99	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
142	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
146	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
147	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
148	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
149	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
150	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
151	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
152	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
153	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
154	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
155	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
156	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
157	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
158	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
159	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
160	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
161	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
162	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
163	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
164	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
165	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
166	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
167	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
168	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
169	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
170	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
171	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
172	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
173	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
174	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
175	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
176	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
177	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
178	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
179	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
180	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
181	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
182	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
183	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
184	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
185	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
186	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
187	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
188	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
189	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
190	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
191	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
192	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
193	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
194	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
195	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
196	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
197	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
198	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
199	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
200	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
201	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
202	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
203	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
204	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
205	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
206	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
207	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
208	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
209	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
210	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
211	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
212	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
213	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
214	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
215	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
216	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
217	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
218	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
219	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
220	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
221	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
222	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
223	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
224	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
225	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
226	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
227	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
228	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
229	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
230	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
231	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
232	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
233	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
234	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
235	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
236	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
237	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
238	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
239	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
240	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
241	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
242	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
243	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
244	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
245	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
246	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
247	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
248	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
249	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
250	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
251	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.84
Metatranscriptomes	0
Isolates	0.16

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.76
Nodule	0
Rhizoplane	14.72
Rhizosphere	83.36
Stem	0
Stem Tuber	0
Unclassified	0.16

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	2214736892	2209111006	Bacteria	4025
2	ARSoilYngRDRAFT_c00585	3300000042	Bacteria	3911
3	ARcpr5yngRDRAFT_c000599	3300000043	Bacteria	4527
4	ARSoilOldRDRAFT_c000515	3300000044	Bacteria	4336
5	ARSoilOldRDRAFT_c001342	3300000044	Unclassified	2299
6	ARCol0yngRDRAFT_1000486	3300000652	Bacteria	4724
7	JGI25404J52841_10000174	3300003659	Bacteria	7374
8	JGI25405J52794_10007189	3300003911	Bacteria	2049
9	Ga0065715_10000317	3300005293	Bacteria	15993
10	Ga0070683_100431342	3300005329	Unclassified	1257
11	Ga0070690_100004460	3300005330	Bacteria	7777
12	Ga0070690_100021058	3300005330	Bacteria	3978
13	Ga0070690_100104225	3300005330	Bacteria	1884
14	Ga0070670_100017162	3300005331	Bacteria	6210
15	Ga0070670_100148752	3300005331	Bacteria	2026
16	Ga0070666_10026208	3300005335	Bacteria	3806
17	Ga0070666_10189245	3300005335	Bacteria	1446
18	Ga0068868_100028588	3300005338	Bacteria	4264
19	Ga0070660_100232208	3300005339	Unclassified	1501
20	Ga0070660_100292690	3300005339	Unclassified	1334
21	Ga0070689_100002134	3300005340	Bacteria	12846
22	Ga0070689_100036583	3300005340	Bacteria	3755
23	Ga0070689_100052338	3300005340	Unclassified	3158
24	Ga0070692_10217365	3300005345	Unclassified	1128
25	Ga0070669_100084139	3300005353	Bacteria	2373
26	Ga0070671_100010441	3300005355	Bacteria	7450
27	Ga0070671_100267093	3300005355	Bacteria	1454
28	Ga0070674_100037336	3300005356	Bacteria	3267
29	Ga0070674_100083782	3300005356	Bacteria	2285
30	Ga0070673_100190347	3300005364	Bacteria	1762
31	Ga0070688_100042922	3300005365	Bacteria	2784
32	Ga0070688_100275625	3300005365	Bacteria	1206
33	Ga0070667_100047003	3300005367	Unclassified	3631
34	Ga0070667_100110501	3300005367	Unclassified	2383
35	Ga0070709_10005532	3300005434	Bacteria	6840
36	Ga0070709_10047694	3300005434	Bacteria	2669
37	Ga0070709_10145423	3300005434	Bacteria	1633
38	Ga0070709_10266473	3300005434	Unclassified	1240
39	Ga0070714_100165416	3300005435	Bacteria	2004
40	Ga0070714_100179018	3300005435	Bacteria	1928
41	Ga0070713_100005026	3300005436	Bacteria	8988
42	Ga0070713_100022621	3300005436	Bacteria	4860
43	Ga0070713_100054599	3300005436	Unclassified	3315
44	Ga0070713_100070626	3300005436	Unclassified	2948
45	Ga0070713_100140960	3300005436	Bacteria	2135
46	Ga0070710_10001919	3300005437	Bacteria	9846
47	Ga0070710_10004346	3300005437	Bacteria	6712
48	Ga0070711_100031866	3300005439	Bacteria	3502
49	Ga0070711_100090099	3300005439	Bacteria	2208
50	Ga0070711_100176960	3300005439	Bacteria	1630
51	Ga0070711_100254315	3300005439	Bacteria	1379
52	Ga0070711_100313705	3300005439	Bacteria	1250
53	Ga0070708_100010931	3300005445	Bacteria	7375
54	Ga0070708_100039455	3300005445	Bacteria	4131
55	Ga0070663_100020275	3300005455	Bacteria	4399
56	Ga0070663_100049417	3300005455	Unclassified	2986
57	Ga0070663_100319313	3300005455	Bacteria	1248
58	Ga0070663_100358187	3300005455	Unclassified	1183
59	Ga0070678_100004147	3300005456	Bacteria	8166
60	Ga0070678_100011241	3300005456	Bacteria	5513
61	Ga0070678_100350414	3300005456	Bacteria	1269
62	Ga0070662_100068208	3300005457	Bacteria	2614
63	Ga0070685_10006301	3300005466	Viruses	6046
64	Ga0070685_10102669	3300005466	Bacteria	1748
65	Ga0070706_100092852	3300005467	Bacteria	2800
