F470401

General Info

Members Datasets Scaffolds Average Seq Length
625 190 583 309

Family's Representative Sequence

Representative Sequence 3300049460|Ga0495682_0000075|Ga0495682_0000075_78828_79871
Length 347
Sequence MRALGSAGLSLLDARCASPGAGTVSEHQTIKGIASMTVTITQSPHVQAFFKDAAGFKNQQGNSRHKHIVLRILQETAKLIEELELTDDEFWGGVEYINRLGRDNEAGLLAAGLGVEHFLDLLHDARQAEAGINGGTPRTIEGPLYVAGAPLREGYDRMDDGSEDGIATPMLLDGQVLDLDGKPVAGALVDLWQADSKGNYSHFDKSQSAFNLRRRIVTDAEGRYRVRSIVPSGYGCNPAGPTQECLNHLGRHGQRPAHVHFFISAPGFEHLTTQINLSNDAYLWDDFAYATRDGLIGEVRFVEDEAKAADHGFSGRFAEMTFDFQLRQAPTPDAERRSNRPRALQDV

Samples

Sample ID Description Type Environment
1 2511231016 Pseudomonas sp. GM50 Isolate Nodule
2 2511231023 Pseudomonas sp. GM80 Isolate Nodule
3 2511231024 Pseudomonas sp. GM84 Isolate Nodule
4 2511231031 Pseudomonas sp. GM16 Isolate Nodule
5 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
6 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
7 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
8 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
9 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
10 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
11 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
12 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
13 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
14 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
15 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
16 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
17 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
18 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
19 2765235841 Pseudomonas putida AA7 Isolate Unclassified
20 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
21 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
22 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
23 2904504865 Serratia marcescens 1822 Isolate Unclassified
24 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
25 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
26 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
27 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
28 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
36 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
62 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
68 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
69 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
70 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
71 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
72 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
73 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
74 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
75 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
76 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
77 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
78 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
79 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
80 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
84 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
91 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
92 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
96 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
150 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
153 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
154 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
175 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
178 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
179 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
180 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
181 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
182 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
183 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
184 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
185 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
186 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
187 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
188 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
189 8052494512 Pseudomonas putida LD6 Isolate Unclassified
190 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.24
Metatranscriptomes 0
Isolates 5.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.52
Nodule 1.76
Rhizoplane 2.24
Rhizosphere 86.88
Stem 0
Stem Tuber 0
Unclassified 5.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000053 3300002737 Bacteria 148653
2 Ga0065704_10002397 3300005289 Bacteria 8099
3 Ga0068853_100195746 3300005539 Bacteria 1838
4 Ga0070665_100176602 3300005548 Bacteria 2137
5 Ga0068856_100141970 3300005614 Bacteria 2409
6 Ga0068863_100378175 3300005841 Bacteria 1383
7 Ga0075432_10000778 3300006058 Bacteria 9934
8 Ga0075432_10034658 3300006058 Bacteria 1754
9 Ga0099823_1000004 3300006944 Bacteria 176518
10 Ga0079104_1004581 3300006946 Bacteria 5839
11 Ga0105251_10000032 3300009011 Bacteria 120825
12 Ga0105251_10003830 3300009011 Bacteria 10716
13 Ga0105251_10006067 3300009011 Bacteria 7786
14 Ga0105251_10012365 3300009011 Bacteria 4831
15 Ga0105251_10017811 3300009011 Bacteria 3796
16 Ga0105251_10020221 3300009011 Bacteria 3501
17 Ga0105251_10035896 3300009011 Bacteria 2443
18 Ga0105244_10000396 3300009036 Bacteria 40375
19 Ga0105244_10000601 3300009036 Bacteria 32060
20 Ga0105244_10004912 3300009036 Bacteria 9048
21 Ga0105244_10012856 3300009036 Bacteria 4929
22 Ga0105244_10014328 3300009036 Bacteria 4588
23 Ga0105250_10000002 3300009092 Bacteria 566949
24 Ga0105250_10000369 3300009092 Bacteria 33604
25 Ga0105250_10007331 3300009092 Bacteria 4741
26 Ga0105250_10059245 3300009092 Bacteria 1538
27 Ga0105240_10405889 3300009093 Bacteria 1534
28 Ga0105243_10161136 3300009148 Bacteria 1934
29 Ga0105249_10392683 3300009553 Bacteria 1416
30 Ga0105239_10090272 3300010375 Bacteria 3380
31 Ga0157345_1000001 3300012498 Bacteria 152919
32 Ga0157370_10040682 3300013104 Bacteria 4487
33 Ga0157369_10000236 3300013105 Bacteria 76415
34 Ga0163163_10078394 3300014325 Bacteria 3300
35 Ga0182008_10003932 3300014497 Bacteria 8795
36 Ga0182008_10148908 3300014497 Bacteria 1173
37 Ga0182007_10004441 3300015262 Bacteria 6356
38 Ga0182005_1013832 3300015265 Bacteria 2267
39 Ga0163161_10000066 3300017792 Bacteria 107442
40 Ga0163161_10040504 3300017792 Bacteria 3346
41 Ga0209675_1002809 3300025291 Bacteria 8678
42 Ga0209676_1001072 3300025292 Bacteria 31080
43 Ga0209676_1002050 3300025292 Bacteria 15754
44 Ga0207696_1000266 3300025711 Bacteria 65599
45 Ga0207696_1000292 3300025711 Bacteria 58466
46 Ga0207696_1007305 3300025711 Bacteria 4339
47 Ga0207696_1013381 3300025711 Bacteria 2861
48 Ga0207696_1021381 3300025711 Bacteria 2072
49 Ga0207655_1000049 3300025728 Bacteria 295872
50 Ga0207655_1000094 3300025728 Bacteria 196748
51 Ga0207655_1000497 3300025728 Bacteria 50628
52 Ga0207655_1008700 3300025728 Bacteria 6402
53 Ga0207713_1000020 3300025735 Bacteria 359258
54 Ga0207713_1000143 3300025735 Bacteria 107175
55 Ga0207713_1000697 3300025735 Bacteria 31485
56 Ga0207713_1001102 3300025735 Bacteria 23108
57 Ga0207713_1009694 3300025735 Bacteria 5397
58 Ga0207713_1018578 3300025735 Bacteria 3437
59 Ga0207713_1073863 3300025735 Bacteria 1250
60 Ga0207709_10292723 3300025935 Bacteria 1207
61 Ga0207712_10189288 3300025961 Bacteria 1623
62 Ga0207702_10265090 3300026078 Bacteria 1619
63 Ga0207641_10320411 3300026088 Bacteria 1470
64 Ga0209281_1003600 3300027111 Bacteria 5032
65 Ga0209389_1000006 3300027296 Bacteria 231635
66 Ga0207428_10029040 3300027907 Bacteria 4588
67 Ga0207428_10220732 3300027907 Bacteria 1421
68 Ga0207428_10247714 3300027907 Bacteria 1329
69 Ga0268266_10210896 3300028379 Bacteria 1781
70 Ga0307408_100016185 3300031548 Bacteria 4973
71 Ga0307414_10086769 3300032004 Bacteria 2310
72 Ga0307510_10000098 3300033180 Bacteria 67319
73 Ga0307510_10000175 3300033180 Bacteria 54436
74 Ga0307510_10012596 3300033180 Bacteria 10026
75 Ga0439438_000034 3300041405 Bacteria 68456
76 Ga0439438_009224 3300041405 Bacteria 3208
77 Ga0439447_000005 3300041407 Bacteria 103186
78 Ga0439447_001401 3300041407 Bacteria 8836
79 Ga0439447_002402 3300041407 Bacteria 6842
80 Ga0439447_004918 3300041407 Bacteria 4520
81 Ga0439466_0000027 3300041411 Bacteria 78182
82 Ga0439466_0001327 3300041411 Bacteria 9642
83 Ga0439466_0005726 3300041411 Bacteria 4738
84 Ga0439466_0011859 3300041411 Bacteria 3219
85 Ga0439432_001881 3300042006 Bacteria 7902
86 Ga0439432_007958 3300042006 Bacteria 3737
87 Ga0439452_000073 3300042010 Bacteria 88504
88 Ga0439452_000151 3300042010 Bacteria 51160
89 Ga0439452_000819 3300042010 Bacteria 14476
90 Ga0450902_000747 3300042137 Bacteria 4175
91 Ga0450905_004637 3300042142 Bacteria 1825
92 Ga0450909_002083 3300042185 Bacteria 2820
93 Ga0439434_0000002 3300042435 Bacteria 76713
94 Ga0439464_0007222 3300042439 Bacteria 2903
95 Ga0450901_000386 3300042533 Bacteria 5331
96 Ga0495617_000159 3300046452 Bacteria 42981
97 Ga0495617_000211 3300046452 Bacteria 35959
98 Ga0495617_002191 3300046452 Bacteria 7993
99 Ga0495617_002304 3300046452 Bacteria 7698
100 Ga0495617_002943 3300046452 Bacteria 6532
101 Ga0495617_007977 3300046452 Bacteria 3660
102 Ga0495617_008449 3300046452 Bacteria 3549
103 Ga0495617_014843 3300046452 Bacteria 2645
104 Ga0495617_018878 3300046452 Bacteria 2332
105 Ga0495617_063997 3300046452 Bacteria 1214
106 Ga0495627_000031 3300046453 Bacteria 226981
107 Ga0495627_000149 3300046453 Bacteria 82984
108 Ga0495627_000275 3300046453 Bacteria 51976
109 Ga0495627_000408 3300046453 Bacteria 37948
110 Ga0495627_001318 3300046453 Bacteria 15129
111 Ga0495627_001440 3300046453 Bacteria 13971
112 Ga0495627_008949 3300046453 Bacteria 3703
113 Ga0495627_019946 3300046453 Bacteria 2241
114 Ga0495592_0000273 3300046454 Bacteria 44143
115 Ga0495603_0000214 3300046455 Bacteria 29899
116 Ga0495590_0000050 3300046457 Bacteria 105727
117 Ga0495590_0000170 3300046457 Bacteria 38656
118 Ga0495590_0000995 3300046457 Bacteria 12494
119 Ga0495590_0001484 3300046457 Bacteria 10114
120 Ga0495590_0002625 3300046457 Bacteria 7434
121 Ga0495590_0005851 3300046457 Bacteria 4829
122 Ga0495590_0010330 3300046457 Bacteria 3513
123 Ga0495591_000123 3300046458 Bacteria 84832
124 Ga0495591_000158 3300046458 Bacteria 72313
125 Ga0495591_000239 3300046458 Bacteria 52720
126 Ga0495591_000660 3300046458 Bacteria 25510
127 Ga0495591_002155 3300046458 Bacteria 11274
128 Ga0495591_002185 3300046458 Bacteria 11175
129 Ga0495591_002353 3300046458 Bacteria 10626
130 Ga0495591_004251 3300046458 Bacteria 7092
131 Ga0495591_005042 3300046458 Bacteria 6212
132 Ga0495591_007869 3300046458 Bacteria 4451
133 Ga0495591_008238 3300046458 Bacteria 4294