66	Ga0070706_100120917	3300005467	Bacteria	2441
67	Ga0070706_100142498	3300005467	Bacteria	2237
68	Ga0070706_100191488	3300005467	Unclassified	1911
69	Ga0070707_100030908	3300005468	Bacteria	5100
70	Ga0070707_100180906	3300005468	Bacteria	2055
71	Ga0070698_100034201	3300005471	Bacteria	5264
72	Ga0070698_100050289	3300005471	Bacteria	4250
73	Ga0070698_100073704	3300005471	Bacteria	3420
74	Ga0070698_100152555	3300005471	Bacteria	2257
75	Ga0070698_100259373	3300005471	Bacteria	1670
76	Ga0070698_100291002	3300005471	Bacteria	1564
77	Ga0070698_100336713	3300005471	Bacteria	1440
78	Ga0070699_100021594	3300005518	Bacteria	5551
79	Ga0070699_100128895	3300005518	Unclassified	2229
80	Ga0070699_100248307	3300005518	Bacteria	1589
81	Ga0070684_100134837	3300005535	Bacteria	2229
82	Ga0070697_100022017	3300005536	Bacteria	5057
83	Ga0070697_100039481	3300005536	Bacteria	3816
84	Ga0070697_100087885	3300005536	Bacteria	2566
85	Ga0070697_100165906	3300005536	Bacteria	1867
86	Ga0070697_100278557	3300005536	Bacteria	1434
87	Ga0068853_100116500	3300005539	Bacteria	2379
88	Ga0068853_100356872	3300005539	Unclassified	1361
89	Ga0070686_100007929	3300005544	Bacteria	5936
90	Ga0070686_100140533	3300005544	Bacteria	1680
91	Ga0070695_100025782	3300005545	Bacteria	3632
92	Ga0070695_100170314	3300005545	Unclassified	1536
93	Ga0070665_100130113	3300005548	Bacteria	2519
94	Ga0070665_100131273	3300005548	Unclassified	2507
95	Ga0070665_100482988	3300005548	Bacteria	1250
96	Ga0070664_100041822	3300005564	Unclassified	3868
97	Ga0070664_100256842	3300005564	Bacteria	1571
98	Ga0068856_100147934	3300005614	Unclassified	2357
99	Ga0070702_100071900	3300005615	Bacteria	2046
100	Ga0068859_100482966	3300005617	Bacteria	1334
101	Ga0068864_100007135	3300005618	Bacteria	9179
102	Ga0068864_100040471	3300005618	Unclassified	3987
103	Ga0068863_100080065	3300005841	Unclassified	3094
104	Ga0068863_100169547	3300005841	Unclassified	2093
105	Ga0068863_100316311	3300005841	Bacteria	1516
106	Ga0068858_100011560	3300005842	Bacteria	8328
107	Ga0068858_100228028	3300005842	Bacteria	1765
108	Ga0068860_100075517	3300005843	Bacteria	3205
109	Ga0068860_100282972	3300005843	Bacteria	1621
110	Ga0068862_100042405	3300005844	Bacteria	3876
111	Ga0068862_100419469	3300005844	Bacteria	1255
112	Ga0081455_10010473	3300005937	Bacteria	9404
113	Ga0081455_10011829	3300005937	Bacteria	8737
114	Ga0081455_10013667	3300005937	Bacteria	7997
115	Ga0081455_10017478	3300005937	Bacteria	6872
116	Ga0081455_10019106	3300005937	Bacteria	6495
117	Ga0081455_10019274	3300005937	Bacteria	6459
118	Ga0081455_10025087	3300005937	Bacteria	5509
119	Ga0081455_10028248	3300005937	Bacteria	5127
120	Ga0081455_10034591	3300005937	Bacteria	4526
121	Ga0081455_10040532	3300005937	Bacteria	4105
122	Ga0081455_10056887	3300005937	Bacteria	3318
123	Ga0081455_10279096	3300005937	Bacteria	1208
124	Ga0081540_1002393	3300005983	Bacteria	15301
125	Ga0081540_1016916	3300005983	Bacteria	4540
126	Ga0081540_1034037	3300005983	Bacteria	2756
127	Ga0081540_1038943	3300005983	Unclassified	2498
128	Ga0081540_1045403	3300005983	Bacteria	2232
129	Ga0081540_1102090	3300005983	Bacteria	1233
130	Ga0081539_10015294	3300005985	Bacteria	5587
131	Ga0070717_10005760	3300006028	Bacteria	9073
132	Ga0070717_10016433	3300006028	Bacteria	5737
133	Ga0070717_10020508	3300006028	Bacteria	5200
134	Ga0070717_10031714	3300006028	Bacteria	4254
135	Ga0070717_10057127	3300006028	Bacteria	3225
136	Ga0070717_10065932	3300006028	Bacteria	3010
137	Ga0070717_10336300	3300006028	Unclassified	1347
138	Ga0070717_10504312	3300006028	Bacteria	1094
139	Ga0075365_10052956	3300006038	Bacteria	2686
140	Ga0075365_10108852	3300006038	Bacteria	1903
141	Ga0075365_10173460	3300006038	Bacteria	1506
142	Ga0075365_10276659	3300006038	Bacteria	1181
143	Ga0075364_10327711	3300006051	Bacteria	1043
144	Ga0070715_10003812	3300006163	Unclassified	4865
145	Ga0070716_100001955	3300006173	Bacteria	9364
146	Ga0070716_100002302	3300006173	Bacteria	8796
147	Ga0070712_100060488	3300006175	Bacteria	2671
148	Ga0070712_100086146	3300006175	Bacteria	2289
149	Ga0070712_100093053	3300006175	Bacteria	2212
150	Ga0075367_10062119	3300006178	Bacteria	2230
151	Ga0075427_10000053	3300006194	Bacteria	8702
152	Ga0097621_100084126	3300006237	Bacteria	2652
153	Ga0097621_100389961	3300006237	Bacteria	1245
154	Ga0068871_100003994	3300006358	Bacteria	10204
155	Ga0075428_100007352	3300006844	Bacteria	12206
156	Ga0075428_100011982	3300006844	Bacteria	9645
157	Ga0075428_100102690	3300006844	Bacteria	3118
158	Ga0075428_100168764	3300006844	Bacteria	2373
159	Ga0075428_100338185	3300006844	Bacteria	1617
160	Ga0075428_100359177	3300006844	Bacteria	1563
161	Ga0075428_100453943	3300006844	Bacteria	1373
162	Ga0075430_100005909	3300006846	Bacteria	10336
163	Ga0075430_100012987	3300006846	Bacteria	7098
164	Ga0075430_100244535	3300006846	Bacteria	1487
165	Ga0075431_100009243	3300006847	Bacteria	9894
166	Ga0075431_100015602	3300006847	Bacteria	7700
167	Ga0075431_100015893	3300006847	Bacteria	7633
168	Ga0075431_100184910	3300006847	Bacteria	2137
169	Ga0075431_100268475	3300006847	Bacteria	1730
170	Ga0075431_100599183	3300006847	Bacteria	1086
171	Ga0075433_10000879	3300006852	Bacteria	21113
172	Ga0075433_10004805	3300006852	Bacteria	10546
173	Ga0075434_100001712	3300006871	Bacteria	18787
174	Ga0075434_100004256	3300006871	Bacteria	12832
175	Ga0075434_100018135	3300006871	Bacteria	6793
176	Ga0075434_100036112	3300006871	Bacteria	4887
177	Ga0075434_100202456	3300006871	Unclassified	2005
178	Ga0075434_100221821	3300006871	Bacteria	1910
179	Ga0075434_100264425	3300006871	Bacteria	1739
180	Ga0075434_100398974	3300006871	Bacteria	1396
181	Ga0075434_100537515	3300006871	Unclassified	1189
182	Ga0075429_100004087	3300006880	Bacteria	12510
183	Ga0075429_100005992	3300006880	Bacteria	10508
184	Ga0075429_100252791	3300006880	Bacteria	1543
185	Ga0068865_100038087	3300006881	Unclassified	3252
186	Ga0068865_100069889	3300006881	Bacteria	2486
187	Ga0068865_100241070	3300006881	Bacteria	1423
188	Ga0068865_100291455	3300006881	Bacteria	1303
189	Ga0075436_100236166	3300006914	Bacteria	1299
190	Ga0075436_100284092	3300006914	Bacteria	1183
191	Ga0097620_100482983	3300006931	Bacteria	1334
192	Ga0075435_100016835	3300007076	Bacteria	5519
193	Ga0075435_100020675	3300007076	Bacteria	5050
194	Ga0075435_100041758	3300007076	Bacteria	3667
195	Ga0075435_100061588	3300007076	Unclassified	3044
196	Ga0075435_100281585	3300007076	Bacteria	1419
197	Ga0105251_10017633	3300009011	Bacteria	3820
198	Ga0111539_10002079	3300009094	Bacteria	26752
199	Ga0111539_10013519	3300009094	Bacteria	10201
200	Ga0111539_10251706	3300009094	Bacteria	2057
201	Ga0111539_10356004	3300009094	Bacteria	1703
202	Ga0111539_10388185	3300009094	Unclassified	1626
203	Ga0111539_10591681	3300009094	Unclassified	1292
204	Ga0105245_10038674	3300009098	Bacteria	4245
205	Ga0105245_10294837	3300009098	Unclassified	1589
206	Ga0105245_10446763	3300009098	Bacteria	1300
207	Ga0105247_10086091	3300009101	Bacteria	1988
208	Ga0114129_10011079	3300009147	Bacteria	12846
209	Ga0114129_10011621	3300009147	Bacteria	12534
210	Ga0114129_10070580	3300009147	Bacteria	4871
211	Ga0114129_10076437	3300009147	Unclassified	4662
212	Ga0114129_10150379	3300009147	Bacteria	3186
213	Ga0114129_10206547	3300009147	Bacteria	2657
214	Ga0114129_10226998	3300009147	Bacteria	2516
215	Ga0114129_10457409	3300009147	Unclassified	1673
216	Ga0114129_10580204	3300009147	Unclassified	1455
217	Ga0114129_10648010	3300009147	Bacteria	1364
218	Ga0114129_10685675	3300009147	Bacteria	1318
219	Ga0114129_10892791	3300009147	Bacteria	1127
220	Ga0105243_10179285	3300009148	Bacteria	1841
221	Ga0105243_10278178	3300009148	Bacteria	1506
222	Ga0105241_10057605	3300009174	Bacteria	2981
223	Ga0105242_10022663	3300009176	Unclassified	4943
224	Ga0105242_10118919	3300009176	Bacteria	2264
225	Ga0105248_10122329	3300009177	Bacteria	2935
226	Ga0105248_10275092	3300009177	Bacteria	1896
227	Ga0105248_10878710	3300009177	Unclassified	1012
228	Ga0105237_10158564	3300009545	Bacteria	2260
229	Ga0105238_10260570	3300009551	Bacteria	1713
230	Ga0105249_10132766	3300009553	Bacteria	2379
231	Ga0105239_10031779	3300010375	Bacteria	5801
232	Ga0105239_10314611	3300010375	Bacteria	1765
233	Ga0105246_10046733	3300011119	Bacteria	2954
234	Ga0105246_10069678	3300011119	Bacteria	2471
235	Ga0105246_10099523	3300011119	Unclassified	2114
236	Ga0157374_10177969	3300013296	Bacteria	2076
237	Ga0157378_10022385	3300013297	Viruses	5564
238	Ga0157378_10029323	3300013297	Bacteria	4857
239	Ga0163162_10045915	3300013306	Bacteria	4378
240	Ga0163162_10114517	3300013306	Bacteria	2796
241	Ga0157375_10100567	3300013308	Bacteria	2972
242	Ga0157375_10209975	3300013308	Bacteria	2104
243	Ga0157375_10303960	3300013308	Bacteria	1759
244	Ga0157375_10379893	3300013308	Bacteria	1579
245	Ga0157375_10573139	3300013308	Bacteria	1289
246	Ga0163163_10214873	3300014325	Bacteria	1972
247	Ga0163163_10637049	3300014325	Bacteria	1129
248	Ga0157380_10128867	3300014326	Bacteria	2155
249	Ga0157379_10059576	3300014968	Unclassified	3413
250	Ga0157379_10316296	3300014968	Bacteria	1425
251	Ga0157376_10026942	3300014969	Unclassified	4549
252	Ga0157376_10285858	3300014969	Bacteria	1555
253	Ga0163161_10397056	3300017792	Bacteria	1105
254	Ga0207692_10037078	3300025898	Bacteria	2382
255	Ga0207692_10040897	3300025898	Unclassified	2291
256	Ga0207692_10047688	3300025898	Unclassified	2152
257	Ga0207692_10061667	3300025898	Bacteria	1944
258	Ga0207710_10001666	3300025900	Bacteria	10815
259	Ga0207710_10009742	3300025900	Unclassified	4037
260	Ga0207688_10206748	3300025901	Bacteria	1178
261	Ga0207680_10194626	3300025903	Bacteria	1378
262	Ga0207685_10000852	3300025905	Bacteria	5726
263	Ga0207685_10002496	3300025905	Unclassified	4234
264	Ga0207699_10002726	3300025906	Bacteria	8354
265	Ga0207699_10177242	3300025906	Unclassified	1430
266	Ga0207645_10186056	3300025907	Bacteria	1364
267	Ga0207684_10027535	3300025910	Bacteria	4841
268	Ga0207684_10153432	3300025910	Bacteria	1982
269	Ga0207684_10218853	3300025910	Bacteria	1643
270	Ga0207671_10213828	3300025914	Unclassified	1509
271	Ga0207671_10317151	3300025914	Bacteria	1233
272	Ga0207693_10002257	3300025915	Bacteria	16770
273	Ga0207693_10032126	3300025915	Unclassified	4144
274	Ga0207693_10185574	3300025915	Bacteria	1637
275	Ga0207693_10264121	3300025915	Bacteria	1349
276	Ga0207693_10374464	3300025915	Unclassified	1114
277	Ga0207663_10004484	3300025916	Bacteria	6951
278	Ga0207663_10014341	3300025916	Bacteria	4334
279	Ga0207663_10055274	3300025916	Bacteria	2490
280	Ga0207663_10117746	3300025916	Unclassified	1813
281	Ga0207663_10179725	3300025916	Bacteria	1510
282	Ga0207662_10006431	3300025918	Bacteria	6340
283	Ga0207657_10046753	3300025919	Bacteria	3789
284	Ga0207657_10056643	3300025919	Unclassified	3381
285	Ga0207646_10016790	3300025922	Bacteria	6866
286	Ga0207646_10184523	3300025922	Bacteria	1884
287	Ga0207694_10068834	3300025924	Unclassified	2765
288	Ga0207650_10016493	3300025925	Bacteria	5165
289	Ga0207687_10012674	3300025927	Bacteria	5509
290	Ga0207700_10008320	3300025928	Bacteria	6415
291	Ga0207700_10011281	3300025928	Bacteria	5692
292	Ga0207700_10013270	3300025928	Bacteria	5353
293	Ga0207700_10161130	3300025928	Unclassified	1863
294	Ga0207664_10018639	3300025929	Bacteria	5114
295	Ga0207664_10058800	3300025929	Bacteria	3060
296	Ga0207664_10158582	3300025929	Bacteria	1928
297	Ga0207664_10460446	3300025929	Bacteria	1136
298	Ga0207664_10473624	3300025929	Bacteria	1120
299	Ga0207644_10015564	3300025931	Bacteria	5108
300	Ga0207644_10290867	3300025931	Bacteria	1314
301	Ga0207706_10015802	3300025933	Bacteria	6824
302	Ga0207706_10186789	3300025933	Bacteria	1820
303	Ga0207706_10257028	3300025933	Bacteria	1525
304	Ga0207686_10021084	3300025934	Bacteria	3733
305	Ga0207709_10172809	3300025935	Bacteria	1518
306	Ga0207670_10035697	3300025936	Unclassified	3226
307	Ga0207669_10194793	3300025937	Bacteria	1465
308	Ga0207704_10077981	3300025938	Unclassified	2129
309	Ga0207665_10004581	3300025939	Bacteria	9177
310	Ga0207665_10004818	3300025939	Bacteria	8981
311	Ga0207691_10025273	3300025940	Bacteria	5577
312	Ga0207691_10169455	3300025940	Bacteria	1913
313	Ga0207691_10477277	3300025940	Unclassified	1060
314	Ga0207711_10019178	3300025941	Bacteria	5694
315	Ga0207711_10247275	3300025941	Unclassified	1637
316	Ga0207711_10403155	3300025941	Bacteria	1271
317	Ga0207689_10118051	3300025942	Bacteria	2181
318	Ga0207689_10416523	3300025942	Bacteria	1121
319	Ga0207679_10051394	3300025945	Bacteria	3017
320	Ga0207679_10395078	3300025945	Bacteria	1215
321	Ga0207712_10262170	3300025961	Bacteria	1402
322	Ga0207677_10029000	3300026023	Unclassified	3510
323	Ga0207677_10454620	3300026023	Bacteria	1098
324	Ga0207703_10018327	3300026035	Bacteria	5467
325	Ga0207678_10029079	3300026067	Unclassified	4823
326	Ga0207678_10163473	3300026067	Bacteria	1901
327	Ga0207678_10371685	3300026067	Unclassified	1235
328	Ga0207708_10052449	3300026075	Unclassified	3107
329	Ga0207708_10361068	3300026075	Bacteria	1194
330	Ga0207641_10171509	3300026088	Bacteria	1981
331	Ga0207641_10455896	3300026088	Bacteria	1236
332	Ga0207641_10484973	3300026088	Unclassified	1198
333	Ga0207648_10091884	3300026089	Bacteria	2653
334	Ga0207676_10039914	3300026095	Unclassified	3594
335	Ga0207676_10294872	3300026095	Bacteria	1478
336	Ga0207675_100058268	3300026118	Bacteria	3605
337	Ga0207675_100308945	3300026118	Unclassified	1542
338	Ga0207675_100398689	3300026118	Bacteria	1356
339	Ga0207683_10006413	3300026121	Bacteria	10074
340	Ga0207683_10009778	3300026121	Bacteria	8174
341	Ga0207683_10422244	3300026121	Bacteria	1228
342	Ga0207683_10522030	3300026121	Unclassified	1097
343	Ga0209588_1039745	3300027671	Bacteria	1517
344	Ga0207428_10000188	3300027907	Bacteria	85820
345	Ga0207428_10000272	3300027907	Bacteria	69872
346	Ga0207428_10007370	3300027907	Bacteria	10036
347	Ga0268266_10005275	3300028379	Bacteria	12134
348	Ga0268265_10020129	3300028380	Bacteria	4653
349	Ga0268265_10261556	3300028380	Bacteria	1539
350	Ga0268264_10123366	3300028381	Bacteria	2286
351	Ga0268264_10160086	3300028381	Unclassified	2027
352	Ga0268264_10394612	3300028381	Unclassified	1328
353	Ga0373938_0004964	3300034957	Bacteria	2243
354	Ga0373926_0028368	3300035083	Unclassified	1964
355	Ga0373926_0072714	3300035083	Bacteria	1265
356	Ga0373928_0000134	3300035084	Bacteria	14013
357	Ga0373929_0011840	3300035085	Unclassified	1649
358	Ga0373940_0010416	3300035088	Bacteria	2184
359	Ga0373944_0062840	3300035089	Bacteria	1194
360	Ga0373944_0067247	3300035089	Bacteria	1161
361	Ga0373949_0006133	3300035090	Bacteria	2657
362	Ga0373951_0005808	3300035091	Bacteria	2851
363	Ga0373952_0000475	3300035092	Bacteria	6981
364	Ga0373932_0007269	3300035112	Bacteria	2634
365	Ga0373936_0032079	3300035113	Bacteria	2077
366	Ga0373939_0014082	3300035114	Unclassified	2069
367	Ga0373939_0035452	3300035114	Unclassified	1470
368	Ga0373941_0075418	3300035115	Unclassified	1128
369	Ga0373945_0004241	3300035116	Bacteria	4544
370	Ga0373956_0019208	3300035119	Bacteria	2898
371	Ga0373960_0055822	3300035121	Bacteria	1185
372	Ga0373943_0010356	3300035170	Unclassified	4182
373	Ga0373943_0087770	3300035170	Unclassified	1606
374	Ga0373943_0105042	3300035170	Bacteria	1482
375	Ga0373942_0001883	3300035207	Bacteria	5269
376	Ga0373961_0006229	3300035241	Bacteria	2868
377	Ga0373962_0001989	3300035242	Bacteria	4876
378	Ga0373931_0001007	3300035691	Bacteria	11924
379	Ga0373931_0032529	3300035691	Unclassified	2699
380	Ga0373931_0077942	3300035691	Bacteria	1822
381	Ga0373935_0279702	3300035692	Bacteria	1175
382	Ga0373927_0016199	3300035695	Bacteria	4919
383	Ga0373927_0080382	3300035695	Bacteria	2112
384	Ga0373927_0239819	3300035695	Bacteria	1191
385	Ga0373947_0001106	3300035725	Bacteria	16547
386	Ga0373947_0032003	3300035725	Bacteria	3098
387	Ga0373947_0081459	3300035725	Bacteria	2004
388	Ga0373947_0105397	3300035725	Bacteria	1776
389	Ga0373947_0145522	3300035725	Bacteria	1523
390	Ga0373937_0110611	3300036401	Unclassified	2555
391	Ga0373925_0015785	3300037068	Bacteria	5465
392	Ga0373925_0083380	3300037068	Bacteria	2434
393	Ga0373925_0268084	3300037068	Bacteria	1373
394	Ga0373925_0290848	3300037068	Bacteria	1317
395	Ga0395898_0354027	3300037466	Bacteria	1400
396	Ga0395901_0210187	3300038443	Bacteria	2037
397	Ga0451577_0338306	3300042876	Unclassified	1365
398	Ga0451576_0011582	3300045051	Bacteria	10001
399	Ga0451576_0130723	3300045051	Bacteria	2617
400	Ga0495592_0106620	3300046454	Unclassified	1988
401	Ga0495603_0013986	3300046455	Bacteria	4853
402	Ga0495603_0016481	3300046455	Bacteria	4471
403	Ga0495603_0112633	3300046455	Bacteria	1586
404	Ga0495603_0132097	3300046455	Bacteria	1453
405	Ga0495629_0002073	3300046459	Bacteria	15547
406	Ga0495629_0016703	3300046459	Bacteria	5267
407	Ga0495629_0088235	3300046459	Unclassified	2163
408	Ga0495629_0090419	3300046459	Bacteria	2136
409	Ga0495629_0166739	3300046459	Bacteria	1529
410	Ga0495629_0320810	3300046459	Unclassified	1059
411	Ga0495641_0042544	3300046461	Bacteria	2104
412	Ga0495641_0114709	3300046461	Bacteria	1202
413	Ga0495651_0033326	3300046462	Bacteria	4018
414	Ga0495653_0011366	3300046463	Bacteria	7273
415	Ga0495580_0026902	3300046472	Unclassified	4189
416	Ga0495580_0274053	3300046472	Bacteria	1152
417	Ga0495582_0015979	3300046473	Bacteria	4115
418	Ga0495582_0072769	3300046473	Bacteria	1902
419	Ga0495582_0178594	3300046473	Bacteria	1209
420	Ga0495639_0013332	3300046475	Bacteria	3548
421	Ga0495662_0011530	3300046476	Bacteria	4319
422	Ga0495662_0101766	3300046476	Bacteria	1405
423	Ga0495664_0040685	3300046477	Unclassified	2749
424	Ga0495585_0048211	3300046492	Bacteria	2369
425	Ga0495594_0057076	3300046499	Bacteria	2156
426	Ga0495594_0072902	3300046499	Unclassified	1910
427	Ga0495607_0047370	3300046501	Bacteria	2519
428	Ga0495607_0107517	3300046501	Bacteria	1483
429	Ga0495608_0030135	3300046511	Unclassified	3676
430	Ga0495618_0007442	3300046514	Bacteria	6622
431	Ga0495630_0036783	3300046517	Unclassified	3659
432	Ga0495630_0116927	3300046517	Bacteria	2021
433	Ga0495644_0001276	3300046523	Bacteria	10320
434	Ga0495644_0108673	3300046523	Bacteria	1052
435	Ga0495666_0046908	3300046526	Unclassified	2081
436	Ga0495652_0024127	3300046529	Bacteria	5386
437	Ga0495652_0255686	3300046529	Bacteria	1296
438	Ga0495665_0032070	3300046531	Unclassified	2810
439	Ga0495640_0004107	3300046533	Bacteria	11646
440	Ga0495598_0077418	3300046537	Bacteria	1060
441	Ga0495645_0247465	3300046543	Unclassified	1186
442	Ga0495667_0008711	3300046559	Bacteria	6889
443	Ga0495634_0005431	3300046642	Bacteria	9818
444	Ga0495635_0014387	3300046663	Bacteria	5535
445	Ga0495588_0018422	3300046674	Unclassified	3404
446	Ga0495599_0200430	3300046678	Bacteria	1226
447	Ga0495647_0001797	3300046681	Bacteria	6630
448	Ga0495647_0023045	3300046681	Bacteria	2255
449	Ga0495647_0050859	3300046681	Bacteria	1609
450	Ga0495658_0007392	3300046683	Bacteria	5434
451	Ga0495658_0174932	3300046683	Bacteria	1330
452	Ga0495669_0063201	3300046684	Bacteria	1679
453	Ga0495613_0017532	3300046689	Bacteria	5331
454	Ga0495624_0031217	3300046690	Unclassified	3466
455	Ga0495624_0060936	3300046690	Bacteria	2365
456	Ga0495670_0004732	3300046691	Bacteria	6684
457	Ga0495600_0015759	3300046809	Bacteria	4786
458	Ga0495581_0049835	3300047315	Unclassified	2418
459	Ga0495604_0027407	3300047317	Bacteria	4532
460	Ga0495674_0002307	3300047319	Bacteria	18712
461	Ga0495676_0032801	3300047321	Bacteria	4381
462	Ga0495676_0079738	3300047321	Bacteria	2488