134 Ga0495591_014104 3300046458 Bacteria 2888
135 Ga0495629_0003706 3300046459 Bacteria 11515
136 Ga0495629_0007492 3300046459 Bacteria 8046
137 Ga0495638_0001488 3300046460 Bacteria 21180
138 Ga0495638_0002726 3300046460 Bacteria 14202
139 Ga0495638_0032884 3300046460 Bacteria 3319
140 Ga0495638_0039996 3300046460 Bacteria 2973
141 Ga0495638_0041289 3300046460 Bacteria 2919
142 Ga0495638_0047821 3300046460 Bacteria 2680
143 Ga0495653_0002519 3300046463 Bacteria 14582
144 Ga0495653_0006708 3300046463 Bacteria 9449
145 Ga0495653_0016602 3300046463 Bacteria 5993
146 Ga0495653_0031790 3300046463 Bacteria 4194
147 Ga0495650_0000101 3300046471 Bacteria 212903
148 Ga0495650_0000180 3300046471 Bacteria 137884
149 Ga0495650_0001922 3300046471 Bacteria 18402
150 Ga0495650_0007694 3300046471 Bacteria 6421
151 Ga0495650_0009818 3300046471 Bacteria 5405
152 Ga0495650_0011075 3300046471 Bacteria 4974
153 Ga0495650_0057848 3300046471 Bacteria 1567
154 Ga0495650_0098316 3300046471 Bacteria 1102
155 Ga0495580_0200532 3300046472 Bacteria 1375
156 Ga0495605_0000078 3300046474 Bacteria 127220
157 Ga0495605_0000272 3300046474 Bacteria 58560
158 Ga0495605_0000718 3300046474 Bacteria 24384
159 Ga0495605_0001557 3300046474 Bacteria 14892
160 Ga0495605_0004797 3300046474 Bacteria 7906
161 Ga0495605_0005569 3300046474 Bacteria 7327
162 Ga0495605_0016661 3300046474 Bacteria 3974
163 Ga0495605_0033614 3300046474 Bacteria 2601
164 Ga0495605_0034702 3300046474 Bacteria 2554
165 Ga0495605_0063150 3300046474 Bacteria 1767
166 Ga0495664_0116562 3300046477 Bacteria 1614
167 Ga0495584_0000393 3300046491 Bacteria 30132
168 Ga0495584_0000997 3300046491 Bacteria 17749
169 Ga0495584_0001248 3300046491 Bacteria 15535
170 Ga0495584_0053056 3300046491 Bacteria 2040
171 Ga0495584_0116806 3300046491 Bacteria 1350
172 Ga0495585_0000533 3300046492 Bacteria 35989
173 Ga0495585_0000890 3300046492 Bacteria 25302
174 Ga0495585_0001093 3300046492 Bacteria 22342
175 Ga0495585_0002492 3300046492 Bacteria 13124
176 Ga0495585_0006312 3300046492 Bacteria 7364
177 Ga0495585_0020843 3300046492 Bacteria 3766
178 Ga0495585_0029957 3300046492 Bacteria 3096
179 Ga0495585_0049863 3300046492 Bacteria 2323
180 Ga0495585_0064463 3300046492 Bacteria 2009
181 Ga0495594_0000218 3300046499 Bacteria 27958
182 Ga0495596_0009603 3300046500 Bacteria 4251
183 Ga0495596_0010375 3300046500 Bacteria 4057
184 Ga0495596_0027871 3300046500 Bacteria 2268
185 Ga0495607_0000025 3300046501 Bacteria 159379
186 Ga0495607_0000297 3300046501 Bacteria 52112
187 Ga0495607_0001725 3300046501 Bacteria 18726
188 Ga0495607_0002617 3300046501 Bacteria 14466
189 Ga0495607_0003607 3300046501 Bacteria 11760
190 Ga0495607_0004983 3300046501 Bacteria 9636
191 Ga0495607_0009424 3300046501 Bacteria 6609
192 Ga0495607_0016210 3300046501 Bacteria 4812
193 Ga0495607_0026026 3300046501 Bacteria 3632
194 Ga0495607_0039010 3300046501 Bacteria 2839
195 Ga0495607_0050182 3300046501 Bacteria 2430
196 Ga0495607_0118820 3300046501 Unclassified 1391
197 Ga0495607_0120922 3300046501 Bacteria 1375
198 Ga0495607_0184035 3300046501 Bacteria 1045
199 Ga0495583_0000114 3300046506 Bacteria 136026
200 Ga0495583_0000167 3300046506 Bacteria 111792
201 Ga0495583_0000347 3300046506 Bacteria 73058
202 Ga0495583_0000611 3300046506 Bacteria 48395
203 Ga0495583_0011037 3300046506 Bacteria 5208
204 Ga0495583_0019613 3300046506 Bacteria 3525
205 Ga0495583_0090474 3300046506 Bacteria 1318
206 Ga0495606_0000023 3300046507 Bacteria 265019
207 Ga0495606_0000339 3300046507 Bacteria 80460
208 Ga0495606_0000875 3300046507 Bacteria 45063
209 Ga0495606_0001415 3300046507 Bacteria 32260
210 Ga0495606_0017969 3300046507 Bacteria 5320
211 Ga0495606_0102830 3300046507 Bacteria 1736
212 Ga0495610_0000359 3300046512 Bacteria 47594
213 Ga0495610_0000900 3300046512 Bacteria 27631
214 Ga0495610_0002690 3300046512 Bacteria 14656
215 Ga0495610_0002771 3300046512 Bacteria 14363
216 Ga0495610_0021964 3300046512 Bacteria 3499
217 Ga0495610_0027507 3300046512 Bacteria 3021
218 Ga0495610_0040130 3300046512 Bacteria 2362
219 Ga0495610_0138980 3300046512 Bacteria 1047
220 Ga0495616_0000029 3300046513 Bacteria 133328
221 Ga0495616_0000121 3300046513 Bacteria 68406
222 Ga0495616_0000612 3300046513 Bacteria 26894
223 Ga0495616_0001049 3300046513 Bacteria 19720
224 Ga0495616_0001170 3300046513 Bacteria 18565
225 Ga0495616_0001687 3300046513 Bacteria 15057
226 Ga0495616_0010309 3300046513 Bacteria 5414
227 Ga0495616_0035520 3300046513 Unclassified 2578
228 Ga0495616_0050994 3300046513 Bacteria 2066
229 Ga0495620_0000134 3300046515 Bacteria 60718
230 Ga0495620_0001467 3300046515 Bacteria 14107
231 Ga0495620_0002054 3300046515 Bacteria 11722
232 Ga0495620_0006719 3300046515 Bacteria 6296
233 Ga0495620_0011925 3300046515 Bacteria 4515
234 Ga0495620_0023850 3300046515 Bacteria 2917
235 Ga0495620_0026959 3300046515 Bacteria 2695
236 Ga0495620_0078700 3300046515 Bacteria 1336
237 Ga0495628_0018894 3300046516 Bacteria 5704
238 Ga0495628_0069392 3300046516 Bacteria 2749
239 Ga0495628_0161634 3300046516 Bacteria 1702
240 Ga0495630_0006243 3300046517 Bacteria 8456
241 Ga0495631_0000151 3300046518 Bacteria 47384
242 Ga0495631_0000411 3300046518 Bacteria 29557
243 Ga0495631_0007388 3300046518 Bacteria 5586
244 Ga0495631_0024313 3300046518 Bacteria 2797
245 Ga0495631_0050841 3300046518 Bacteria 1812
246 Ga0495631_0060973 3300046518 Bacteria 1636
247 Ga0495632_0000031 3300046519 Bacteria 166613
248 Ga0495632_0000111 3300046519 Bacteria 83663
249 Ga0495632_0000127 3300046519 Bacteria 77378
250 Ga0495632_0000361 3300046519 Bacteria 43155
251 Ga0495632_0000600 3300046519 Bacteria 33355
252 Ga0495632_0001061 3300046519 Bacteria 23597
253 Ga0495632_0001317 3300046519 Bacteria 20911
254 Ga0495632_0001440 3300046519 Bacteria 19816
255 Ga0495632_0001720 3300046519 Bacteria 17793
256 Ga0495632_0004574 3300046519 Bacteria 9376
257 Ga0495632_0041507 3300046519 Bacteria 2311
258 Ga0495632_0046042 3300046519 Bacteria 2169
259 Ga0495637_0000017 3300046520 Bacteria 209676
260 Ga0495637_0000081 3300046520 Bacteria 74206
261 Ga0495637_0000261 3300046520 Bacteria 41729
262 Ga0495637_0001340 3300046520 Bacteria 14772
263 Ga0495637_0001719 3300046520 Bacteria 12588
264 Ga0495637_0003248 3300046520 Bacteria 8670
265 Ga0495637_0003553 3300046520 Bacteria 8262
266 Ga0495637_0009846 3300046520 Bacteria 4648
267 Ga0495637_0010420 3300046520 Bacteria 4496
268 Ga0495637_0011319 3300046520 Bacteria 4290
269 Ga0495637_0022974 3300046520 Bacteria 2838
270 Ga0495643_0000523 3300046522 Bacteria 47863
271 Ga0495643_0000604 3300046522 Bacteria 43306
272 Ga0495643_0001208 3300046522 Bacteria 25052
273 Ga0495643_0003132 3300046522 Bacteria 12337
274 Ga0495643_0004340 3300046522 Bacteria 9951
275 Ga0495643_0005803 3300046522 Bacteria 8264
276 Ga0495643_0036978 3300046522 Bacteria 2680
277 Ga0495643_0056456 3300046522 Bacteria 2096
278 Ga0495644_0000081 3300046523 Bacteria 46968
279 Ga0495644_0000448 3300046523 Bacteria 18156
280 Ga0495644_0033971 3300046523 Unclassified 1925
281 Ga0495644_0082090 3300046523 Bacteria 1215
282 Ga0495648_0000261 3300046524 Bacteria 59739
283 Ga0495648_0000352 3300046524 Bacteria 50673
284 Ga0495648_0000768 3300046524 Bacteria 34207
285 Ga0495648_0002261 3300046524 Bacteria 17993
286 Ga0495648_0002309 3300046524 Bacteria 17758
287 Ga0495648_0003397 3300046524 Bacteria 13994
288 Ga0495648_0006119 3300046524 Bacteria 9867
289 Ga0495648_0007455 3300046524 Bacteria 8749
290 Ga0495648_0019288 3300046524 Bacteria 4801
291 Ga0495648_0023683 3300046524 Bacteria 4197
292 Ga0495648_0026697 3300046524 Bacteria 3883
293 Ga0495648_0026987 3300046524 Unclassified 3854
294 Ga0495648_0028649 3300046524 Unclassified 3706
295 Ga0495648_0037968 3300046524 Bacteria 3088
296 Ga0495648_0042191 3300046524 Bacteria 2872
297 Ga0495648_0043493 3300046524 Bacteria 2814
298 Ga0495648_0044358 3300046524 Bacteria 2776
299 Ga0495648_0230294 3300046524 Bacteria 907
300 Ga0495666_0000035 3300046526 Bacteria 51902
301 Ga0495642_0000026 3300046528 Bacteria 90898
302 Ga0495652_0017341 3300046529 Bacteria 6427
303 Ga0495652_0050711 3300046529 Bacteria 3547
304 Ga0495654_0000050 3300046530 Bacteria 146814
305 Ga0495654_0000075 3300046530 Bacteria 113720
306 Ga0495654_0000158 3300046530 Bacteria 67310
307 Ga0495654_0000579 3300046530 Bacteria 29441
308 Ga0495654_0000932 3300046530 Bacteria 21734
309 Ga0495654_0001654 3300046530 Bacteria 15085
310 Ga0495654_0001696 3300046530 Bacteria 14805
311 Ga0495654_0004573 3300046530 Bacteria 8177
312 Ga0495654_0006775 3300046530 Bacteria 6474
313 Ga0495654_0012928 3300046530 Bacteria 4477
314 Ga0495654_0022413 3300046530 Bacteria 3280
315 Ga0495654_0025686 3300046530 Bacteria 3033
316 Ga0495654_0036176 3300046530 Bacteria 2483
317 Ga0495654_0044799 3300046530 Bacteria 2185
318 Ga0495654_0065588 3300046530 Bacteria 1733
319 Ga0495665_0000502 3300046531 Bacteria 19684
320 Ga0495587_0000054 3300046536 Bacteria 97507
321 Ga0495587_0193097 3300046536 Bacteria 1153
322 Ga0495609_0000013 3300046538 Bacteria 328540
323 Ga0495609_0001255 3300046538 Bacteria 17434
324 Ga0495609_0001416 3300046538 Bacteria 16016
325 Ga0495609_0001497 3300046538 Bacteria 15437
326 Ga0495609_0002782 3300046538 Bacteria 10524
327 Ga0495609_0005713 3300046538 Bacteria 6477
328 Ga0495609_0015151 3300046538 Bacteria 3612
329 Ga0495609_0023466 3300046538 Bacteria 2835
330 Ga0495609_0035387 3300046538 Bacteria 2260
331 Ga0495609_0059827 3300046538 Bacteria 1684
332 Ga0495609_0073163 3300046538 Unclassified 1504
333 Ga0495597_0000011 3300046542 Bacteria 221377
334 Ga0495597_0003655 3300046542 Bacteria 8830
335 Ga0495597_0005938 3300046542 Bacteria 6371
336 Ga0495597_0022270 3300046542 Bacteria 2940
337 Ga0495597_0028848 3300046542 Bacteria 2536
338 Ga0495645_0012624 3300046543 Bacteria 5957
339 Ga0495622_0000046 3300046557 Bacteria 110625
340 Ga0495622_0000066 3300046557 Bacteria 92491
341 Ga0495622_0000086 3300046557 Bacteria 83162
342 Ga0495622_0005565 3300046557 Bacteria 5842
343 Ga0495633_0007167 3300046558 Bacteria 6464
344 Ga0495633_0019178 3300046558 Bacteria 3460
345 Ga0495656_0182885 3300046615 Unclassified 1031
346 Ga0495668_0001423 3300046616 Bacteria 23205
347 Ga0495668_0009818 3300046616 Bacteria 5842
348 Ga0495668_0011156 3300046616 Bacteria 5397
349 Ga0495668_0013819 3300046616 Bacteria 4749
350 Ga0495668_0038695 3300046616 Bacteria 2664
351 Ga0495668_0056983 3300046616 Unclassified 2156
352 Ga0495634_0000169 3300046642 Bacteria 60237
353 Ga0495611_0000019 3300046648 Bacteria 126076
354 Ga0495611_0000024 3300046648 Bacteria 118898
355 Ga0495611_0000041 3300046648 Bacteria 98699
356 Ga0495611_0000427 3300046648 Bacteria 26104
357 Ga0495611_0017536 3300046648 Bacteria 3063
358 Ga0495611_0045921 3300046648 Bacteria 1957