463	Ga0495676_0225013	3300047321	Bacteria	1291
464	Ga0495676_0299791	3300047321	Bacteria	1084
465	Ga0495680_0013401	3300047322	Bacteria	7155
466	Ga0495680_0338720	3300047322	Bacteria	1049
467	Ga0495684_0001148	3300047471	Bacteria	21341
468	Ga0495614_0038606	3300048089	Bacteria	2049
469	Ga0496100_0004970	3300048903	Bacteria	7108
470	Ga0496100_0031771	3300048903	Unclassified	3285
471	Ga0496100_0281869	3300048903	Bacteria	1239
472	Ga0496100_0312816	3300048903	Bacteria	1178
473	Ga0496101_0045993	3300048904	Bacteria	3128
474	Ga0496101_0080884	3300048904	Bacteria	2401
475	Ga0496101_0118916	3300048904	Bacteria	1996
476	Ga0496101_0128463	3300048904	Unclassified	1922
477	Ga0496101_0184124	3300048904	Bacteria	1609
478	Ga0496101_0266424	3300048904	Bacteria	1337
479	Ga0496101_0417685	3300048904	Bacteria	1057
480	Ga0496102_0502658	3300048905	Bacteria	1134
481	Ga0496103_0266713	3300048906	Bacteria	1101
482	Ga0496104_0000368	3300048907	Bacteria	39833
483	Ga0496104_0014709	3300048907	Bacteria	7071
484	Ga0496104_0023873	3300048907	Bacteria	5624
485	Ga0496104_0031351	3300048907	Bacteria	4943
486	Ga0496104_0038920	3300048907	Bacteria	4450
487	Ga0496104_0044886	3300048907	Bacteria	4154
488	Ga0496104_0049577	3300048907	Bacteria	3959
489	Ga0496104_0058755	3300048907	Bacteria	3640
490	Ga0496104_0059564	3300048907	Bacteria	3615
491	Ga0496104_0067390	3300048907	Bacteria	3400
492	Ga0496104_0169653	3300048907	Bacteria	2092
493	Ga0496104_0177128	3300048907	Bacteria	2042
494	Ga0496104_0429883	3300048907	Bacteria	1232
495	Ga0496104_0569269	3300048907	Bacteria	1043
496	Ga0496105_0020983	3300048908	Bacteria	5283
497	Ga0496105_0029142	3300048908	Bacteria	4517
498	Ga0496105_0033173	3300048908	Bacteria	4239
499	Ga0496105_0085903	3300048908	Bacteria	2600
500	Ga0496105_0104308	3300048908	Bacteria	2341
501	Ga0496105_0124165	3300048908	Bacteria	2128
502	Ga0496105_0137072	3300048908	Bacteria	2015
503	Ga0496105_0149997	3300048908	Bacteria	1916
504	Ga0496105_0201104	3300048908	Bacteria	1626
505	Ga0496105_0353977	3300048908	Bacteria	1172
506	Ga0496106_0006214	3300048909	Bacteria	8836
507	Ga0496106_0026830	3300048909	Unclassified	4289
508	Ga0496106_0198248	3300048909	Bacteria	1597
509	Ga0496106_0208346	3300048909	Bacteria	1557
510	Ga0496107_0021868	3300048910	Bacteria	4519
511	Ga0496107_0024401	3300048910	Bacteria	4277
512	Ga0496108_0031908	3300048911	Bacteria	4372
513	Ga0496108_0232852	3300048911	Bacteria	1602
514	Ga0496108_0237295	3300048911	Bacteria	1586
515	Ga0496108_0364494	3300048911	Unclassified	1261
516	Ga0496108_0444918	3300048911	Unclassified	1132
517	Ga0496109_0064470	3300048912	Bacteria	3353
518	Ga0496109_0089504	3300048912	Bacteria	2846
519	Ga0496109_0266962	3300048912	Bacteria	1612
520	Ga0496109_0600799	3300048912	Bacteria	1036
521	Ga0496109_0671919	3300048912	Bacteria	973
522	Ga0496110_0010917	3300048913	Bacteria	7407
523	Ga0496110_0021618	3300048913	Bacteria	5451
524	Ga0496110_0059847	3300048913	Bacteria	3358
525	Ga0496110_0084981	3300048913	Bacteria	2825
526	Ga0496110_0149447	3300048913	Bacteria	2114
527	Ga0496110_0155382	3300048913	Bacteria	2072
528	Ga0496110_0383747	3300048913	Bacteria	1280
529	Ga0496110_0538308	3300048913	Bacteria	1062
530	Ga0496111_0011587	3300048914	Bacteria	5944
531	Ga0496111_0036536	3300048914	Bacteria	3513
532	Ga0496111_0060616	3300048914	Unclassified	2742
533	Ga0496111_0179492	3300048914	Bacteria	1574
534	Ga0496112_0044695	3300048915	Bacteria	4341
535	Ga0496112_0048980	3300048915	Bacteria	4140
536	Ga0496112_0117946	3300048915	Bacteria	2624
537	Ga0496112_0391763	3300048915	Bacteria	1329
538	Ga0496112_0452620	3300048915	Bacteria	1221
539	Ga0496113_0019535	3300048916	Bacteria	4743
540	Ga0496113_0025579	3300048916	Unclassified	4209
541	Ga0496113_0126211	3300048916	Bacteria	2004
542	Ga0496113_0345976	3300048916	Bacteria	1192
543	Ga0496113_0392445	3300048916	Bacteria	1114
544	Ga0496114_0019243	3300048917	Bacteria	5531
545	Ga0496114_0117425	3300048917	Bacteria	2285
546	Ga0496114_0162899	3300048917	Bacteria	1940
547	Ga0496114_0171099	3300048917	Bacteria	1893
548	Ga0496114_0207735	3300048917	Unclassified	1716
549	Ga0496114_0416896	3300048917	Unclassified	1189
550	Ga0496115_0019304	3300048918	Bacteria	5245
551	Ga0496115_0022053	3300048918	Bacteria	4926
552	Ga0496115_0048961	3300048918	Bacteria	3381
553	Ga0496115_0114646	3300048918	Bacteria	2215
554	Ga0496115_0314026	3300048918	Bacteria	1283
555	Ga0496115_0343230	3300048918	Unclassified	1218
556	Ga0496115_0382176	3300048918	Bacteria	1145
557	Ga0501076_0218029	3300049592	Bacteria	1560
558	nmdc:mga00v17_205695_c1	3300050491	Bacteria	1273
559	nmdc:mga0yw44_145086_c1	3300050492	Bacteria	1545
560	nmdc:mga0yw44_33399_c1	3300050492	Bacteria	3006
561	nmdc:mga0yw44_80533_c1	3300050492	Bacteria	2040
562	nmdc:mga06z11_16016_c1	3300050494	Bacteria	3019
563	nmdc:mga05p37_139501_c1	3300050507	Unclassified	2971
564	nmdc:mga05p37_143838_c1	3300050507	Unclassified	2921
565	nmdc:mga05p37_2361_c1	3300050507	Bacteria	21958
566	nmdc:mga05p37_282587_c1	3300050507	Bacteria	1979
567	nmdc:mga05p37_285201_c1	3300050507	Unclassified	1968
568	nmdc:mga05p37_398576_c1	3300050507	Unclassified	1607
569	nmdc:mga05p37_519728_c1	3300050507	Bacteria	1362
570	nmdc:mga05p37_7467_c1	3300050507	Bacteria	12892
571	nmdc:mga09592_17665_c1	3300050508	Bacteria	5847
572	nmdc:mga09592_34670_c1	3300050508	Unclassified	4220
573	nmdc:mga09592_37604_c1	3300050508	Bacteria	4061
574	nmdc:mga09592_9032_c1	3300050508	Bacteria	8101
575	nmdc:mga0qj67_1746_c1	3300050509	Bacteria	15360
576	nmdc:mga0qj67_19766_c1	3300050509	Bacteria	5151
577	nmdc:mga0qj67_30625_c1	3300050509	Bacteria	4189
578	nmdc:mga06r32_174385_c1	3300050510	Bacteria	2134
579	nmdc:mga06r32_19799_c1	3300050510	Bacteria	6185
580	nmdc:mga06r32_19891_c1	3300050510	Bacteria	6171
581	nmdc:mga06r32_546_c1	3300050510	Bacteria	32690
582	nmdc:mga06r32_91084_c1	3300050510	Unclassified	2980
583	nmdc:mga08y16_124764_c1	3300050511	Unclassified	2679
584	nmdc:mga08y16_1498_c1	3300050511	Bacteria	23520
585	nmdc:mga08y16_2619_c1	3300050511	Bacteria	18484
586	nmdc:mga08y16_32282_c1	3300050511	Bacteria	5506
587	nmdc:mga08y16_3375_c1	3300050511	Bacteria	16554
588	nmdc:mga08y16_501246_c1	3300050511	Bacteria	1233
589	nmdc:mga0n895_152906_c1	3300050512	Bacteria	2338
590	nmdc:mga0n895_160068_c1	3300050512	Unclassified	2283
591	nmdc:mga0n895_193529_c1	3300050512	Bacteria	2065
592	nmdc:mga0n895_303305_c1	3300050512	Unclassified	1619
593	nmdc:mga0n895_35211_c1	3300050512	Unclassified	4825
594	nmdc:mga0n895_365038_c1	3300050512	Unclassified	1462
595	nmdc:mga0n895_38950_c1	3300050512	Bacteria	4609
596	nmdc:mga0n895_449082_c1	3300050512	Bacteria	1302
597	nmdc:mga0n895_495701_c1	3300050512	Bacteria	1231
598	nmdc:mga0n895_56003_c1	3300050512	Bacteria	3883
599	nmdc:mga0n895_8191_c1	3300050512	Bacteria	9035
600	nmdc:mga0rr50_11345_c1	3300050513	Bacteria	5700
601	nmdc:mga0rr50_212656_c1	3300050513	Bacteria	1594
602	nmdc:mga0rr50_641969_c1	3300050513	Unclassified	906
603	nmdc:mga08x19_128684_c1	3300050514	Bacteria	1702
604	nmdc:mga0a205_100_c1	3300050515	Bacteria	49122
605	nmdc:mga0a205_184567_c1	3300050515	Bacteria	1979
606	nmdc:mga0a205_32636_c1	3300050515	Bacteria	4992
607	nmdc:mga0a205_389497_c1	3300050515	Bacteria	1258
608	nmdc:mga0a205_444_c1	3300050515	Bacteria	31211
609	nmdc:mga0a205_48095_c1	3300050515	Bacteria	4116
610	Ga0495601_0000704	3300053077	Bacteria	17930
611	Ga0495601_0032014	3300053077	Bacteria	3271
612	Ga0495601_0214371	3300053077	Bacteria	1258
613	Ga0495612_0004379	3300053078	Bacteria	5859
614	Ga0495595_0000241	3300053084	Bacteria	21521
615	Ga0495595_0067226	3300053084	Bacteria	1689
616	Ga0495619_0001954	3300053085	Bacteria	13749
617	Ga0495619_0012903	3300053085	Bacteria	5263
618	Ga0495619_0094886	3300053085	Unclassified	2024
619	Ga0495619_0187973	3300053085	Bacteria	1430
620	Ga0501082_0226760	3300060353	Bacteria	1626

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025906	Ga0207699_10177242	Ga0207699_101772423	271
2	3300047322	Ga0495680_0338720	Ga0495680_0338720_140_958	271
3	3300050513	nmdc:mga0rr50_641969_c1	nmdc:mga0rr50_641969_c1_42_863	273
4	3300046455	Ga0495603_0112633	Ga0495603_0112633_14_838	274
5	3300046472	Ga0495580_0274053	Ga0495580_0274053_75_929	281
6	3300048918	Ga0496115_0314026	Ga0496115_0314026_358_1212	281
7	3300053084	Ga0495595_0067226	Ga0495595_0067226_85_942	284
8	3300046492	Ga0495585_0048211	Ga0495585_0048211_944_1804	285
9	3300050512	nmdc:mga0n895_56003_c1	nmdc:mga0n895_56003_c1_2696_3580	294
10	3300050513	nmdc:mga0rr50_212656_c1	nmdc:mga0rr50_212656_c1_323_1207	294
11	3300048913	Ga0496110_0538308	Ga0496110_0538308_147_1037	296
12	3300048907	Ga0496104_0058755	Ga0496104_0058755_241_1239	298
13	3300048917	Ga0496114_0171099	Ga0496114_0171099_972_1874	300
14	3300005518	Ga0070699_100021594	Ga0070699_1000215944	301
15	3300035170	Ga0373943_0087770	Ga0373943_0087770_591_1502	301
16	3300046459	Ga0495629_0088235	Ga0495629_0088235_1240_2145	301
17	3300048904	Ga0496101_0417685	Ga0496101_0417685_15_920	301
18	3300048912	Ga0496109_0671919	Ga0496109_0671919_41_946	301
19	3300048916	Ga0496113_0392445	Ga0496113_0392445_51_956	301
20	3300046537	Ga0495598_0077418	Ga0495598_0077418_126_1049	306
21	3300009147	Ga0114129_10648010	Ga0114129_106480101	307
22	3300050507	nmdc:mga05p37_398576_c1	nmdc:mga05p37_398576_c1_136_1128	307
23	3300050514	nmdc:mga08x19_128684_c1	nmdc:mga08x19_128684_c1_14_943	309
24	3300009101	Ga0105247_10086091	Ga0105247_100860912	310
25	3300009176	Ga0105242_10118919	Ga0105242_101189192	310
26	3300035691	Ga0373931_0077942	Ga0373931_0077942_669_1601	310
27	3300046459	Ga0495629_0320810	Ga0495629_0320810_110_1045	310
28	3300048906	Ga0496103_0266713	Ga0496103_0266713_75_1007	310