359 Ga0495611_0050121 3300046648 Bacteria 1880
360 Ga0495625_0000016 3300046660 Bacteria 311353
361 Ga0495625_0000387 3300046660 Bacteria 67320
362 Ga0495625_0001351 3300046660 Bacteria 30318
363 Ga0495625_0004052 3300046660 Bacteria 14003
364 Ga0495625_0017314 3300046660 Bacteria 5644
365 Ga0495625_0040310 3300046660 Bacteria 3407
366 Ga0495625_0044862 3300046660 Bacteria 3198
367 Ga0495625_0046447 3300046660 Bacteria 3134
368 Ga0495625_0087090 3300046660 Bacteria 2165
369 Ga0495635_0000033 3300046663 Bacteria 104638
370 Ga0495635_0223184 3300046663 Bacteria 1274
371 Ga0495659_0018682 3300046664 Bacteria 2312
372 Ga0495661_0000001 3300046665 Bacteria 898372
373 Ga0495661_0000276 3300046665 Bacteria 59027
374 Ga0495661_0002224 3300046665 Bacteria 15086
375 Ga0495661_0009529 3300046665 Bacteria 6662
376 Ga0495661_0020664 3300046665 Bacteria 4295
377 Ga0495661_0032230 3300046665 Bacteria 3314
378 Ga0495661_0040973 3300046665 Bacteria 2868
379 Ga0495661_0101707 3300046665 Bacteria 1616
380 Ga0495588_0001613 3300046674 Bacteria 9626
381 Ga0495588_0022239 3300046674 Bacteria 3133
382 Ga0495588_0032784 3300046674 Bacteria 2620
383 Ga0495599_0060130 3300046678 Bacteria 2376
384 Ga0495623_0000234 3300046679 Bacteria 35834
385 Ga0495623_0147223 3300046679 Bacteria 1395
386 Ga0495646_0000147 3300046680 Bacteria 35451
387 Ga0495646_0113020 3300046680 Bacteria 1544
388 Ga0495669_0006563 3300046684 Bacteria 4864
389 Ga0495669_0012064 3300046684 Bacteria 3674
390 Ga0495613_0033675 3300046689 Bacteria 3805
391 Ga0495624_0000014 3300046690 Bacteria 111102
392 Ga0495624_0005066 3300046690 Bacteria 9529
393 Ga0495670_0000018 3300046691 Bacteria 115019
394 Ga0495670_0000021 3300046691 Bacteria 104769
395 Ga0495670_0000046 3300046691 Bacteria 65784
396 Ga0495670_0000206 3300046691 Bacteria 26640
397 Ga0495670_0000612 3300046691 Bacteria 17074
398 Ga0495670_0001155 3300046691 Bacteria 12830
399 Ga0495670_0031368 3300046691 Bacteria 2640
400 Ga0495671_0000153 3300046692 Bacteria 60065
401 Ga0495671_0000540 3300046692 Bacteria 28569
402 Ga0495671_0001075 3300046692 Bacteria 18899
403 Ga0495671_0002114 3300046692 Bacteria 12692
404 Ga0495671_0003136 3300046692 Bacteria 10275
405 Ga0495671_0003204 3300046692 Bacteria 10168
406 Ga0495671_0004538 3300046692 Bacteria 8278
407 Ga0495671_0015404 3300046692 Bacteria 4095
408 Ga0495671_0019934 3300046692 Bacteria 3539
409 Ga0495671_0038921 3300046692 Bacteria 2402
410 Ga0495671_0043687 3300046692 Bacteria 2249
411 Ga0495671_0092888 3300046692 Bacteria 1476
412 Ga0495649_0000079 3300046694 Bacteria 83486
413 Ga0495649_0003282 3300046694 Bacteria 11014
414 Ga0495649_0003379 3300046694 Bacteria 10793
415 Ga0495649_0009298 3300046694 Bacteria 5850
416 Ga0495649_0014319 3300046694 Bacteria 4549
417 Ga0495649_0022516 3300046694 Bacteria 3525
418 Ga0495649_0023485 3300046694 Bacteria 3445
419 Ga0495649_0043886 3300046694 Bacteria 2440
420 Ga0495649_0045738 3300046694 Bacteria 2385
421 Ga0495649_0072943 3300046694 Bacteria 1839
422 Ga0495649_0112304 3300046694 Bacteria 1444
423 Ga0495589_0000440 3300046794 Bacteria 30537
424 Ga0495589_0001491 3300046794 Bacteria 13467
425 Ga0495589_0002588 3300046794 Bacteria 10058
426 Ga0495589_0002699 3300046794 Bacteria 9804
427 Ga0495589_0004429 3300046794 Bacteria 7479
428 Ga0495589_0090936 3300046794 Bacteria 1482
429 Ga0495600_0007621 3300046809 Bacteria 6631
430 Ga0495660_0000179 3300046810 Bacteria 68653
431 Ga0495660_0000234 3300046810 Bacteria 54439
432 Ga0495660_0000414 3300046810 Bacteria 36352
433 Ga0495660_0002886 3300046810 Bacteria 10805
434 Ga0495660_0007167 3300046810 Bacteria 6567
435 Ga0495660_0009778 3300046810 Bacteria 5586
436 Ga0495660_0009908 3300046810 Bacteria 5545
437 Ga0495660_0039193 3300046810 Bacteria 2631
438 Ga0495660_0072237 3300046810 Bacteria 1827
439 Ga0495660_0083000 3300046810 Bacteria 1676
440 Ga0495660_0090648 3300046810 Bacteria 1589
441 Ga0495660_0091341 3300046810 Bacteria 1582
442 Ga0495581_0013764 3300047315 Bacteria 4691
443 Ga0495604_0000094 3300047317 Bacteria 76004
444 Ga0495604_0002615 3300047317 Bacteria 14441
445 Ga0495636_0000265 3300047318 Bacteria 20711
446 Ga0495636_0008243 3300047318 Bacteria 4113
447 Ga0495636_0019752 3300047318 Bacteria 2710
448 Ga0495674_0000058 3300047319 Bacteria 73405
449 Ga0495674_0065923 3300047319 Bacteria 3143
450 Ga0495672_0000488 3300047320 Bacteria 46246
451 Ga0495672_0000524 3300047320 Bacteria 43828
452 Ga0495672_0000598 3300047320 Bacteria 40592
453 Ga0495672_0000893 3300047320 Bacteria 31321
454 Ga0495672_0000934 3300047320 Bacteria 30487
455 Ga0495672_0001199 3300047320 Bacteria 26191
456 Ga0495672_0002362 3300047320 Bacteria 17434
457 Ga0495672_0026050 3300047320 Bacteria 3735
458 Ga0495672_0068336 3300047320 Bacteria 2020
459 Ga0495676_0000001 3300047321 Bacteria 624167
460 Ga0495676_0000041 3300047321 Bacteria 104634
461 Ga0495676_0000050 3300047321 Bacteria 97800
462 Ga0495680_0000133 3300047322 Bacteria 74109
463 Ga0495680_0008797 3300047322 Bacteria 9147
464 Ga0495680_0169582 3300047322 Unclassified 1581
465 Ga0495683_0000073 3300047323 Bacteria 101074
466 Ga0495683_0000456 3300047323 Bacteria 32056
467 Ga0495683_0005519 3300047323 Bacteria 7011
468 Ga0495683_0006337 3300047323 Bacteria 6468
469 Ga0495683_0007210 3300047323 Bacteria 6034
470 Ga0495683_0019490 3300047323 Bacteria 3500
471 Ga0495683_0019707 3300047323 Bacteria 3481
472 Ga0495683_0120160 3300047323 Bacteria 1247
473 Ga0495687_000159 3300047443 Bacteria 101178
474 Ga0495687_001282 3300047443 Bacteria 23671
475 Ga0495675_0012459 3300047444 Bacteria 5353
476 Ga0495679_000053 3300047446 Bacteria 119015
477 Ga0495679_000064 3300047446 Bacteria 102509
478 Ga0495679_000278 3300047446 Bacteria 42823
479 Ga0495679_001197 3300047446 Bacteria 15418
480 Ga0495679_002451 3300047446 Bacteria 9448
481 Ga0495679_005384 3300047446 Bacteria 5678
482 Ga0495679_011585 3300047446 Bacteria 3395
483 Ga0495679_014529 3300047446 Bacteria 2912
484 Ga0495679_053635 3300047446 Bacteria 1203
485 Ga0495673_0000477 3300047469 Bacteria 43268
486 Ga0495673_0000582 3300047469 Bacteria 36759
487 Ga0495673_0002099 3300047469 Bacteria 14505
488 Ga0495673_0004137 3300047469 Bacteria 9180
489 Ga0495673_0008888 3300047469 Bacteria 5600
490 Ga0495673_0012498 3300047469 Bacteria 4498
491 Ga0495673_0013173 3300047469 Bacteria 4353
492 Ga0495673_0020585 3300047469 Bacteria 3281
493 Ga0495673_0022415 3300047469 Bacteria 3096
494 Ga0495673_0045360 3300047469 Bacteria 1954
495 Ga0495673_0050842 3300047469 Bacteria 1817
496 Ga0495673_0054166 3300047469 Bacteria 1746
497 Ga0495673_0054714 3300047469 Bacteria 1734
498 Ga0495673_0080563 3300047469 Bacteria 1349
499 Ga0495673_0088466 3300047469 Bacteria 1269
500 Ga0495681_0000034 3300047470 Bacteria 125396
501 Ga0495681_0000068 3300047470 Bacteria 96387
502 Ga0495681_0000116 3300047470 Bacteria 69786
503 Ga0495681_0000487 3300047470 Bacteria 30516
504 Ga0495681_0007899 3300047470 Bacteria 6727
505 Ga0495686_0001403 3300047472 Bacteria 26593
506 Ga0495686_0003734 3300047472 Bacteria 12982
507 Ga0495686_0005220 3300047472 Bacteria 10321
508 Ga0495686_0016240 3300047472 Bacteria 5053
509 Ga0495686_0047060 3300047472 Bacteria 2724
510 Ga0495593_0003808 3300047673 Bacteria 9010
511 Ga0495593_0007637 3300047673 Bacteria 6315
512 Ga0495593_0036625 3300047673 Bacteria 2659
513 Ga0495602_0000129 3300048088 Bacteria 71215
514 Ga0495602_0007489 3300048088 Bacteria 11417
515 Ga0495626_0000002 3300048091 Bacteria 436012
516 Ga0495626_0000073 3300048091 Bacteria 133813
517 Ga0495626_0000119 3300048091 Bacteria 102920
518 Ga0495626_0000185 3300048091 Bacteria 75817
519 Ga0495626_0000199 3300048091 Bacteria 72605
520 Ga0495626_0004794 3300048091 Bacteria 8162
521 Ga0495626_0018750 3300048091 Bacteria 3467
522 Ga0495626_0056973 3300048091 Bacteria 1788
523 Ga0496101_0176097 3300048904 Bacteria 1645
524 Ga0496102_0198308 3300048905 Bacteria 1892
525 Ga0496104_0010228 3300048907 Bacteria 8376
526 Ga0496104_0133363 3300048907 Bacteria 2386
527 Ga0496109_0062962 3300048912 Bacteria 3392
528 Ga0496110_0033428 3300048913 Bacteria 4448
529 Ga0496110_0068493 3300048913 Bacteria 3141
530 Ga0496110_0093069 3300048913 Bacteria 2698
531 Ga0496114_0043354 3300048917 Bacteria 3730
532 Ga0496114_0128134 3300048917 Bacteria 2190
533 Ga0496116_0001846 3300048919 Bacteria 22919
534 Ga0496117_0002527 3300048920 Bacteria 22906
535 Ga0496118_0000966 3300048921 Bacteria 44919
536 Ga0496118_0019391 3300048921 Bacteria 6080
537 Ga0496121_0011359 3300048924 Bacteria 9900
538 Ga0496121_0098087 3300048924 Bacteria 2268
539 Ga0496121_0194669 3300048924 Bacteria 1450
540 Ga0496122_0000388 3300048925 Bacteria 93611
541 Ga0496122_0125206 3300048925 Bacteria 1646
542 Ga0496123_0000551 3300048926 Bacteria 64142
543 Ga0496123_0002532 3300048926 Bacteria 22409
544 Ga0496124_0029577 3300048927 Bacteria 4878
545 Ga0496125_0006921 3300048928 Bacteria 12140
546 Ga0496125_0016722 3300048928 Bacteria 7034
547 Ga0496126_0092124 3300048929 Bacteria 2663
548 Ga0495678_000008 3300049459 Bacteria 445926
549 Ga0495678_000614 3300049459 Bacteria 33355
550 Ga0495678_002554 3300049459 Bacteria 12195
551 Ga0495678_003045 3300049459 Bacteria 10652
552 Ga0495678_010677 3300049459 Bacteria 4443
553 Ga0495678_013661 3300049459 Unclassified 3801
554 Ga0495678_016258 3300049459 Bacteria 3406
555 Ga0495678_031024 3300049459 Bacteria 2232
556 Ga0495678_060735 3300049459 Bacteria 1421
557 Ga0495678_085320 3300049459 Bacteria 1124
558 Ga0495682_0000075 3300049460 Bacteria 91041
559 Ga0495682_0000211 3300049460 Bacteria 46828
560 Ga0495682_0002353 3300049460 Bacteria 8984
561 Ga0495682_0013008 3300049460 Bacteria 3175
562 Ga0495682_0013027 3300049460 Bacteria 3172
563 Ga0501034_0000003 3300049571 Bacteria 471748
564 Ga0501034_0142631 3300049571 Bacteria 2374
565 Ga0501034_0166775 3300049571 Bacteria 2171
566 Ga0500572_000005 3300053111 Bacteria 84950
567 Ga0500572_000009 3300053111 Bacteria 68641
568 Ga0500572_000472 3300053111 Bacteria 13973
569 Ga0500592_000233 3300053116 Bacteria 10057
570 Ga0500618_006035 3300053125 Bacteria 3599
571 Ga0500659_0000019 3300053135 Bacteria 65589
572 Ga0500659_0000385 3300053135 Bacteria 28387
573 Ga0500659_0005740 3300053135 Bacteria 6937
574 Ga0500659_0006147 3300053135 Bacteria 6676
575 Ga0500568_0010802 3300053139 Bacteria 4260
576 Ga0500568_0023865 3300053139 Bacteria 2596
577 Ga0500586_000037 3300053145 Bacteria 23337
578 Ga0500586_043929 3300053145 Bacteria 1524
579 Ga0500622_0003174 3300053156 Bacteria 11238
580 Ga0500624_000039 3300053157 Bacteria 93415
581 Ga0500627_0038260 3300053158 Bacteria 2050
582 Ga0500636_0100690 3300053177 Bacteria 1643
583 Ga0500637_0001192 3300053178 Bacteria 10823