29	3300050515	nmdc:mga0a205_184567_c1	nmdc:mga0a205_184567_c1_810_1742	310
30	3300053085	Ga0495619_0094886	Ga0495619_0094886_1002_1937	310
31	3300048912	Ga0496109_0600799	Ga0496109_0600799_42_980	311
32	3300000044	ARSoilOldRDRAFT_c001342	ARSoilOldRDRAFT_0013422	312
33	3300005331	Ga0070670_100017162	Ga0070670_1000171622	312
34	3300005367	Ga0070667_100047003	Ga0070667_1000470032	312
35	3300005436	Ga0070713_100054599	Ga0070713_1000545992	312
36	3300005437	Ga0070710_10004346	Ga0070710_100043462	312
37	3300005455	Ga0070663_100049417	Ga0070663_1000494172	312
38	3300005548	Ga0070665_100131273	Ga0070665_1001312732	312
39	3300005614	Ga0068856_100147934	Ga0068856_1001479342	312
40	3300005618	Ga0068864_100040471	Ga0068864_1000404712	312
41	3300005841	Ga0068863_100080065	Ga0068863_1000800652	312
42	3300009098	Ga0105245_10038674	Ga0105245_100386742	312
43	3300009148	Ga0105243_10179285	Ga0105243_101792851	312
44	3300011119	Ga0105246_10099523	Ga0105246_100995232	312
45	3300025924	Ga0207694_10068834	Ga0207694_100688342	312
46	3300025938	Ga0207704_10077981	Ga0207704_100779812	312
47	3300026023	Ga0207677_10029000	Ga0207677_100290002	312
48	3300026095	Ga0207676_10039914	Ga0207676_100399142	312
49	3300035083	Ga0373926_0028368	Ga0373926_0028368_413_1351	312
50	3300035089	Ga0373944_0062840	Ga0373944_0062840_67_1005	312
51	3300035113	Ga0373936_0032079	Ga0373936_0032079_507_1445	312
52	3300035114	Ga0373939_0035452	Ga0373939_0035452_383_1321	312
53	3300035115	Ga0373941_0075418	Ga0373941_0075418_79_1017	312
54	3300035116	Ga0373945_0004241	Ga0373945_0004241_1453_2391	312
55	3300035119	Ga0373956_0019208	Ga0373956_0019208_326_1264	312
56	3300035170	Ga0373943_0010356	Ga0373943_0010356_146_1084	312
57	3300035691	Ga0373931_0032529	Ga0373931_0032529_703_1641	312
58	3300035695	Ga0373927_0016199	Ga0373927_0016199_2425_3363	312
59	3300035725	Ga0373947_0001106	Ga0373947_0001106_13185_14123	312
60	3300036401	Ga0373937_0110611	Ga0373937_0110611_1525_2463	312
61	3300046455	Ga0495603_0016481	Ga0495603_0016481_547_1485	312
62	3300046459	Ga0495629_0002073	Ga0495629_0002073_2157_3095	312
63	3300046462	Ga0495651_0033326	Ga0495651_0033326_2732_3670	312
64	3300046463	Ga0495653_0011366	Ga0495653_0011366_3458_4396	312
65	3300046472	Ga0495580_0026902	Ga0495580_0026902_350_1288	312
66	3300046473	Ga0495582_0015979	Ga0495582_0015979_2534_3472	312
67	3300046475	Ga0495639_0013332	Ga0495639_0013332_1769_2707	312
68	3300046476	Ga0495662_0011530	Ga0495662_0011530_1319_2257	312
69	3300046477	Ga0495664_0040685	Ga0495664_0040685_227_1165	312
70	3300046499	Ga0495594_0072902	Ga0495594_0072902_609_1547	312
71	3300046511	Ga0495608_0030135	Ga0495608_0030135_2589_3527	312
72	3300046514	Ga0495618_0007442	Ga0495618_0007442_3784_4722	312
73	3300046517	Ga0495630_0036783	Ga0495630_0036783_2705_3643	312
74	3300046526	Ga0495666_0046908	Ga0495666_0046908_176_1114	312
75	3300046529	Ga0495652_0024127	Ga0495652_0024127_2363_3301	312
76	3300046531	Ga0495665_0032070	Ga0495665_0032070_337_1275	312
77	3300046533	Ga0495640_0004107	Ga0495640_0004107_9921_10859	312
78	3300046559	Ga0495667_0008711	Ga0495667_0008711_5045_5983	312
79	3300046642	Ga0495634_0005431	Ga0495634_0005431_3253_4191	312
80	3300046663	Ga0495635_0014387	Ga0495635_0014387_623_1561	312
81	3300046674	Ga0495588_0018422	Ga0495588_0018422_2241_3179	312
82	3300046681	Ga0495647_0001797	Ga0495647_0001797_3692_4630	312
83	3300046690	Ga0495624_0031217	Ga0495624_0031217_2291_3229	312
84	3300046809	Ga0495600_0015759	Ga0495600_0015759_1137_2075	312
85	3300047315	Ga0495581_0049835	Ga0495581_0049835_967_1905	312
86	3300047317	Ga0495604_0027407	Ga0495604_0027407_2972_3910	312
87	3300047319	Ga0495674_0002307	Ga0495674_0002307_10168_11106	312
88	3300047322	Ga0495680_0013401	Ga0495680_0013401_4016_4954	312
89	3300047471	Ga0495684_0001148	Ga0495684_0001148_9048_9986	312
90	3300048089	Ga0495614_0038606	Ga0495614_0038606_17_955	312
91	3300048903	Ga0496100_0031771	Ga0496100_0031771_124_1062	312
92	3300048904	Ga0496101_0128463	Ga0496101_0128463_37_975	312
93	3300048907	Ga0496104_0023873	Ga0496104_0023873_4289_5230	312
94	3300048908	Ga0496105_0201104	Ga0496105_0201104_117_1058	312
95	3300048909	Ga0496106_0026830	Ga0496106_0026830_639_1577	312
96	3300048913	Ga0496110_0021618	Ga0496110_0021618_639_1577	312
97	3300048914	Ga0496111_0060616	Ga0496111_0060616_441_1379	312
98	3300048916	Ga0496113_0025579	Ga0496113_0025579_1765_2703	312
99	3300048917	Ga0496114_0207735	Ga0496114_0207735_140_1078	312
100	3300048917	Ga0496114_0416896	Ga0496114_0416896_222_1163	312
101	3300048918	Ga0496115_0019304	Ga0496115_0019304_2515_3453	312
102	3300048918	Ga0496115_0343230	Ga0496115_0343230_216_1157	312
103	3300053077	Ga0495601_0000704	Ga0495601_0000704_6786_7724	312
104	3300053078	Ga0495612_0004379	Ga0495612_0004379_2276_3214	312
105	3300053084	Ga0495595_0000241	Ga0495595_0000241_9415_10353	312
106	3300053085	Ga0495619_0187973	Ga0495619_0187973_51_995	313
107	3300005983	Ga0081540_1038943	Ga0081540_10389434	314
108	3300047321	Ga0495676_0079738	Ga0495676_0079738_1523_2470	314
109	3300005937	Ga0081455_10017478	Ga0081455_100174786	315
110	3300005937	Ga0081455_10019274	Ga0081455_100192743	317
111	3300009147	Ga0114129_10457409	Ga0114129_104574092	317
112	3300050507	nmdc:mga05p37_285201_c1	nmdc:mga05p37_285201_c1_513_1508	317
113	iso_pu_bacteria	2885409591	2885411751	317
114	3300005434	Ga0070709_10145423	Ga0070709_101454231	318
115	3300006871	Ga0075434_100221821	Ga0075434_1002218212	318
116	3300009098	Ga0105245_10294837	Ga0105245_102948371	318
117	3300050512	nmdc:mga0n895_449082_c1	nmdc:mga0n895_449082_c1_153_1148	318
118	3300005434	Ga0070709_10266473	Ga0070709_102664731	319
119	3300005436	Ga0070713_100070626	Ga0070713_1000706263	319
120	3300006028	Ga0070717_10336300	Ga0070717_103363002	319
121	3300025928	Ga0207700_10161130	Ga0207700_101611302	319
122	3300025929	Ga0207664_10460446	Ga0207664_104604461	319
123	3300006844	Ga0075428_100338185	Ga0075428_1003381851	320
124	3300009147	Ga0114129_10070580	Ga0114129_100705802	320
125	3300045051	Ga0451576_0011582	Ga0451576_0011582_1858_2847	320
126	3300050512	nmdc:mga0n895_160068_c1	nmdc:mga0n895_160068_c1_1118_2080	320
127	3300005544	Ga0070686_100140533	Ga0070686_1001405331	322
128	3300013308	Ga0157375_10379893	Ga0157375_103798932	322
129	3300014969	Ga0157376_10285858	Ga0157376_102858582	322
130	3300048914	Ga0496111_0179492	Ga0496111_0179492_276_1283	323
131	3300048911	Ga0496108_0237295	Ga0496108_0237295_394_1371	324
132	3300048907	Ga0496104_0000368	Ga0496104_0000368_19364_20344	325
133	3300048907	Ga0496104_0031351	Ga0496104_0031351_3697_4683	325
134	3300048911	Ga0496108_0444918	Ga0496108_0444918_46_1026	325
135	3300048918	Ga0496115_0048961	Ga0496115_0048961_1034_2014	325
136	3300005356	Ga0070674_100037336	Ga0070674_1000373362	326
137	3300005983	Ga0081540_1102090	Ga0081540_11020901	326
138	3300006038	Ga0075365_10276659	Ga0075365_102766592	326
139	3300006051	Ga0075364_10327711	Ga0075364_103277111	326
140	3300006194	Ga0075427_10000053	Ga0075427_100000533	326
141	3300006846	Ga0075430_100012987	Ga0075430_1000129875	326
142	3300006847	Ga0075431_100009243	Ga0075431_1000092435	326
143	3300006847	Ga0075431_100599183	Ga0075431_1005991831	326
144	3300006852	Ga0075433_10000879	Ga0075433_1000087920	326
145	3300006871	Ga0075434_100018135	Ga0075434_1000181354	326
146	3300006880	Ga0075429_100005992	Ga0075429_10000599210	326
147	3300007076	Ga0075435_100016835	Ga0075435_1000168352	326
148	3300009094	Ga0111539_10013519	Ga0111539_100135194	326
149	3300009147	Ga0114129_10076437	Ga0114129_100764374	326
150	3300013308	Ga0157375_10209975	Ga0157375_102099752	326
151	3300017792	Ga0163161_10397056	Ga0163161_103970561	326
152	3300026089	Ga0207648_10091884	Ga0207648_100918842	326
153	3300027907	Ga0207428_10000272	Ga0207428_1000027250	326
154	3300035695	Ga0373927_0080382	Ga0373927_0080382_122_1105	326
155	3300035725	Ga0373947_0032003	Ga0373947_0032003_33_1016	326
156	3300046690	Ga0495624_0060936	Ga0495624_0060936_606_1589	326
157	3300047321	Ga0495676_0032801	Ga0495676_0032801_1346_2329	326
158	3300050507	nmdc:mga05p37_2361_c1	nmdc:mga05p37_2361_c1_4046_5029	326
159	3300050508	nmdc:mga09592_37604_c1	nmdc:mga09592_37604_c1_1775_2758	326
160	3300050509	nmdc:mga0qj67_1746_c1	nmdc:mga0qj67_1746_c1_1446_2429	326
161	3300050510	nmdc:mga06r32_174385_c1	nmdc:mga06r32_174385_c1_300_1286	326
162	3300050510	nmdc:mga06r32_546_c1	nmdc:mga06r32_546_c1_27909_28892	326
163	3300050511	nmdc:mga08y16_1498_c1	nmdc:mga08y16_1498_c1_3994_4977	326
164	3300050512	nmdc:mga0n895_152906_c1	nmdc:mga0n895_152906_c1_175_1170	326
165	3300050512	nmdc:mga0n895_8191_c1	nmdc:mga0n895_8191_c1_4254_5237	326
166	3300050513	nmdc:mga0rr50_11345_c1	nmdc:mga0rr50_11345_c1_2944_3927	326
167	3300050515	nmdc:mga0a205_444_c1	nmdc:mga0a205_444_c1_25063_26046	326
168	3300060353	Ga0501082_0226760	Ga0501082_0226760_598_1596	326
169	3300003659	JGI25404J52841_10000174	JGI25404J52841_100001746	327
170	3300003911	JGI25405J52794_10007189	JGI25405J52794_100071892	327
171	3300005434	Ga0070709_10047694	Ga0070709_100476942	327
172	3300005435	Ga0070714_100165416	Ga0070714_1001654162	327
173	3300005436	Ga0070713_100022621	Ga0070713_1000226213	327
174	3300005436	Ga0070713_100140960	Ga0070713_1001409602	327
175	3300005439	Ga0070711_100090099	Ga0070711_1000900993	327
176	3300005439	Ga0070711_100176960	Ga0070711_1001769602	327
177	3300005445	Ga0070708_100010931	Ga0070708_1000109316	327
178	3300005445	Ga0070708_100039455	Ga0070708_1000394555	327
179	3300005467	Ga0070706_100092852	Ga0070706_1000928522	327
180	3300005467	Ga0070706_100142498	Ga0070706_1001424982	327
181	3300005468	Ga0070707_100030908	Ga0070707_1000309082	327
182	3300005468	Ga0070707_100180906	Ga0070707_1001809061	327
183	3300005471	Ga0070698_100034201	Ga0070698_1000342014	327
184	3300005471	Ga0070698_100050289	Ga0070698_1000502891	327
185	3300005471	Ga0070698_100073704	Ga0070698_1000737042	327
186	3300005471	Ga0070698_100152555	Ga0070698_1001525552	327
187	3300005471	Ga0070698_100259373	Ga0070698_1002593732	327
188	3300005518	Ga0070699_100128895	Ga0070699_1001288952	327
189	3300005518	Ga0070699_100248307	Ga0070699_1002483071	327
190	3300005536	Ga0070697_100022017	Ga0070697_1000220173	327
191	3300005536	Ga0070697_100039481	Ga0070697_1000394813	327
192	3300005536	Ga0070697_100087885	Ga0070697_1000878851	327
193	3300005539	Ga0068853_100356872	Ga0068853_1003568721	327
194	3300005548	Ga0070665_100482988	Ga0070665_1004829882	327
195	3300005937	Ga0081455_10010473	Ga0081455_100104732	327
196	3300005937	Ga0081455_10028248	Ga0081455_100282483	327
197	3300005937	Ga0081455_10034591	Ga0081455_100345913	327
198	3300005937	Ga0081455_10040532	Ga0081455_100405324	327
199	3300005937	Ga0081455_10056887	Ga0081455_100568872	327
200	3300005983	Ga0081540_1016916	Ga0081540_10169163	327
201	3300005983	Ga0081540_1045403	Ga0081540_10454033	327
202	3300005985	Ga0081539_10015294	Ga0081539_100152942	327
203	3300006028	Ga0070717_10016433	Ga0070717_100164332	327
204	3300006028	Ga0070717_10031714	Ga0070717_100317142	327
205	3300006028	Ga0070717_10057127	Ga0070717_100571272	327
206	3300006028	Ga0070717_10065932	Ga0070717_100659323	327
207	3300006038	Ga0075365_10052956	Ga0075365_100529563	327
208	3300006175	Ga0070712_100060488	Ga0070712_1000604882	327
209	3300006175	Ga0070712_100093053	Ga0070712_1000930533	327
210	3300006178	Ga0075367_10062119	Ga0075367_100621192	327
211	3300006237	Ga0097621_100389961	Ga0097621_1003899612	327
212	3300006844	Ga0075428_100168764	Ga0075428_1001687641	327
213	3300006844	Ga0075428_100453943	Ga0075428_1004539431	327
214	3300006846	Ga0075430_100244535	Ga0075430_1002445352	327
215	3300006847	Ga0075431_100184910	Ga0075431_1001849101	327
216	3300006871	Ga0075434_100004256	Ga0075434_10000425612	327
217	3300006871	Ga0075434_100036112	Ga0075434_1000361127	327
218	3300006881	Ga0068865_100291455	Ga0068865_1002914552	327
219	3300006914	Ga0075436_100236166	Ga0075436_1002361661	327
220	3300007076	Ga0075435_100041758	Ga0075435_1000417582	327
221	3300007076	Ga0075435_100281585	Ga0075435_1002815851	327
222	3300009094	Ga0111539_10356004	Ga0111539_103560042	327
223	3300009094	Ga0111539_10388185	Ga0111539_103881853	327
224	3300009147	Ga0114129_10685675	Ga0114129_106856751	327
225	3300009147	Ga0114129_10892791	Ga0114129_108927912	327
226	3300009177	Ga0105248_10275092	Ga0105248_102750921	327
227	3300009177	Ga0105248_10878710	Ga0105248_108787101	327
228	3300010375	Ga0105239_10314611	Ga0105239_103146112	327
229	3300011119	Ga0105246_10069678	Ga0105246_100696781	327
230	3300013296	Ga0157374_10177969	Ga0157374_101779691	327
231	3300013308	Ga0157375_10573139	Ga0157375_105731391	327
232	3300014326	Ga0157380_10128867	Ga0157380_101288673	327
233	3300025898	Ga0207692_10037078	Ga0207692_100370782	327
234	3300025901	Ga0207688_10206748	Ga0207688_102067482	327
235	3300025903	Ga0207680_10194626	Ga0207680_101946261	327
236	3300025907	Ga0207645_10186056	Ga0207645_101860561	327
237	3300025910	Ga0207684_10027535	Ga0207684_100275355	327
238	3300025915	Ga0207693_10185574	Ga0207693_101855742	327
239	3300025916	Ga0207663_10014341	Ga0207663_100143414	327
240	3300025922	Ga0207646_10016790	Ga0207646_100167905	327
241	3300025922	Ga0207646_10184523	Ga0207646_101845232	327
242	3300025928	Ga0207700_10008320	Ga0207700_100083206	327
243	3300025929	Ga0207664_10158582	Ga0207664_101585822	327
244	3300025929	Ga0207664_10473624	Ga0207664_104736241	327
245	3300025931	Ga0207644_10290867	Ga0207644_102908672	327
246	3300025933	Ga0207706_10186789	Ga0207706_101867892	327
247	3300025940	Ga0207691_10169455	Ga0207691_101694552	327
248	3300025940	Ga0207691_10477277	Ga0207691_104772771	327
249	3300026023	Ga0207677_10454620	Ga0207677_104546201	327
250	3300026075	Ga0207708_10361068	Ga0207708_103610681	327
251	3300026088	Ga0207641_10171509	Ga0207641_101715091	327
252	3300026118	Ga0207675_100058268	Ga0207675_1000582683	327
253	3300026121	Ga0207683_10522030	Ga0207683_105220301	327
254	3300027671	Ga0209588_1039745	Ga0209588_10397451	327
255	3300028381	Ga0268264_10394612	Ga0268264_103946122	327
256	3300035083	Ga0373926_0072714	Ga0373926_0072714_156_1142	327
257	3300035692	Ga0373935_0279702	Ga0373935_0279702_27_1019	327
258	3300035695	Ga0373927_0239819	Ga0373927_0239819_162_1148	327
259	3300035725	Ga0373947_0081459	Ga0373947_0081459_21_1007	327
260	3300035725	Ga0373947_0105397	Ga0373947_0105397_34_1020	327
261	3300037068	Ga0373925_0015785	Ga0373925_0015785_2462_3448	327
262	3300037068	Ga0373925_0290848	Ga0373925_0290848_78_1073	327
263	3300037466	Ga0395898_0354027	Ga0395898_0354027_120_1106	327
264	3300046455	Ga0495603_0013986	Ga0495603_0013986_1916_2902	327
265	3300046455	Ga0495603_0132097	Ga0495603_0132097_118_1104	327
266	3300046461	Ga0495641_0042544	Ga0495641_0042544_982_1968	327
267	3300046461	Ga0495641_0114709	Ga0495641_0114709_146_1132	327
268	3300046473	Ga0495582_0178594	Ga0495582_0178594_123_1109	327
269	3300046517	Ga0495630_0116927	Ga0495630_0116927_754_1740	327
270	3300046529	Ga0495652_0255686	Ga0495652_0255686_187_1173	327
271	3300046543	Ga0495645_0247465	Ga0495645_0247465_29_1015	327
272	3300046678	Ga0495599_0200430	Ga0495599_0200430_76_1062	327
273	3300046683	Ga0495658_0174932	Ga0495658_0174932_63_1049	327
274	3300048903	Ga0496100_0312816	Ga0496100_0312816_97_1083	327
275	3300048904	Ga0496101_0118916	Ga0496101_0118916_484_1473	327
276	3300048907	Ga0496104_0000368	Ga0496104_0000368_22307_23302	327
277	3300048907	Ga0496104_0014709	Ga0496104_0014709_4017_5006	327
278	3300048907	Ga0496104_0067390	Ga0496104_0067390_1677_2666	327
279	3300048907	Ga0496104_0067390	Ga0496104_0067390_694_1680	327
280	3300048907	Ga0496104_0569269	Ga0496104_0569269_28_1011	327
281	3300048908	Ga0496105_0085903	Ga0496105_0085903_529_1518	327
282	3300048908	Ga0496105_0104308	Ga0496105_0104308_152_1144	327
283	3300048908	Ga0496105_0124165	Ga0496105_0124165_974_1963	327
284	3300048909	Ga0496106_0198248	Ga0496106_0198248_470_1462	327
285	3300048909	Ga0496106_0208346	Ga0496106_0208346_393_1379	327
286	3300048911	Ga0496108_0232852	Ga0496108_0232852_332_1315	327
287	3300048912	Ga0496109_0089504	Ga0496109_0089504_1477_2466	327
288	3300048913	Ga0496110_0010917	Ga0496110_0010917_5621_6622	327
289	3300048913	Ga0496110_0059847	Ga0496110_0059847_1922_2908	327
290	3300048913	Ga0496110_0059847	Ga0496110_0059847_936_1925	327
291	3300048913	Ga0496110_0084981	Ga0496110_0084981_79_1065	327
292	3300048913	Ga0496110_0149447	Ga0496110_0149447_1006_1995	327
293	3300048914	Ga0496111_0036536	Ga0496111_0036536_1705_2706	327
294	3300048915	Ga0496112_0044695	Ga0496112_0044695_1367_2356	327
295	3300048915	Ga0496112_0044695	Ga0496112_0044695_384_1370	327
296	3300048916	Ga0496113_0019535	Ga0496113_0019535_1833_2828	327
297	3300048918	Ga0496115_0114646	Ga0496115_0114646_566_1561	327
298	3300048918	Ga0496115_0382176	Ga0496115_0382176_72_1061	327
299	3300049592	Ga0501076_0218029	Ga0501076_0218029_450_1442	327
300	3300050492	nmdc:mga0yw44_33399_c1	nmdc:mga0yw44_33399_c1_379_1365	327
301	3300050492	nmdc:mga0yw44_80533_c1	nmdc:mga0yw44_80533_c1_68_1054	327
302	3300050494	nmdc:mga06z11_16016_c1	nmdc:mga06z11_16016_c1_255_1241	327
303	3300050507	nmdc:mga05p37_519728_c1	nmdc:mga05p37_519728_c1_54_1193	327
304	3300050509	nmdc:mga0qj67_30625_c1	nmdc:mga0qj67_30625_c1_2907_3890	327
305	3300050512	nmdc:mga0n895_193529_c1	nmdc:mga0n895_193529_c1_437_1423	327
306	3300050512	nmdc:mga0n895_495701_c1	nmdc:mga0n895_495701_c1_66_1064	327
307	3300053077	Ga0495601_0032014	Ga0495601_0032014_230_1216	327
308	3300053077	Ga0495601_0214371	Ga0495601_0214371_206_1195	327
309	3300005330	Ga0070690_100104225	Ga0070690_1001042252	328
310	3300005335	Ga0070666_10189245	Ga0070666_101892452	328
311	3300005340	Ga0070689_100052338	Ga0070689_1000523382	328
312	3300005353	Ga0070669_100084139	Ga0070669_1000841393	328
313	3300005355	Ga0070671_100267093	Ga0070671_1002670932	328
314	3300005365	Ga0070688_100042922	Ga0070688_1000429222	328
315	3300005367	Ga0070667_100110501	Ga0070667_1001105012	328
316	3300005435	Ga0070714_100179018	Ga0070714_1001790181	328
317	3300005439	Ga0070711_100254315	Ga0070711_1002543152	328
318	3300005439	Ga0070711_100313705	Ga0070711_1003137051	328
319	3300005467	Ga0070706_100120917	Ga0070706_1001209172	328
320	3300005467	Ga0070706_100191488	Ga0070706_1001914882	328
321	3300005615	Ga0070702_100071900	Ga0070702_1000719001	328
322	3300005843	Ga0068860_100282972	Ga0068860_1002829722	328
323	3300005937	Ga0081455_10013667	Ga0081455_100136674	328
324	3300005937	Ga0081455_10019106	Ga0081455_100191064	328
325	3300005937	Ga0081455_10025087	Ga0081455_100250873	328
326	3300005937	Ga0081455_10279096	Ga0081455_102790961	328
327	3300006038	Ga0075365_10108852	Ga0075365_101088521	328
328	3300006038	Ga0075365_10173460	Ga0075365_101734602	328
329	3300006175	Ga0070712_100086146	Ga0070712_1000861462	328
330	3300006844	Ga0075428_100102690	Ga0075428_1001026902	328
331	3300006844	Ga0075428_100359177	Ga0075428_1003591772	328
332	3300006847	Ga0075431_100268475	Ga0075431_1002684752	328
333	3300006871	Ga0075434_100264425	Ga0075434_1002644251	328
334	3300006871	Ga0075434_100398974	Ga0075434_1003989742	328
335	3300006914	Ga0075436_100284092	Ga0075436_1002840921	328
336	3300007076	Ga0075435_100061588	Ga0075435_1000615883	328
337	3300009147	Ga0114129_10206547	Ga0114129_102065473	328
338	3300009147	Ga0114129_10226998	Ga0114129_102269982	328
339	3300009147	Ga0114129_10580204	Ga0114129_105802042	328
340	3300014325	Ga0163163_10214873	Ga0163163_102148732	328
341	3300014325	Ga0163163_10637049	Ga0163163_106370491	328