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046524 Ga0495648_0230294 Ga0495648_0230294_17_871 282
2 3300049571 Ga0501034_0166775 Ga0501034_0166775_739_1668 284
3 3300032004 Ga0307414_10086769 Ga0307414_100867691 286
4 3300046524 Ga0495648_0000352 Ga0495648_0000352_28199_29134 286
5 3300014497 Ga0182008_10003932 Ga0182008_100039324 288
6 3300046694 Ga0495649_0014319 Ga0495649_0014319_577_1506 288
7 3300053125 Ga0500618_006035 Ga0500618_006035_59_988 288
8 3300047443 Ga0495687_001282 Ga0495687_001282_4417_5355 294
9 iso_pu_bacteria 2511231023 2511368942 295
10 3300046522 Ga0495643_0001208 Ga0495643_0001208_21390_22325 297
11 iso_pu_bacteria 2511231024 2511374482 297
12 iso_pu_bacteria 2600255318 2601799344 297
13 iso_pu_bacteria 2603880185 2606078424 297
14 iso_pu_bacteria 2603880199 2606130532 297
15 iso_pu_bacteria 2713897149 2715758659 297
16 iso_pu_bacteria 2765235841 2765583909 297
17 iso_pu_bacteria 2878029506 2878032233 297
18 iso_pu_bacteria 8052494512 8052497402 297
19 iso_pu_bacteria 8054929484 8054932616 297
20 iso_pu_bacteria 2511231031 2511414523 298
21 iso_pu_bacteria 2969304461 2969307121 298
22 iso_pu_bacteria 3007614139 3007614411 298
23 3300046452 Ga0495617_063997 Ga0495617_063997_85_993 299
24 3300046458 Ga0495591_002185 Ga0495591_002185_887_1792 299
25 3300046459 Ga0495629_0003706 Ga0495629_0003706_50_955 299
26 3300046463 Ga0495653_0016602 Ga0495653_0016602_2819_3724 299
27 3300046472 Ga0495580_0200532 Ga0495580_0200532_351_1256 299
28 3300046474 Ga0495605_0063150 Ga0495605_0063150_51_956 299
29 3300046477 Ga0495664_0116562 Ga0495664_0116562_101_1006 299
30 3300046492 Ga0495585_0001093 Ga0495585_0001093_4225_5130 299
31 3300046492 Ga0495585_0002492 Ga0495585_0002492_8561_9466 299
32 3300046501 Ga0495607_0120922 Ga0495607_0120922_53_958 299
33 3300046506 Ga0495583_0090474 Ga0495583_0090474_165_1073 299
34 3300046507 Ga0495606_0000339 Ga0495606_0000339_17203_18108 299
35 3300046512 Ga0495610_0000359 Ga0495610_0000359_21871_22776 299
36 3300046516 Ga0495628_0018894 Ga0495628_0018894_4417_5322 299
37 3300046516 Ga0495628_0069392 Ga0495628_0069392_1814_2722 299
38 3300046516 Ga0495628_0161634 Ga0495628_0161634_590_1489 299
39 3300046518 Ga0495631_0050841 Ga0495631_0050841_577_1485 299
40 3300046524 Ga0495648_0026697 Ga0495648_0026697_1099_2007 299
41 3300046529 Ga0495652_0050711 Ga0495652_0050711_1216_2121 299
42 3300046530 Ga0495654_0022413 Ga0495654_0022413_1982_2890 299
43 3300046531 Ga0495665_0000502 Ga0495665_0000502_5121_6026 299
44 3300046536 Ga0495587_0193097 Ga0495587_0193097_111_1016 299
45 3300046538 Ga0495609_0059827 Ga0495609_0059827_277_1185 299
46 3300046616 Ga0495668_0001423 Ga0495668_0001423_4552_5457 299
47 3300046648 Ga0495611_0017536 Ga0495611_0017536_194_1102 299
48 3300046660 Ga0495625_0040310 Ga0495625_0040310_2140_3048 299
49 3300046663 Ga0495635_0223184 Ga0495635_0223184_245_1150 299
50 3300046674 Ga0495588_0032784 Ga0495588_0032784_216_1124 299
51 3300046678 Ga0495599_0060130 Ga0495599_0060130_59_964 299
52 3300046679 Ga0495623_0147223 Ga0495623_0147223_323_1228 299
53 3300046690 Ga0495624_0005066 Ga0495624_0005066_1832_2737 299
54 3300046692 Ga0495671_0015404 Ga0495671_0015404_2927_3832 299
55 3300046694 Ga0495649_0023485 Ga0495649_0023485_1479_2384 299
56 3300047317 Ga0495604_0002615 Ga0495604_0002615_9302_10207 299
57 3300047319 Ga0495674_0065923 Ga0495674_0065923_101_1006 299
58 3300047320 Ga0495672_0000488 Ga0495672_0000488_22746_23654 299
59 3300047322 Ga0495680_0008797 Ga0495680_0008797_6710_7615 299
60 3300047446 Ga0495679_001197 Ga0495679_001197_13325_14230 299
61 3300047469 Ga0495673_0045360 Ga0495673_0045360_691_1599 299
62 3300047469 Ga0495673_0050842 Ga0495673_0050842_221_1126 299
63 3300047673 Ga0495593_0036625 Ga0495593_0036625_1559_2464 299
64 3300048088 Ga0495602_0007489 Ga0495602_0007489_8166_9071 299
65 3300048091 Ga0495626_0004794 Ga0495626_0004794_926_1831 299
66 3300048091 Ga0495626_0056973 Ga0495626_0056973_807_1715 299
67 3300048904 Ga0496101_0176097 Ga0496101_0176097_615_1520 299
68 3300048905 Ga0496102_0198308 Ga0496102_0198308_694_1599 299
69 3300048913 Ga0496110_0093069 Ga0496110_0093069_176_1081 299
70 3300048917 Ga0496114_0128134 Ga0496114_0128134_913_1818 299
71 3300049459 Ga0495678_010677 Ga0495678_010677_1235_2140 299
72 3300049460 Ga0495682_0013027 Ga0495682_0013027_360_1268 299
73 iso_pu_bacteria 8002745576 8002747208 300
74 3300006944 Ga0099823_1000004 Ga0099823_10000046 301
75 3300009011 Ga0105251_10006067 Ga0105251_100060673 301
76 3300009011 Ga0105251_10035896 Ga0105251_100358962 301
77 3300009036 Ga0105244_10000601 Ga0105244_1000060122 301
78 3300009036 Ga0105244_10012856 Ga0105244_100128566 301
79 3300009092 Ga0105250_10007331 Ga0105250_100073315 301
80 3300009092 Ga0105250_10059245 Ga0105250_100592452 301
81 3300013104 Ga0157370_10040682 Ga0157370_100406822 301
82 3300025291 Ga0209675_1002809 Ga0209675_100280911 301
83 3300025292 Ga0209676_1002050 Ga0209676_100205012 301
84 3300025711 Ga0207696_1013381 Ga0207696_10133812 301
85 3300025711 Ga0207696_1021381 Ga0207696_10213812 301
86 3300025728 Ga0207655_1000049 Ga0207655_100004985 301
87 3300025735 Ga0207713_1000143 Ga0207713_100014385 301
88 3300025735 Ga0207713_1073863 Ga0207713_10738632 301
89 3300027296 Ga0209389_1000006 Ga0209389_1000006147 301
90 3300042006 Ga0439432_001881 Ga0439432_001881_4288_5202 301
91 3300042439 Ga0439464_0007222 Ga0439464_0007222_106_1020 301
92 3300048913 Ga0496110_0068493 Ga0496110_0068493_2170_3084 301
93 3300048917 Ga0496114_0043354 Ga0496114_0043354_2727_3641 301
94 3300048924 Ga0496121_0098087 Ga0496121_0098087_372_1286 301
95 3300048925 Ga0496122_0000388 Ga0496122_0000388_17092_18006 301
96 3300048926 Ga0496123_0000551 Ga0496123_0000551_5287_6201 301
97 3300048927 Ga0496124_0029577 Ga0496124_0029577_232_1146 301
98 3300048928 Ga0496125_0006921 Ga0496125_0006921_9712_10626 301
99 3300048928 Ga0496125_0016722 Ga0496125_0016722_141_1055 301
100 3300048929 Ga0496126_0092124 Ga0496126_0092124_264_1178 301
101 3300049571 Ga0501034_0000003 Ga0501034_0000003_5997_6911 301
102 3300053135 Ga0500659_0006147 Ga0500659_0006147_4879_5793 301
103 iso_pu_bacteria 2554235231 2555246888 301
104 iso_pu_bacteria 2643221541 2643727240 301
105 iso_pu_bacteria 2643221606 2644041599 301
106 iso_pu_bacteria 2643221671 2644395140 301
107 iso_pu_bacteria 3007872151 3007874127 301
108 3300005548 Ga0070665_100176602 Ga0070665_1001766022 302
109 3300006946 Ga0079104_1004581 Ga0079104_10045813 302
110 3300012498 Ga0157345_1000001 Ga0157345_100000193 302
111 3300013105 Ga0157369_10000236 Ga0157369_1000023631 302
112 3300017792 Ga0163161_10000066 Ga0163161_1000006672 302
113 3300025728 Ga0207655_1008700 Ga0207655_10087007 302
114 3300027111 Ga0209281_1003600 Ga0209281_10036002 302
115 3300028379 Ga0268266_10210896 Ga0268266_102108962 302
116 3300031548 Ga0307408_100016185 Ga0307408_1000161851 302
117 3300033180 Ga0307510_10012596 Ga0307510_100125963 302
118 3300046452 Ga0495617_008449 Ga0495617_008449_1804_2721 302
119 3300046452 Ga0495617_018878 Ga0495617_018878_1312_2229 302
120 3300046453 Ga0495627_000149 Ga0495627_000149_73223_74140 302
121 3300046453 Ga0495627_001440 Ga0495627_001440_3627_4544 302
122 3300046457 Ga0495590_0010330 Ga0495590_0010330_1877_2794 302
123 3300046458 Ga0495591_000158 Ga0495591_000158_3971_4888 302
124 3300046458 Ga0495591_002155 Ga0495591_002155_3907_4824 302
125 3300046458 Ga0495591_005042 Ga0495591_005042_1042_1959 302
126 3300046458 Ga0495591_007869 Ga0495591_007869_2472_3389 302
127 3300046460 Ga0495638_0002726 Ga0495638_0002726_4760_5677 302
128 3300046460 Ga0495638_0032884 Ga0495638_0032884_1396_2313 302
129 3300046471 Ga0495650_0011075 Ga0495650_0011075_507_1424 302
130 3300046474 Ga0495605_0000078 Ga0495605_0000078_122984_123901 302
131 3300046492 Ga0495585_0006312 Ga0495585_0006312_4006_4923 302
132 3300046492 Ga0495585_0020843 Ga0495585_0020843_691_1608 302
133 3300046492 Ga0495585_0049863 Ga0495585_0049863_158_1075 302
134 3300046500 Ga0495596_0027871 Ga0495596_0027871_1084_2001 302
135 3300046501 Ga0495607_0001725 Ga0495607_0001725_14976_15893 302
136 3300046501 Ga0495607_0009424 Ga0495607_0009424_4124_5041 302
137 3300046501 Ga0495607_0184035 Ga0495607_0184035_90_1007 302
138 3300046507 Ga0495606_0000875 Ga0495606_0000875_40150_41067 302
139 3300046507 Ga0495606_0102830 Ga0495606_0102830_494_1411 302
140 3300046512 Ga0495610_0002690 Ga0495610_0002690_11601_12518 302
141 3300046512 Ga0495610_0138980 Ga0495610_0138980_15_932 302
142 3300046513 Ga0495616_0000029 Ga0495616_0000029_128348_129265 302
143 3300046513 Ga0495616_0010309 Ga0495616_0010309_513_1430 302
144 3300046515 Ga0495620_0026959 Ga0495620_0026959_1356_2273 302
145 3300046515 Ga0495620_0078700 Ga0495620_0078700_290_1207 302
146 3300046519 Ga0495632_0000127 Ga0495632_0000127_4665_5582 302
147 3300046519 Ga0495632_0004574 Ga0495632_0004574_8384_9301 302
148 3300046520 Ga0495637_0000261 Ga0495637_0000261_4386_5303 302
149 3300046520 Ga0495637_0009846 Ga0495637_0009846_420_1391 302
150 3300046520 Ga0495637_0022974 Ga0495637_0022974_106_1023 302
151 3300046522 Ga0495643_0000523 Ga0495643_0000523_3729_4646 302
152 3300046524 Ga0495648_0003397 Ga0495648_0003397_3668_4585 302
153 3300046524 Ga0495648_0006119 Ga0495648_0006119_123_1040 302
154 3300046530 Ga0495654_0000050 Ga0495654_0000050_98766_99683 302
155 3300046530 Ga0495654_0025686 Ga0495654_0025686_795_1712 302
156 3300046538 Ga0495609_0002782 Ga0495609_0002782_5733_6650 302
157 3300046538 Ga0495609_0015151 Ga0495609_0015151_2420_3337 302
158 3300046538 Ga0495609_0023466 Ga0495609_0023466_1777_2694 302
159 3300046538 Ga0495609_0035387 Ga0495609_0035387_121_1038 302
160 3300046616 Ga0495668_0009818 Ga0495668_0009818_3664_4581 302
161 3300046648 Ga0495611_0000024 Ga0495611_0000024_167_1084 302
162 3300046648 Ga0495611_0045921 Ga0495611_0045921_965_1882 302