342	3300025898	Ga0207692_10040897	Ga0207692_100408973	328
343	3300025898	Ga0207692_10061667	Ga0207692_100616672	328
344	3300025915	Ga0207693_10374464	Ga0207693_103744641	328
345	3300025916	Ga0207663_10055274	Ga0207663_100552741	328
346	3300025916	Ga0207663_10179725	Ga0207663_101797251	328
347	3300025929	Ga0207664_10058800	Ga0207664_100588001	328
348	3300025936	Ga0207670_10035697	Ga0207670_100356972	328
349	3300025941	Ga0207711_10247275	Ga0207711_102472751	328
350	3300026118	Ga0207675_100308945	Ga0207675_1003089451	328
351	3300035089	Ga0373944_0067247	Ga0373944_0067247_109_1098	328
352	3300035121	Ga0373960_0055822	Ga0373960_0055822_173_1159	328
353	3300037068	Ga0373925_0268084	Ga0373925_0268084_200_1189	328
354	3300038443	Ga0395901_0210187	Ga0395901_0210187_965_1954	328
355	3300046459	Ga0495629_0016703	Ga0495629_0016703_2416_3411	328
356	3300046459	Ga0495629_0166739	Ga0495629_0166739_139_1128	328
357	3300046476	Ga0495662_0101766	Ga0495662_0101766_199_1188	328
358	3300046501	Ga0495607_0047370	Ga0495607_0047370_1426_2415	328
359	3300046501	Ga0495607_0107517	Ga0495607_0107517_428_1423	328
360	3300046523	Ga0495644_0001276	Ga0495644_0001276_353_1342	328
361	3300046681	Ga0495647_0050859	Ga0495647_0050859_239_1228	328
362	3300046691	Ga0495670_0004732	Ga0495670_0004732_5657_6646	328
363	3300047321	Ga0495676_0225013	Ga0495676_0225013_167_1165	328
364	3300047321	Ga0495676_0299791	Ga0495676_0299791_34_1023	328
365	3300048904	Ga0496101_0266424	Ga0496101_0266424_213_1205	328
366	3300048907	Ga0496104_0044886	Ga0496104_0044886_1568_2557	328
367	3300048907	Ga0496104_0049577	Ga0496104_0049577_2704_3693	328
368	3300048907	Ga0496104_0059564	Ga0496104_0059564_861_1853	328
369	3300048907	Ga0496104_0169653	Ga0496104_0169653_1047_2036	328
370	3300048907	Ga0496104_0177128	Ga0496104_0177128_590_1588	328
371	3300048907	Ga0496104_0429883	Ga0496104_0429883_86_1075	328
372	3300048908	Ga0496105_0033173	Ga0496105_0033173_1388_2377	328
373	3300048908	Ga0496105_0137072	Ga0496105_0137072_161_1150	328
374	3300048908	Ga0496105_0149997	Ga0496105_0149997_325_1323	328
375	3300048910	Ga0496107_0021868	Ga0496107_0021868_3408_4397	328
376	3300048911	Ga0496108_0364494	Ga0496108_0364494_174_1163	328
377	3300048912	Ga0496109_0064470	Ga0496109_0064470_2101_3090	328
378	3300048913	Ga0496110_0383747	Ga0496110_0383747_232_1218	328
379	3300048915	Ga0496112_0117946	Ga0496112_0117946_1479_2468	328
380	3300048915	Ga0496112_0391763	Ga0496112_0391763_328_1317	328
381	3300048915	Ga0496112_0452620	Ga0496112_0452620_172_1161	328
382	3300048916	Ga0496113_0126211	Ga0496113_0126211_980_1969	328
383	3300048917	Ga0496114_0117425	Ga0496114_0117425_116_1105	328
384	3300050491	nmdc:mga00v17_205695_c1	nmdc:mga00v17_205695_c1_12_1016	328
385	3300050492	nmdc:mga0yw44_145086_c1	nmdc:mga0yw44_145086_c1_184_1245	328
386	3300050507	nmdc:mga05p37_139501_c1	nmdc:mga05p37_139501_c1_1340_2329	328
387	3300050508	nmdc:mga09592_9032_c1	nmdc:mga09592_9032_c1_5737_6726	328
388	3300050509	nmdc:mga0qj67_19766_c1	nmdc:mga0qj67_19766_c1_1809_2798	328
389	3300050510	nmdc:mga06r32_91084_c1	nmdc:mga06r32_91084_c1_131_1120	328
390	3300050511	nmdc:mga08y16_124764_c1	nmdc:mga08y16_124764_c1_1340_2329	328
391	3300050511	nmdc:mga08y16_501246_c1	nmdc:mga08y16_501246_c1_232_1221	328
392	3300050512	nmdc:mga0n895_38950_c1	nmdc:mga0n895_38950_c1_1396_2385	328
393	3300050515	nmdc:mga0a205_32636_c1	nmdc:mga0a205_32636_c1_1663_2652	328
394	3300053085	Ga0495619_0012903	Ga0495619_0012903_1757_2752	328
395	2209111006	2214736892	2213743050	329
396	3300000042	ARSoilYngRDRAFT_c00585	ARSoilYngRDRAFT_005852	329
397	3300000043	ARcpr5yngRDRAFT_c000599	ARcpr5yngRDRAFT_0005995	329
398	3300000044	ARSoilOldRDRAFT_c000515	ARSoilOldRDRAFT_0005155	329
399	3300000652	ARCol0yngRDRAFT_1000486	ARCol0yngRDRAFT_10004862	329
400	3300005293	Ga0065715_10000317	Ga0065715_100003172	329
401	3300005329	Ga0070683_100431342	Ga0070683_1004313421	329
402	3300005330	Ga0070690_100004460	Ga0070690_1000044607	329
403	3300005330	Ga0070690_100021058	Ga0070690_1000210587	329
404	3300005331	Ga0070670_100148752	Ga0070670_1001487522	329
405	3300005335	Ga0070666_10026208	Ga0070666_100262082	329
406	3300005338	Ga0068868_100028588	Ga0068868_1000285882	329
407	3300005339	Ga0070660_100232208	Ga0070660_1002322081	329
408	3300005339	Ga0070660_100292690	Ga0070660_1002926901	329
409	3300005340	Ga0070689_100002134	Ga0070689_1000021344	329
410	3300005340	Ga0070689_100036583	Ga0070689_1000365834	329
411	3300005345	Ga0070692_10217365	Ga0070692_102173651	329
412	3300005355	Ga0070671_100010441	Ga0070671_1000104412	329
413	3300005356	Ga0070674_100083782	Ga0070674_1000837822	329
414	3300005364	Ga0070673_100190347	Ga0070673_1001903471	329
415	3300005365	Ga0070688_100275625	Ga0070688_1002756251	329
416	3300005434	Ga0070709_10005532	Ga0070709_100055323	329
417	3300005436	Ga0070713_100005026	Ga0070713_1000050268	329
418	3300005437	Ga0070710_10001919	Ga0070710_1000191910	329
419	3300005439	Ga0070711_100031866	Ga0070711_1000318664	329
420	3300005455	Ga0070663_100020275	Ga0070663_1000202752	329
421	3300005455	Ga0070663_100319313	Ga0070663_1003193131	329
422	3300005455	Ga0070663_100358187	Ga0070663_1003581871	329
423	3300005456	Ga0070678_100004147	Ga0070678_1000041474	329
424	3300005456	Ga0070678_100011241	Ga0070678_1000112414	329
425	3300005456	Ga0070678_100350414	Ga0070678_1003504141	329
426	3300005457	Ga0070662_100068208	Ga0070662_1000682081	329
427	3300005466	Ga0070685_10006301	Ga0070685_100063013	329
428	3300005466	Ga0070685_10102669	Ga0070685_101026692	329
429	3300005471	Ga0070698_100291002	Ga0070698_1002910022	329
430	3300005471	Ga0070698_100336713	Ga0070698_1003367132	329
431	3300005535	Ga0070684_100134837	Ga0070684_1001348371	329
432	3300005536	Ga0070697_100165906	Ga0070697_1001659062	329
433	3300005536	Ga0070697_100278557	Ga0070697_1002785572	329
434	3300005539	Ga0068853_100116500	Ga0068853_1001165002	329
435	3300005544	Ga0070686_100007929	Ga0070686_1000079293	329
436	3300005545	Ga0070695_100025782	Ga0070695_1000257823	329
437	3300005545	Ga0070695_100170314	Ga0070695_1001703141	329
438	3300005548	Ga0070665_100130113	Ga0070665_1001301133	329
439	3300005564	Ga0070664_100041822	Ga0070664_1000418221	329
440	3300005564	Ga0070664_100256842	Ga0070664_1002568423	329
441	3300005617	Ga0068859_100482966	Ga0068859_1004829662	329
442	3300005618	Ga0068864_100007135	Ga0068864_1000071353	329
443	3300005841	Ga0068863_100169547	Ga0068863_1001695474	329
444	3300005841	Ga0068863_100316311	Ga0068863_1003163111	329
445	3300005842	Ga0068858_100011560	Ga0068858_1000115603	329
446	3300005842	Ga0068858_100228028	Ga0068858_1002280282	329
447	3300005843	Ga0068860_100075517	Ga0068860_1000755172	329
448	3300005844	Ga0068862_100042405	Ga0068862_1000424054	329
449	3300005844	Ga0068862_100419469	Ga0068862_1004194691	329
450	3300005937	Ga0081455_10011829	Ga0081455_100118292	329
451	3300005983	Ga0081540_1002393	Ga0081540_100239318	329
452	3300005983	Ga0081540_1034037	Ga0081540_10340372	329
453	3300006028	Ga0070717_10005760	Ga0070717_100057609	329
454	3300006028	Ga0070717_10020508	Ga0070717_100205085	329
455	3300006028	Ga0070717_10504312	Ga0070717_105043121	329
456	3300006163	Ga0070715_10003812	Ga0070715_100038122	329
457	3300006173	Ga0070716_100001955	Ga0070716_1000019558	329
458	3300006173	Ga0070716_100002302	Ga0070716_1000023022	329
459	3300006237	Ga0097621_100084126	Ga0097621_1000841262	329
460	3300006358	Ga0068871_100003994	Ga0068871_1000039947	329
461	3300006844	Ga0075428_100007352	Ga0075428_1000073522	329
462	3300006844	Ga0075428_100011982	Ga0075428_1000119829	329
463	3300006846	Ga0075430_100005909	Ga0075430_1000059096	329
464	3300006847	Ga0075431_100015602	Ga0075431_1000156022	329
465	3300006847	Ga0075431_100015893	Ga0075431_1000158935	329
466	3300006852	Ga0075433_10004805	Ga0075433_100048052	329
467	3300006871	Ga0075434_100001712	Ga0075434_1000017126	329
468	3300006871	Ga0075434_100202456	Ga0075434_1002024563	329
469	3300006871	Ga0075434_100537515	Ga0075434_1005375152	329
470	3300006880	Ga0075429_100004087	Ga0075429_1000040876	329
471	3300006880	Ga0075429_100252791	Ga0075429_1002527912	329
472	3300006881	Ga0068865_100038087	Ga0068865_1000380873	329
473	3300006881	Ga0068865_100069889	Ga0068865_1000698892	329
474	3300006881	Ga0068865_100241070	Ga0068865_1002410702	329
475	3300006931	Ga0097620_100482983	Ga0097620_1004829832	329
476	3300007076	Ga0075435_100020675	Ga0075435_1000206756	329
477	3300009011	Ga0105251_10017633	Ga0105251_100176332	329
478	3300009094	Ga0111539_10002079	Ga0111539_1000207932	329
479	3300009094	Ga0111539_10251706	Ga0111539_102517062	329
480	3300009094	Ga0111539_10591681	Ga0111539_105916811	329
481	3300009098	Ga0105245_10446763	Ga0105245_104467632	329
482	3300009147	Ga0114129_10011079	Ga0114129_1001107915	329
483	3300009147	Ga0114129_10011621	Ga0114129_100116214	329
484	3300009147	Ga0114129_10150379	Ga0114129_101503794	329
485	3300009148	Ga0105243_10278178	Ga0105243_102781782	329
486	3300009174	Ga0105241_10057605	Ga0105241_100576052	329
487	3300009176	Ga0105242_10022663	Ga0105242_100226632	329
488	3300009177	Ga0105248_10122329	Ga0105248_101223293	329
489	3300009545	Ga0105237_10158564	Ga0105237_101585641	329
490	3300009551	Ga0105238_10260570	Ga0105238_102605701	329
491	3300009553	Ga0105249_10132766	Ga0105249_101327664	329
492	3300010375	Ga0105239_10031779	Ga0105239_100317792	329
493	3300011119	Ga0105246_10046733	Ga0105246_100467334	329
494	3300013297	Ga0157378_10022385	Ga0157378_100223853	329
495	3300013297	Ga0157378_10029323	Ga0157378_100293236	329
496	3300013306	Ga0163162_10045915	Ga0163162_100459152	329
497	3300013306	Ga0163162_10114517	Ga0163162_101145174	329
498	3300013308	Ga0157375_10100567	Ga0157375_101005671	329
499	3300013308	Ga0157375_10303960	Ga0157375_103039602	329