163 3300046660 Ga0495625_0000387 Ga0495625_0000387_62565_63482 302
164 3300046660 Ga0495625_0017314 Ga0495625_0017314_812_1729 302
165 3300046665 Ga0495661_0020664 Ga0495661_0020664_2135_3052 302
166 3300046665 Ga0495661_0040973 Ga0495661_0040973_764_1681 302
167 3300046665 Ga0495661_0101707 Ga0495661_0101707_28_945 302
168 3300046691 Ga0495670_0001155 Ga0495670_0001155_7527_8444 302
169 3300046692 Ga0495671_0002114 Ga0495671_0002114_8234_9151 302
170 3300046692 Ga0495671_0003204 Ga0495671_0003204_8421_9338 302
171 3300046694 Ga0495649_0003282 Ga0495649_0003282_9269_10186 302
172 3300046810 Ga0495660_0009908 Ga0495660_0009908_2379_3296 302
173 3300046810 Ga0495660_0091341 Ga0495660_0091341_28_945 302
174 3300047320 Ga0495672_0068336 Ga0495672_0068336_318_1235 302
175 3300047321 Ga0495676_0000050 Ga0495676_0000050_92906_93823 302
176 3300047323 Ga0495683_0005519 Ga0495683_0005519_407_1324 302
177 3300047323 Ga0495683_0019490 Ga0495683_0019490_2166_3083 302
178 3300047323 Ga0495683_0019707 Ga0495683_0019707_271_1188 302
179 3300047446 Ga0495679_002451 Ga0495679_002451_126_1043 302
180 3300047446 Ga0495679_011585 Ga0495679_011585_2044_2961 302
181 3300047446 Ga0495679_053635 Ga0495679_053635_107_1024 302
182 3300047469 Ga0495673_0002099 Ga0495673_0002099_9562_10479 302
183 3300047469 Ga0495673_0054714 Ga0495673_0054714_757_1674 302
184 3300047469 Ga0495673_0080563 Ga0495673_0080563_332_1249 302
185 3300048091 Ga0495626_0000073 Ga0495626_0000073_3756_4673 302
186 3300049459 Ga0495678_002554 Ga0495678_002554_8415_9332 302
187 3300053111 Ga0500572_000472 Ga0500572_000472_3698_4615 302
188 3300053145 Ga0500586_043929 Ga0500586_043929_518_1435 302
189 iso_pu_bacteria 2811994881 2812366946 302
190 iso_pu_bacteria 2923519811 2923520982 302
191 3300005539 Ga0068853_100195746 Ga0068853_1001957462 304
192 3300005614 Ga0068856_100141970 Ga0068856_1001419702 304
193 3300009093 Ga0105240_10405889 Ga0105240_104058892 304
194 3300010375 Ga0105239_10090272 Ga0105239_100902723 304
195 3300026078 Ga0207702_10265090 Ga0207702_102650902 304
196 3300048907 Ga0496104_0133363 Ga0496104_0133363_1231_2250 304
197 3300049571 Ga0501034_0142631 Ga0501034_0142631_111_1049 304
198 3300053157 Ga0500624_000039 Ga0500624_000039_82901_83827 304
199 3300053178 Ga0500637_0001192 Ga0500637_0001192_9579_10505 304
200 iso_pu_bacteria 2513237087 2513590987 304
201 iso_pu_bacteria 2904504865 2904508616 304
202 3300009011 Ga0105251_10017811 Ga0105251_100178112 305
203 3300009036 Ga0105244_10004912 Ga0105244_100049126 305
204 3300009148 Ga0105243_10161136 Ga0105243_101611362 305
205 3300025711 Ga0207696_1007305 Ga0207696_10073053 305
206 3300025728 Ga0207655_1000094 Ga0207655_1000094114 305
207 3300025735 Ga0207713_1018578 Ga0207713_10185784 305
208 3300025935 Ga0207709_10292723 Ga0207709_102927231 305
209 3300041405 Ga0439438_009224 Ga0439438_009224_1640_2566 305
210 3300041407 Ga0439447_004918 Ga0439447_004918_2631_3557 305
211 3300042006 Ga0439432_007958 Ga0439432_007958_1227_2153 305
212 3300042010 Ga0439452_000819 Ga0439452_000819_1236_2162 305
213 3300042137 Ga0450902_000747 Ga0450902_000747_2296_3222 305
214 3300042142 Ga0450905_004637 Ga0450905_004637_359_1285 305
215 3300042533 Ga0450901_000386 Ga0450901_000386_4197_5123 305
216 3300048924 Ga0496121_0011359 Ga0496121_0011359_698_1678 305
217 3300053116 Ga0500592_000233 Ga0500592_000233_8842_9765 305
218 3300053139 Ga0500568_0023865 Ga0500568_0023865_1085_2008 305
219 3300053156 Ga0500622_0003174 Ga0500622_0003174_9710_10633 305
220 3300053158 Ga0500627_0038260 Ga0500627_0038260_78_1001 305
221 iso_pu_bacteria 2511231016 2511328451 305
222 iso_pu_bacteria 2511231031 2511411717 305
223 iso_pu_bacteria 2511231031 2511411766 305
224 iso_pu_bacteria 2600255389 2602012051 305
225 iso_pu_bacteria 2738541294 2738810601 305
226 iso_pu_bacteria 2738541309 2738897961 305
227 iso_pu_bacteria 2738543020 2739285584 305
228 iso_pu_bacteria 2738543020 2739285590 305
229 iso_pu_bacteria 2738543021 2739290897 305
230 iso_pu_bacteria 2738543021 2739290903 305
231 iso_pu_bacteria 2808606379 2808942720 305
232 iso_pu_bacteria 8052494512 8052497136 305
233 iso_pu_bacteria 8052494512 8052497142 305
234 3300053177 Ga0500636_0100690 Ga0500636_0100690_35_961 306
235 3300006058 Ga0075432_10034658 Ga0075432_100346582 308
236 3300009011 Ga0105251_10020221 Ga0105251_100202212 308
237 3300009036 Ga0105244_10014328 Ga0105244_100143282 308
238 3300009092 Ga0105250_10000002 Ga0105250_1000000234 308
239 3300014497 Ga0182008_10148908 Ga0182008_101489081 308
240 3300015262 Ga0182007_10004441 Ga0182007_100044414 308
241 3300015265 Ga0182005_1013832 Ga0182005_10138322 308
242 3300017792 Ga0163161_10040504 Ga0163161_100405042 308
243 3300025711 Ga0207696_1000292 Ga0207696_100029216 308
244 3300025735 Ga0207713_1009694 Ga0207713_10096944 308
245 3300027907 Ga0207428_10220732 Ga0207428_102207322 308
246 3300041405 Ga0439438_000034 Ga0439438_000034_35330_36265 308
247 3300041407 Ga0439447_000005 Ga0439447_000005_34472_35407 308
248 3300041411 Ga0439466_0000027 Ga0439466_0000027_34309_35244 308
249 3300042010 Ga0439452_000073 Ga0439452_000073_53182_54117 308
250 3300042185 Ga0450909_002083 Ga0450909_002083_798_1733 308
251 3300042435 Ga0439434_0000002 Ga0439434_0000002_22577_23512 308
252 3300046457 Ga0495590_0000050 Ga0495590_0000050_70502_71437 308
253 3300002737 JGI25162J39368_1000053 JGI25162J39368_100005323 309
254 3300005289 Ga0065704_10002397 Ga0065704_100023976 309
255 3300005841 Ga0068863_100378175 Ga0068863_1003781751 309
256 3300006058 Ga0075432_10000778 Ga0075432_100007785 309
257 3300009011 Ga0105251_10000032 Ga0105251_1000003297 309
258 3300009011 Ga0105251_10003830 Ga0105251_1000383010 309
259 3300009011 Ga0105251_10012365 Ga0105251_100123654 309
260 3300009036 Ga0105244_10000396 Ga0105244_1000039616 309
261 3300009092 Ga0105250_10000369 Ga0105250_100003693 309
262 3300009553 Ga0105249_10392683 Ga0105249_103926831 309
263 3300014325 Ga0163163_10078394 Ga0163163_100783943 309
264 3300025292 Ga0209676_1001072 Ga0209676_100107221 309
265 3300025711 Ga0207696_1000266 Ga0207696_100026626 309
266 3300025728 Ga0207655_1000497 Ga0207655_100049734 309
267 3300025735 Ga0207713_1000020 Ga0207713_1000020318 309
268 3300025735 Ga0207713_1000697 Ga0207713_10006972 309
269 3300025735 Ga0207713_1001102 Ga0207713_100110218 309
270 3300025961 Ga0207712_10189288 Ga0207712_101892881 309
271 3300026088 Ga0207641_10320411 Ga0207641_103204111 309
272 3300027907 Ga0207428_10029040 Ga0207428_100290405 309
273 3300027907 Ga0207428_10247714 Ga0207428_102477142 309
274 3300033180 Ga0307510_10000098 Ga0307510_1000009855 309
275 3300033180 Ga0307510_10000175 Ga0307510_1000017539 309
276 3300041407 Ga0439447_001401 Ga0439447_001401_1311_2249 309
277 3300041407 Ga0439447_002402 Ga0439447_002402_1238_2167 309
278 3300041411 Ga0439466_0001327 Ga0439466_0001327_3219_4148 309
279 3300041411 Ga0439466_0005726 Ga0439466_0005726_3705_4643 309
280 3300041411 Ga0439466_0011859 Ga0439466_0011859_1698_2639 309
281 3300042010 Ga0439452_000151 Ga0439452_000151_27641_28579 309
282 3300046452 Ga0495617_000159 Ga0495617_000159_15754_16692 309
283 3300046452 Ga0495617_000211 Ga0495617_000211_21185_22123 309
284 3300046452 Ga0495617_002191 Ga0495617_002191_1207_2145 309
285 3300046452 Ga0495617_002304 Ga0495617_002304_3912_4841 309
286 3300046452 Ga0495617_002943 Ga0495617_002943_3508_4446 309
287 3300046452 Ga0495617_007977 Ga0495617_007977_2102_3040 309
288 3300046452 Ga0495617_014843 Ga0495617_014843_199_1134 309
289 3300046453 Ga0495627_000031 Ga0495627_000031_62541_63479 309
290 3300046453 Ga0495627_000031 Ga0495627_000031_92780_93715 309
291 3300046453 Ga0495627_000275 Ga0495627_000275_22381_23319 309
292 3300046453 Ga0495627_000408 Ga0495627_000408_8590_9528 309
293 3300046453 Ga0495627_001318 Ga0495627_001318_1004_1939 309
294 3300046453 Ga0495627_008949 Ga0495627_008949_641_1579 309
295 3300046453 Ga0495627_019946 Ga0495627_019946_1049_1984 309
296 3300046454 Ga0495592_0000273 Ga0495592_0000273_18800_19738 309
297 3300046455 Ga0495603_0000214 Ga0495603_0000214_1876_2814 309
298 3300046457 Ga0495590_0000170 Ga0495590_0000170_20126_21064 309
299 3300046457 Ga0495590_0000995 Ga0495590_0000995_3419_4357 309
300 3300046457 Ga0495590_0001484 Ga0495590_0001484_2863_3801 309
301 3300046457 Ga0495590_0002625 Ga0495590_0002625_1364_2299 309
302 3300046457 Ga0495590_0005851 Ga0495590_0005851_846_1784 309
303 3300046458 Ga0495591_000123 Ga0495591_000123_62072_63010 309
304 3300046458 Ga0495591_000239 Ga0495591_000239_12265_13200 309
305 3300046458 Ga0495591_000660 Ga0495591_000660_21424_22362 309
306 3300046458 Ga0495591_002353 Ga0495591_002353_5678_6616 309
307 3300046458 Ga0495591_004251 Ga0495591_004251_49_984 309
308 3300046458 Ga0495591_008238 Ga0495591_008238_1046_1984 309
309 3300046458 Ga0495591_014104 Ga0495591_014104_460_1398 309
310 3300046459 Ga0495629_0007492 Ga0495629_0007492_1394_2332 309
311 3300046460 Ga0495638_0001488 Ga0495638_0001488_2110_3048 309
312 3300046460 Ga0495638_0039996 Ga0495638_0039996_1859_2797 309
313 3300046460 Ga0495638_0041289 Ga0495638_0041289_1252_2190 309
314 3300046460 Ga0495638_0047821 Ga0495638_0047821_730_1668 309
315 3300046463 Ga0495653_0002519 Ga0495653_0002519_13511_14446 309
316 3300046463 Ga0495653_0006708 Ga0495653_0006708_5047_5976 309
317 3300046463 Ga0495653_0031790 Ga0495653_0031790_646_1584 309
318 3300046471 Ga0495650_0000101 Ga0495650_0000101_196882_197820 309
319 3300046471 Ga0495650_0000180 Ga0495650_0000180_36891_37829 309
320 3300046471 Ga0495650_0001922 Ga0495650_0001922_2918_3856 309
321 3300046471 Ga0495650_0007694 Ga0495650_0007694_5353_6291 309
322 3300046471 Ga0495650_0009818 Ga0495650_0009818_2753_3691 309
323 3300046471 Ga0495650_0057848 Ga0495650_0057848_25_963 309
324 3300046471 Ga0495650_0098316 Ga0495650_0098316_146_1081 309
325 3300046474 Ga0495605_0000272 Ga0495605_0000272_23044_23982 309
326 3300046474 Ga0495605_0000718 Ga0495605_0000718_7071_8009 309
327 3300046474 Ga0495605_0001557 Ga0495605_0001557_5465_6403 309
328 3300046474 Ga0495605_0004797 Ga0495605_0004797_4935_5873 309
329 3300046474 Ga0495605_0005569 Ga0495605_0005569_2304_3242 309
330 3300046474 Ga0495605_0016661 Ga0495605_0016661_2422_3360 309
331 3300046474 Ga0495605_0033614 Ga0495605_0033614_1644_2582 309
332 3300046474 Ga0495605_0034702 Ga0495605_0034702_546_1484 309
333 3300046491 Ga0495584_0000393 Ga0495584_0000393_16401_17339 309
334 3300046491 Ga0495584_0000997 Ga0495584_0000997_11651_12589 309
335 3300046491 Ga0495584_0001248 Ga0495584_0001248_12531_13469 309
336 3300046491 Ga0495584_0053056 Ga0495584_0053056_994_1932 309
337 3300046491 Ga0495584_0116806 Ga0495584_0116806_144_1082 309
338 3300046492 Ga0495585_0000533 Ga0495585_0000533_11615_12553 309
339 3300046492 Ga0495585_0000890 Ga0495585_0000890_11677_12615 309
340 3300046492 Ga0495585_0029957 Ga0495585_0029957_651_1586 309
341 3300046492 Ga0495585_0064463 Ga0495585_0064463_151_1089 309
342 3300046499 Ga0495594_0000218 Ga0495594_0000218_18564_19502 309
343 3300046500 Ga0495596_0009603 Ga0495596_0009603_2474_3412 309
344 3300046500 Ga0495596_0010375 Ga0495596_0010375_727_1665 309
345 3300046501 Ga0495607_0000025 Ga0495607_0000025_125377_126315 309
346 3300046501 Ga0495607_0000297 Ga0495607_0000297_20929_21867 309
347 3300046501 Ga0495607_0002617 Ga0495607_0002617_13137_14075 309
348 3300046501 Ga0495607_0003607 Ga0495607_0003607_7369_8307 309
349 3300046501 Ga0495607_0004983 Ga0495607_0004983_5464_6402 309
350 3300046501 Ga0495607_0016210 Ga0495607_0016210_345_1283 309
351 3300046501 Ga0495607_0026026 Ga0495607_0026026_1185_2123 309
352 3300046501 Ga0495607_0039010 Ga0495607_0039010_392_1330 309
353 3300046501 Ga0495607_0050182 Ga0495607_0050182_257_1192 309
354 3300046501 Ga0495607_0118820 Ga0495607_0118820_350_1288 309
355 3300046506 Ga0495583_0000114 Ga0495583_0000114_37255_38193 309
356 3300046506 Ga0495583_0000167 Ga0495583_0000167_40898_41836 309
357 3300046506 Ga0495583_0000347 Ga0495583_0000347_62123_63061 309
358 3300046506 Ga0495583_0000611 Ga0495583_0000611_17816_18754 309
359 3300046506 Ga0495583_0011037 Ga0495583_0011037_1412_2350 309
360 3300046506 Ga0495583_0019613 Ga0495583_0019613_40_975 309
361 3300046507 Ga0495606_0000023 Ga0495606_0000023_233190_234125 309
362 3300046507 Ga0495606_0000023 Ga0495606_0000023_239386_240321 309
363 3300046507 Ga0495606_0001415 Ga0495606_0001415_3100_4038 309
364 3300046507 Ga0495606_0017969 Ga0495606_0017969_2369_3307 309
365 3300046512 Ga0495610_0000900 Ga0495610_0000900_4923_5858 309
366 3300046512 Ga0495610_0002771 Ga0495610_0002771_12240_13178 309
367 3300046512 Ga0495610_0021964 Ga0495610_0021964_2345_3283 309
368 3300046512 Ga0495610_0027507 Ga0495610_0027507_1608_2546 309
369 3300046512 Ga0495610_0040130 Ga0495610_0040130_883_1821 309
370 3300046513 Ga0495616_0000121 Ga0495616_0000121_19897_20835 309
371 3300046513 Ga0495616_0000612 Ga0495616_0000612_5393_6331 309
372 3300046513 Ga0495616_0001049 Ga0495616_0001049_234_1169 309
373 3300046513 Ga0495616_0001170 Ga0495616_0001170_21_959 309
374 3300046513 Ga0495616_0001687 Ga0495616_0001687_5190_6128 309
375 3300046513 Ga0495616_0035520 Ga0495616_0035520_1108_2046 309
376 3300046513 Ga0495616_0050994 Ga0495616_0050994_24_962 309
377 3300046515 Ga0495620_0000134 Ga0495620_0000134_30388_31326 309
378 3300046515 Ga0495620_0001467 Ga0495620_0001467_1033_1971 309
379 3300046515 Ga0495620_0002054 Ga0495620_0002054_10381_11319 309
380 3300046515 Ga0495620_0006719 Ga0495620_0006719_4850_5788 309
381 3300046515 Ga0495620_0011925 Ga0495620_0011925_132_1070 309
382 3300046515 Ga0495620_0023850 Ga0495620_0023850_1071_2009 309
383 3300046517 Ga0495630_0006243 Ga0495630_0006243_4298_5236 309
384 3300046518 Ga0495631_0000151 Ga0495631_0000151_2022_2960 309
385 3300046518 Ga0495631_0000411 Ga0495631_0000411_20285_21223 309
386 3300046518 Ga0495631_0007388 Ga0495631_0007388_1823_2761 309
387 3300046518 Ga0495631_0024313 Ga0495631_0024313_546_1484 309
388 3300046518 Ga0495631_0060973 Ga0495631_0060973_509_1447 309
389 3300046519 Ga0495632_0000031 Ga0495632_0000031_124631_125566 309
390 3300046519 Ga0495632_0000031 Ga0495632_0000031_132757_133695 309
391 3300046519 Ga0495632_0000111 Ga0495632_0000111_10041_10979 309
392 3300046519 Ga0495632_0000361 Ga0495632_0000361_35532_36470 309
393 3300046519 Ga0495632_0000600 Ga0495632_0000600_20192_21130 309
394 3300046519 Ga0495632_0001061 Ga0495632_0001061_15335_16273 309
395 3300046519 Ga0495632_0001317 Ga0495632_0001317_7670_8605 309
396 3300046519 Ga0495632_0001440 Ga0495632_0001440_17836_18774 309
397 3300046519 Ga0495632_0001720 Ga0495632_0001720_5179_6117 309
398 3300046519 Ga0495632_0041507 Ga0495632_0041507_987_1925 309
399 3300046519 Ga0495632_0046042 Ga0495632_0046042_124_1062 309
400 3300046520 Ga0495637_0000017 Ga0495637_0000017_109929_110864 309
401 3300046520 Ga0495637_0000017 Ga0495637_0000017_59498_60436 309
402 3300046520 Ga0495637_0000081 Ga0495637_0000081_20886_21824 309
403 3300046520 Ga0495637_0001340 Ga0495637_0001340_10972_11910 309
404 3300046520 Ga0495637_0001719 Ga0495637_0001719_6809_7747 309
405 3300046520 Ga0495637_0003248 Ga0495637_0003248_7187_8125 309
406 3300046520 Ga0495637_0003553 Ga0495637_0003553_5856_6794 309
407 3300046520 Ga0495637_0010420 Ga0495637_0010420_1995_2933 309
408 3300046520 Ga0495637_0011319 Ga0495637_0011319_1190_2128 309
409 3300046522 Ga0495643_0000604 Ga0495643_0000604_12083_13021 309
410 3300046522 Ga0495643_0003132 Ga0495643_0003132_5710_6648 309
411 3300046522 Ga0495643_0004340 Ga0495643_0004340_6186_7124 309
412 3300046522 Ga0495643_0005803 Ga0495643_0005803_1415_2353 309
413 3300046522 Ga0495643_0036978 Ga0495643_0036978_1717_2655 309
414 3300046522 Ga0495643_0056456 Ga0495643_0056456_167_1102 309
415 3300046523 Ga0495644_0000081 Ga0495644_0000081_12492_13427 309
416 3300046523 Ga0495644_0000448 Ga0495644_0000448_8644_9582 309
417 3300046523 Ga0495644_0033971 Ga0495644_0033971_130_1068 309
418 3300046523 Ga0495644_0082090 Ga0495644_0082090_46_984 309
419 3300046524 Ga0495648_0000261 Ga0495648_0000261_5057_5992 309
420 3300046524 Ga0495648_0000352 Ga0495648_0000352_36318_37256 309
421 3300046524 Ga0495648_0000768 Ga0495648_0000768_13413_14351 309
422 3300046524 Ga0495648_0002261 Ga0495648_0002261_14214_15152 309
423 3300046524 Ga0495648_0002309 Ga0495648_0002309_14523_15461 309
424 3300046524 Ga0495648_0007455 Ga0495648_0007455_3762_4700 309
425 3300046524 Ga0495648_0019288 Ga0495648_0019288_2729_3667 309
426 3300046524 Ga0495648_0023683 Ga0495648_0023683_1522_2460 309
427 3300046524 Ga0495648_0026987 Ga0495648_0026987_246_1184 309
428 3300046524 Ga0495648_0028649 Ga0495648_0028649_1280_2218 309
429 3300046524 Ga0495648_0037968 Ga0495648_0037968_1288_2226 309
430 3300046524 Ga0495648_0042191 Ga0495648_0042191_866_1804 309
431 3300046524 Ga0495648_0043493 Ga0495648_0043493_956_1894 309
432 3300046524 Ga0495648_0044358 Ga0495648_0044358_1003_1941 309
433 3300046526 Ga0495666_0000035 Ga0495666_0000035_20719_21657 309
434 3300046528 Ga0495642_0000026 Ga0495642_0000026_33451_34389 309
435 3300046529 Ga0495652_0017341 Ga0495652_0017341_141_1079 309
436 3300046530 Ga0495654_0000075 Ga0495654_0000075_65507_66445 309
437 3300046530 Ga0495654_0000158 Ga0495654_0000158_47587_48525 309
438 3300046530 Ga0495654_0000579 Ga0495654_0000579_25657_26595 309
439 3300046530 Ga0495654_0000932 Ga0495654_0000932_11136_12071 309
440 3300046530 Ga0495654_0001654 Ga0495654_0001654_13951_14889 309
441 3300046530 Ga0495654_0001696 Ga0495654_0001696_10691_11629 309
442 3300046530 Ga0495654_0004573 Ga0495654_0004573_6911_7849 309
443 3300046530 Ga0495654_0006775 Ga0495654_0006775_2271_3209 309
444 3300046530 Ga0495654_0012928 Ga0495654_0012928_2137_3075 309
445 3300046530 Ga0495654_0036176 Ga0495654_0036176_1185_2123 309
446 3300046530 Ga0495654_0044799 Ga0495654_0044799_1010_1948 309
447 3300046530 Ga0495654_0065588 Ga0495654_0065588_54_989 309
448 3300046536 Ga0495587_0000054 Ga0495587_0000054_30300_31238 309
449 3300046538 Ga0495609_0000013 Ga0495609_0000013_237429_238367 309
450 3300046538 Ga0495609_0001255 Ga0495609_0001255_11318_12256 309
451 3300046538 Ga0495609_0001416 Ga0495609_0001416_2168_3106 309
452 3300046538 Ga0495609_0001497 Ga0495609_0001497_12256_13191 309
453 3300046538 Ga0495609_0005713 Ga0495609_0005713_1957_2895 309
454 3300046538 Ga0495609_0073163 Ga0495609_0073163_24_962 309
455 3300046542 Ga0495597_0000011 Ga0495597_0000011_181673_182611 309
456 3300046542 Ga0495597_0003655 Ga0495597_0003655_864_1802 309
457 3300046542 Ga0495597_0005938 Ga0495597_0005938_1186_2124 309
458 3300046542 Ga0495597_0022270 Ga0495597_0022270_1658_2596 309
459 3300046542 Ga0495597_0028848 Ga0495597_0028848_1041_1979 309
460 3300046543 Ga0495645_0012624 Ga0495645_0012624_3170_4108 309
461 3300046557 Ga0495622_0000046 Ga0495622_0000046_18786_19724 309
462 3300046557 Ga0495622_0000066 Ga0495622_0000066_19531_20469 309
463 3300046557 Ga0495622_0000086 Ga0495622_0000086_81073_82008 309
464 3300046557 Ga0495622_0005565 Ga0495622_0005565_1501_2439 309
465 3300046558 Ga0495633_0007167 Ga0495633_0007167_1968_2903 309
466 3300046558 Ga0495633_0019178 Ga0495633_0019178_1144_2082 309
467 3300046615 Ga0495656_0182885 Ga0495656_0182885_65_1003 309
468 3300046616 Ga0495668_0011156 Ga0495668_0011156_3840_4778 309
469 3300046616 Ga0495668_0013819 Ga0495668_0013819_1601_2539 309
470 3300046616 Ga0495668_0038695 Ga0495668_0038695_862_1797 309
471 3300046616 Ga0495668_0056983 Ga0495668_0056983_96_1034 309
472 3300046642 Ga0495634_0000169 Ga0495634_0000169_29005_29943 309
473 3300046648 Ga0495611_0000019 Ga0495611_0000019_94692_95630 309
474 3300046648 Ga0495611_0000041 Ga0495611_0000041_19172_20107 309
475 3300046648 Ga0495611_0000427 Ga0495611_0000427_3242_4180 309