500	3300014968	Ga0157379_10059576	Ga0157379_100595762	329
501	3300014968	Ga0157379_10316296	Ga0157379_103162962	329
502	3300014969	Ga0157376_10026942	Ga0157376_100269423	329
503	3300025898	Ga0207692_10047688	Ga0207692_100476882	329
504	3300025900	Ga0207710_10001666	Ga0207710_1000166612	329
505	3300025900	Ga0207710_10009742	Ga0207710_100097422	329
506	3300025905	Ga0207685_10000852	Ga0207685_100008523	329
507	3300025905	Ga0207685_10002496	Ga0207685_100024963	329
508	3300025906	Ga0207699_10002726	Ga0207699_100027265	329
509	3300025910	Ga0207684_10153432	Ga0207684_101534321	329
510	3300025910	Ga0207684_10218853	Ga0207684_102188532	329
511	3300025914	Ga0207671_10213828	Ga0207671_102138281	329
512	3300025914	Ga0207671_10317151	Ga0207671_103171511	329
513	3300025915	Ga0207693_10002257	Ga0207693_100022578	329
514	3300025915	Ga0207693_10032126	Ga0207693_100321262	329
515	3300025915	Ga0207693_10264121	Ga0207693_102641211	329
516	3300025916	Ga0207663_10004484	Ga0207663_100044842	329
517	3300025916	Ga0207663_10117746	Ga0207663_101177461	329
518	3300025918	Ga0207662_10006431	Ga0207662_100064312	329
519	3300025919	Ga0207657_10046753	Ga0207657_100467532	329
520	3300025919	Ga0207657_10056643	Ga0207657_100566431	329
521	3300025925	Ga0207650_10016493	Ga0207650_100164934	329
522	3300025927	Ga0207687_10012674	Ga0207687_100126742	329
523	3300025928	Ga0207700_10011281	Ga0207700_100112815	329
524	3300025928	Ga0207700_10013270	Ga0207700_100132703	329
525	3300025929	Ga0207664_10018639	Ga0207664_100186393	329
526	3300025931	Ga0207644_10015564	Ga0207644_100155642	329
527	3300025933	Ga0207706_10015802	Ga0207706_100158024	329
528	3300025933	Ga0207706_10257028	Ga0207706_102570281	329
529	3300025934	Ga0207686_10021084	Ga0207686_100210843	329
530	3300025935	Ga0207709_10172809	Ga0207709_101728092	329
531	3300025937	Ga0207669_10194793	Ga0207669_101947931	329
532	3300025939	Ga0207665_10004581	Ga0207665_100045817	329
533	3300025939	Ga0207665_10004818	Ga0207665_100048182	329
534	3300025940	Ga0207691_10025273	Ga0207691_100252735	329
535	3300025941	Ga0207711_10019178	Ga0207711_100191784	329
536	3300025941	Ga0207711_10403155	Ga0207711_104031551	329
537	3300025942	Ga0207689_10118051	Ga0207689_101180512	329
538	3300025942	Ga0207689_10416523	Ga0207689_104165231	329
539	3300025945	Ga0207679_10051394	Ga0207679_100513942	329
540	3300025945	Ga0207679_10395078	Ga0207679_103950781	329
541	3300025961	Ga0207712_10262170	Ga0207712_102621701	329
542	3300026035	Ga0207703_10018327	Ga0207703_100183272	329
543	3300026067	Ga0207678_10029079	Ga0207678_100290793	329
544	3300026067	Ga0207678_10163473	Ga0207678_101634732	329
545	3300026067	Ga0207678_10371685	Ga0207678_103716851	329
546	3300026075	Ga0207708_10052449	Ga0207708_100524492	329
547	3300026088	Ga0207641_10455896	Ga0207641_104558961	329
548	3300026088	Ga0207641_10484973	Ga0207641_104849731	329
549	3300026095	Ga0207676_10294872	Ga0207676_102948721	329
550	3300026118	Ga0207675_100398689	Ga0207675_1003986891	329
551	3300026121	Ga0207683_10006413	Ga0207683_100064134	329
552	3300026121	Ga0207683_10009778	Ga0207683_1000977810	329
553	3300026121	Ga0207683_10422244	Ga0207683_104222442	329
554	3300027907	Ga0207428_10000188	Ga0207428_1000018890	329
555	3300027907	Ga0207428_10007370	Ga0207428_100073702	329
556	3300028379	Ga0268266_10005275	Ga0268266_100052758	329
557	3300028380	Ga0268265_10020129	Ga0268265_100201295	329
558	3300028380	Ga0268265_10261556	Ga0268265_102615562	329
559	3300028381	Ga0268264_10123366	Ga0268264_101233664	329
560	3300028381	Ga0268264_10160086	Ga0268264_101600862	329
561	3300034957	Ga0373938_0004964	Ga0373938_0004964_1047_2036	329
562	3300035084	Ga0373928_0000134	Ga0373928_0000134_831_1820	329
563	3300035085	Ga0373929_0011840	Ga0373929_0011840_398_1387	329
564	3300035088	Ga0373940_0010416	Ga0373940_0010416_101_1090	329
565	3300035090	Ga0373949_0006133	Ga0373949_0006133_1414_2403	329
566	3300035091	Ga0373951_0005808	Ga0373951_0005808_1601_2590	329
567	3300035092	Ga0373952_0000475	Ga0373952_0000475_5139_6128	329
568	3300035112	Ga0373932_0007269	Ga0373932_0007269_1461_2450	329
569	3300035114	Ga0373939_0014082	Ga0373939_0014082_947_1936	329
570	3300035170	Ga0373943_0105042	Ga0373943_0105042_340_1341	329
571	3300035207	Ga0373942_0001883	Ga0373942_0001883_785_1774	329
572	3300035241	Ga0373961_0006229	Ga0373961_0006229_1716_2705	329
573	3300035242	Ga0373962_0001989	Ga0373962_0001989_3857_4846	329
574	3300035691	Ga0373931_0001007	Ga0373931_0001007_7954_8943	329
575	3300035725	Ga0373947_0145522	Ga0373947_0145522_480_1481	329
576	3300037068	Ga0373925_0083380	Ga0373925_0083380_1106_2107	329
577	3300042876	Ga0451577_0338306	Ga0451577_0338306_274_1263	329
578	3300045051	Ga0451576_0130723	Ga0451576_0130723_219_1208	329
579	3300046454	Ga0495592_0106620	Ga0495592_0106620_878_1867	329
580	3300046459	Ga0495629_0090419	Ga0495629_0090419_235_1230	329
581	3300046473	Ga0495582_0072769	Ga0495582_0072769_559_1560	329
582	3300046499	Ga0495594_0057076	Ga0495594_0057076_1028_2029	329
583	3300046523	Ga0495644_0108673	Ga0495644_0108673_49_1041	329
584	3300046681	Ga0495647_0023045	Ga0495647_0023045_285_1286	329
585	3300046683	Ga0495658_0007392	Ga0495658_0007392_2113_3114	329
586	3300046684	Ga0495669_0063201	Ga0495669_0063201_89_1087	329
587	3300046689	Ga0495613_0017532	Ga0495613_0017532_1895_2896	329
588	3300048903	Ga0496100_0004970	Ga0496100_0004970_2170_3162	329
589	3300048903	Ga0496100_0281869	Ga0496100_0281869_185_1186	329
590	3300048904	Ga0496101_0045993	Ga0496101_0045993_95_1087	329
591	3300048904	Ga0496101_0080884	Ga0496101_0080884_434_1426	329
592	3300048904	Ga0496101_0184124	Ga0496101_0184124_93_1082	329
593	3300048905	Ga0496102_0502658	Ga0496102_0502658_43_1032	329
594	3300048907	Ga0496104_0038920	Ga0496104_0038920_754_1743	329
595	3300048908	Ga0496105_0020983	Ga0496105_0020983_1241_2233	329
596	3300048908	Ga0496105_0029142	Ga0496105_0029142_3069_4058	329
597	3300048908	Ga0496105_0353977	Ga0496105_0353977_75_1067	329
598	3300048909	Ga0496106_0006214	Ga0496106_0006214_95_1087	329
599	3300048910	Ga0496107_0024401	Ga0496107_0024401_2042_3034	329
600	3300048911	Ga0496108_0031908	Ga0496108_0031908_1534_2526	329
601	3300048912	Ga0496109_0266962	Ga0496109_0266962_497_1486	329
602	3300048913	Ga0496110_0155382	Ga0496110_0155382_767_1762	329
603	3300048914	Ga0496111_0011587	Ga0496111_0011587_4373_5365	329
604	3300048915	Ga0496112_0048980	Ga0496112_0048980_3054_4046	329
605	3300048916	Ga0496113_0345976	Ga0496113_0345976_95_1087	329
606	3300048917	Ga0496114_0019243	Ga0496114_0019243_167_1159	329
607	3300048917	Ga0496114_0162899	Ga0496114_0162899_96_1088	329
608	3300048918	Ga0496115_0022053	Ga0496115_0022053_3847_4848	329
609	3300050507	nmdc:mga05p37_143838_c1	nmdc:mga05p37_143838_c1_1657_2658	329
610	3300050507	nmdc:mga05p37_282587_c1	nmdc:mga05p37_282587_c1_936_1928	329
611	3300050507	nmdc:mga05p37_7467_c1	nmdc:mga05p37_7467_c1_6703_7695	329
612	3300050508	nmdc:mga09592_17665_c1	nmdc:mga09592_17665_c1_378_1370	329
613	3300050508	nmdc:mga09592_34670_c1	nmdc:mga09592_34670_c1_305_1297	329
614	3300050510	nmdc:mga06r32_19799_c1	nmdc:mga06r32_19799_c1_4889_5881	329
615	3300050510	nmdc:mga06r32_19891_c1	nmdc:mga06r32_19891_c1_264_1256	329
616	3300050511	nmdc:mga08y16_2619_c1	nmdc:mga08y16_2619_c1_8853_9842	329
617	3300050511	nmdc:mga08y16_32282_c1	nmdc:mga08y16_32282_c1_212_1204	329
618	3300050511	nmdc:mga08y16_3375_c1	nmdc:mga08y16_3375_c1_12767_13759	329
619	3300050512	nmdc:mga0n895_303305_c1	nmdc:mga0n895_303305_c1_250_1239	329
620	3300050512	nmdc:mga0n895_35211_c1	nmdc:mga0n895_35211_c1_305_1297	329
621	3300050512	nmdc:mga0n895_365038_c1	nmdc:mga0n895_365038_c1_310_1302	329
622	3300050515	nmdc:mga0a205_100_c1	nmdc:mga0a205_100_c1_7186_8178	329
623	3300050515	nmdc:mga0a205_389497_c1	nmdc:mga0a205_389497_c1_183_1175	329
624	3300050515	nmdc:mga0a205_48095_c1	nmdc:mga0a205_48095_c1_645_1634	329
625	3300053085	Ga0495619_0001954	Ga0495619_0001954_12426_13427	329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

83

378

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3lft-assembly1.cif.gz_A	the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a	0.8975	29	328
3lft-assembly1.cif.gz_A	the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a	0.8891	29	328
3lkv-assembly1.cif.gz_A-2	crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961	0.8834	27	327
3lft-assembly2.cif.gz_B	the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a	0.8808	31	328
3lkv-assembly1.cif.gz_A-2	crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961	0.8779	27	327

ID	Description	Score	Start	End	Superfamily
3lftA02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.8867	151	328	3.40.50.2300
3lkvA02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.8866	151	327	3.40.50.2300
3lftA02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.8697	151	328	3.40.50.2300
3lkvA02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.8639	151	327	3.40.50.2300
af_P02925_28_128_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.7833	166	251	3.40.50.2300

ID	Description	Score	Start	End
AF-A0A537MMK8-F1-model_v4	ABC transporter substrate-binding protein	0.9645	151	329
AF-A0A7V9HTZ8-F1-model_v4	ABC transporter substrate-binding protein	0.9603	223	329
AF-A0A4V1KUC4-F1-model_v4	ABC transporter substrate-binding protein	0.9589	222	329
AF-A0A536Z3T8-F1-model_v4	ABC transporter substrate-binding protein	0.9562	232	329
AF-A0A537H7S6-F1-model_v4	ABC transporter substrate-binding protein	0.9557	222	329

Feature Viewer

pLDDT	pTM	Quality
90.52	0.84	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F470355

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

83

378

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map