476 3300046648 Ga0495611_0050121 Ga0495611_0050121_881_1819 309
477 3300046660 Ga0495625_0000016 Ga0495625_0000016_181772_182710 309
478 3300046660 Ga0495625_0001351 Ga0495625_0001351_27897_28835 309
479 3300046660 Ga0495625_0004052 Ga0495625_0004052_715_1653 309
480 3300046660 Ga0495625_0044862 Ga0495625_0044862_40_975 309
481 3300046660 Ga0495625_0046447 Ga0495625_0046447_2163_3098 309
482 3300046660 Ga0495625_0087090 Ga0495625_0087090_159_1097 309
483 3300046663 Ga0495635_0000033 Ga0495635_0000033_30303_31241 309
484 3300046664 Ga0495659_0018682 Ga0495659_0018682_621_1559 309
485 3300046665 Ga0495661_0000001 Ga0495661_0000001_697754_698692 309
486 3300046665 Ga0495661_0000276 Ga0495661_0000276_43481_44419 309
487 3300046665 Ga0495661_0002224 Ga0495661_0002224_10282_11220 309
488 3300046665 Ga0495661_0009529 Ga0495661_0009529_2534_3472 309
489 3300046665 Ga0495661_0032230 Ga0495661_0032230_803_1741 309
490 3300046674 Ga0495588_0001613 Ga0495588_0001613_5710_6648 309
491 3300046674 Ga0495588_0022239 Ga0495588_0022239_1320_2258 309
492 3300046679 Ga0495623_0000234 Ga0495623_0000234_4600_5538 309
493 3300046680 Ga0495646_0000147 Ga0495646_0000147_30298_31236 309
494 3300046680 Ga0495646_0113020 Ga0495646_0113020_159_1097 309
495 3300046684 Ga0495669_0006563 Ga0495669_0006563_2887_3825 309
496 3300046684 Ga0495669_0012064 Ga0495669_0012064_1037_1975 309
497 3300046689 Ga0495613_0033675 Ga0495613_0033675_2592_3530 309
498 3300046690 Ga0495624_0000014 Ga0495624_0000014_60571_61509 309
499 3300046691 Ga0495670_0000018 Ga0495670_0000018_38137_39075 309
500 3300046691 Ga0495670_0000021 Ga0495670_0000021_84829_85764 309
501 3300046691 Ga0495670_0000046 Ga0495670_0000046_27663_28601 309
502 3300046691 Ga0495670_0000206 Ga0495670_0000206_3058_3996 309
503 3300046691 Ga0495670_0000612 Ga0495670_0000612_13539_14477 309
504 3300046691 Ga0495670_0031368 Ga0495670_0031368_1077_2015 309
505 3300046692 Ga0495671_0000153 Ga0495671_0000153_28834_29772 309
506 3300046692 Ga0495671_0000540 Ga0495671_0000540_16442_17380 309
507 3300046692 Ga0495671_0001075 Ga0495671_0001075_6806_7744 309
508 3300046692 Ga0495671_0003136 Ga0495671_0003136_5886_6824 309
509 3300046692 Ga0495671_0004538 Ga0495671_0004538_1837_2775 309
510 3300046692 Ga0495671_0019934 Ga0495671_0019934_115_1053 309
511 3300046692 Ga0495671_0038921 Ga0495671_0038921_1313_2242 309
512 3300046692 Ga0495671_0043687 Ga0495671_0043687_240_1175 309
513 3300046692 Ga0495671_0092888 Ga0495671_0092888_502_1437 309
514 3300046694 Ga0495649_0000079 Ga0495649_0000079_62357_63295 309
515 3300046694 Ga0495649_0003379 Ga0495649_0003379_862_1800 309
516 3300046694 Ga0495649_0009298 Ga0495649_0009298_451_1389 309
517 3300046694 Ga0495649_0022516 Ga0495649_0022516_2551_3486 309
518 3300046694 Ga0495649_0043886 Ga0495649_0043886_985_1923 309
519 3300046694 Ga0495649_0045738 Ga0495649_0045738_918_1856 309
520 3300046694 Ga0495649_0072943 Ga0495649_0072943_520_1455 309
521 3300046694 Ga0495649_0112304 Ga0495649_0112304_83_1018 309
522 3300046794 Ga0495589_0000440 Ga0495589_0000440_17635_18573 309
523 3300046794 Ga0495589_0001491 Ga0495589_0001491_6982_7920 309
524 3300046794 Ga0495589_0002588 Ga0495589_0002588_5685_6623 309
525 3300046794 Ga0495589_0002699 Ga0495589_0002699_1287_2222 309
526 3300046794 Ga0495589_0004429 Ga0495589_0004429_5465_6403 309
527 3300046794 Ga0495589_0090936 Ga0495589_0090936_118_1056 309
528 3300046809 Ga0495600_0007621 Ga0495600_0007621_4274_5212 309
529 3300046810 Ga0495660_0000179 Ga0495660_0000179_21590_22528 309
530 3300046810 Ga0495660_0000234 Ga0495660_0000234_45210_46148 309
531 3300046810 Ga0495660_0000414 Ga0495660_0000414_12659_13597 309
532 3300046810 Ga0495660_0002886 Ga0495660_0002886_8970_9908 309
533 3300046810 Ga0495660_0007167 Ga0495660_0007167_983_1918 309
534 3300046810 Ga0495660_0009778 Ga0495660_0009778_1437_2372 309
535 3300046810 Ga0495660_0039193 Ga0495660_0039193_585_1523 309
536 3300046810 Ga0495660_0072237 Ga0495660_0072237_714_1652 309
537 3300046810 Ga0495660_0083000 Ga0495660_0083000_368_1306 309
538 3300046810 Ga0495660_0090648 Ga0495660_0090648_477_1415 309
539 3300047315 Ga0495581_0013764 Ga0495581_0013764_3679_4617 309
540 3300047317 Ga0495604_0000094 Ga0495604_0000094_19002_19940 309
541 3300047318 Ga0495636_0000265 Ga0495636_0000265_144_1082 309
542 3300047318 Ga0495636_0008243 Ga0495636_0008243_1300_2238 309
543 3300047318 Ga0495636_0019752 Ga0495636_0019752_1007_1945 309
544 3300047319 Ga0495674_0000058 Ga0495674_0000058_42217_43155 309
545 3300047320 Ga0495672_0000524 Ga0495672_0000524_12229_13167 309
546 3300047320 Ga0495672_0000598 Ga0495672_0000598_27354_28289 309
547 3300047320 Ga0495672_0000893 Ga0495672_0000893_14278_15216 309
548 3300047320 Ga0495672_0000934 Ga0495672_0000934_17679_18617 309
549 3300047320 Ga0495672_0001199 Ga0495672_0001199_3118_4056 309
550 3300047320 Ga0495672_0002362 Ga0495672_0002362_11318_12256 309
551 3300047320 Ga0495672_0026050 Ga0495672_0026050_2427_3365 309
552 3300047321 Ga0495676_0000001 Ga0495676_0000001_300570_301508 309
553 3300047321 Ga0495676_0000041 Ga0495676_0000041_30254_31192 309
554 3300047322 Ga0495680_0000133 Ga0495680_0000133_31143_32081 309
555 3300047322 Ga0495680_0169582 Ga0495680_0169582_257_1195 309
556 3300047323 Ga0495683_0000073 Ga0495683_0000073_62985_63923 309
557 3300047323 Ga0495683_0000456 Ga0495683_0000456_28346_29284 309
558 3300047323 Ga0495683_0006337 Ga0495683_0006337_2678_3616 309
559 3300047323 Ga0495683_0007210 Ga0495683_0007210_477_1415 309
560 3300047323 Ga0495683_0120160 Ga0495683_0120160_185_1120 309
561 3300047443 Ga0495687_000159 Ga0495687_000159_4091_5029 309
562 3300047444 Ga0495675_0012459 Ga0495675_0012459_1817_2755 309
563 3300047446 Ga0495679_000053 Ga0495679_000053_102879_103817 309
564 3300047446 Ga0495679_000064 Ga0495679_000064_13861_14799 309
565 3300047446 Ga0495679_000278 Ga0495679_000278_30842_31780 309
566 3300047446 Ga0495679_005384 Ga0495679_005384_2543_3481 309
567 3300047446 Ga0495679_014529 Ga0495679_014529_176_1114 309
568 3300047469 Ga0495673_0000477 Ga0495673_0000477_34667_35605 309
569 3300047469 Ga0495673_0000582 Ga0495673_0000582_13807_14745 309
570 3300047469 Ga0495673_0004137 Ga0495673_0004137_3137_4075 309
571 3300047469 Ga0495673_0008888 Ga0495673_0008888_380_1318 309
572 3300047469 Ga0495673_0012498 Ga0495673_0012498_1972_2907 309
573 3300047469 Ga0495673_0013173 Ga0495673_0013173_1876_2814 309
574 3300047469 Ga0495673_0020585 Ga0495673_0020585_448_1386 309
575 3300047469 Ga0495673_0022415 Ga0495673_0022415_1784_2722 309
576 3300047469 Ga0495673_0054166 Ga0495673_0054166_749_1687 309
577 3300047469 Ga0495673_0088466 Ga0495673_0088466_100_1038 309
578 3300047470 Ga0495681_0000034 Ga0495681_0000034_29633_30571 309
579 3300047470 Ga0495681_0000034 Ga0495681_0000034_59872_60807 309
580 3300047470 Ga0495681_0000068 Ga0495681_0000068_73435_74373 309
581 3300047470 Ga0495681_0000116 Ga0495681_0000116_27446_28384 309
582 3300047470 Ga0495681_0000487 Ga0495681_0000487_9377_10315 309
583 3300047470 Ga0495681_0007899 Ga0495681_0007899_546_1484 309
584 3300047472 Ga0495686_0001403 Ga0495686_0001403_293_1231 309
585 3300047472 Ga0495686_0003734 Ga0495686_0003734_4775_5713 309
586 3300047472 Ga0495686_0005220 Ga0495686_0005220_1892_2827 309
587 3300047472 Ga0495686_0016240 Ga0495686_0016240_2455_3393 309
588 3300047472 Ga0495686_0047060 Ga0495686_0047060_438_1376 309
589 3300047673 Ga0495593_0003808 Ga0495593_0003808_1349_2287 309
590 3300047673 Ga0495593_0007637 Ga0495593_0007637_1349_2287 309
591 3300048088 Ga0495602_0000129 Ga0495602_0000129_31186_32124 309
592 3300048091 Ga0495626_0000002 Ga0495626_0000002_372085_373023 309
593 3300048091 Ga0495626_0000119 Ga0495626_0000119_44745_45683 309
594 3300048091 Ga0495626_0000185 Ga0495626_0000185_38576_39514 309
595 3300048091 Ga0495626_0000199 Ga0495626_0000199_46516_47454 309
596 3300048091 Ga0495626_0018750 Ga0495626_0018750_1253_2191 309
597 3300048907 Ga0496104_0010228 Ga0496104_0010228_2341_3270 309
598 3300048912 Ga0496109_0062962 Ga0496109_0062962_112_1041 309
599 3300048913 Ga0496110_0033428 Ga0496110_0033428_1486_2415 309
600 3300048919 Ga0496116_0001846 Ga0496116_0001846_13021_13956 309
601 3300048920 Ga0496117_0002527 Ga0496117_0002527_9067_10002 309
602 3300048921 Ga0496118_0000966 Ga0496118_0000966_35104_36039 309
603 3300048921 Ga0496118_0019391 Ga0496118_0019391_1315_2244 309
604 3300048924 Ga0496121_0194669 Ga0496121_0194669_440_1375 309
605 3300048925 Ga0496122_0125206 Ga0496122_0125206_691_1626 309
606 3300048926 Ga0496123_0002532 Ga0496123_0002532_12373_13308 309
607 3300049459 Ga0495678_000008 Ga0495678_000008_353167_354105 309
608 3300049459 Ga0495678_000614 Ga0495678_000614_12226_13164 309
609 3300049459 Ga0495678_003045 Ga0495678_003045_7376_8314 309
610 3300049459 Ga0495678_013661 Ga0495678_013661_359_1297 309
611 3300049459 Ga0495678_016258 Ga0495678_016258_1942_2880 309
612 3300049459 Ga0495678_031024 Ga0495678_031024_1037_1975 309
613 3300049459 Ga0495678_060735 Ga0495678_060735_442_1377 309
614 3300049459 Ga0495678_085320 Ga0495678_085320_40_975 309
615 3300049460 Ga0495682_0000075 Ga0495682_0000075_78828_79871 309
616 3300049460 Ga0495682_0000211 Ga0495682_0000211_41046_41978 309
617 3300049460 Ga0495682_0002353 Ga0495682_0002353_6324_7262 309
618 3300049460 Ga0495682_0013008 Ga0495682_0013008_1908_2846 309
619 3300053111 Ga0500572_000005 Ga0500572_000005_30264_31202 309
620 3300053111 Ga0500572_000009 Ga0500572_000009_58693_59628 309
621 3300053135 Ga0500659_0000019 Ga0500659_0000019_739_1677 309
622 3300053135 Ga0500659_0000385 Ga0500659_0000385_21002_21937 309
623 3300053135 Ga0500659_0005740 Ga0500659_0005740_3270_4208 309
624 3300053139 Ga0500568_0010802 Ga0500568_0010802_2904_3842 309
625 3300053145 Ga0500586_000037 Ga0500586_000037_3464_4399 309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04444

Dioxygenase_N

Catechol dioxygenase N terminus

62

131

0.98

PF00775

Dioxygenase_C

Dioxygenase

140

328

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dmh-assembly1.cif.gz_B structure of catechol 1,2-dioxygenase from acinetobacter sp. adp1 with bound 4-methylcatechol 0.9582 3 291
2azq-assembly1.cif.gz_A-2 crystal structure of catechol 1,2-dioxygenase from pseudomonas arvilla c-1 0.9546 3 308
5td3-assembly1.cif.gz_A crystal structure of catechol 1,2-dioxygenase from burkholderia vietnamiensis 0.9269 3 301
5vxt-assembly1.cif.gz_A crystal structure of catechol 1,2-dioxygenase from burkholderia ambifaria 0.9224 1 306
5td3-assembly1.cif.gz_B crystal structure of catechol 1,2-dioxygenase from burkholderia vietnamiensis 0.918 3 300
ID Description Score Start End Superfamily
5umhB00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.93 3 301 2.60.130.10
3hhyA02 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.9083 99 292 2.60.130.10
3hhyA02 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.9037 99 292 2.60.130.10
5umhB00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8982 3 301 2.60.130.10
4iltA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8937 99 292 2.60.130.10
ID Description Score Start End GO Terms
AF-A0A7Y2PJV1-F1-model_v4 Catechol 1,2-dioxygenase 0.9899 1 79 GO:0005506
GO:0009712
GO:0018576
AF-A0A658G477-F1-model_v4 deleted 0.9853 1 96
AF-A0A4R7XUE0-F1-model_v4 deleted 0.9794 1 164
AF-A0A5R9R2R6-F1-model_v4 Catechol 1,2-dioxygenase 0.9787 1 112 GO:0005506
GO:0009712
GO:0018576
AF-A0A024HF40-F1-model_v4 catechol 1,2-dioxygenase (EC 1.13.11.1) 0.9766 1 301 GO:0008199
GO:0018576
GO:0019614
GO:0042952

Feature Viewer

pLDDT pTM Quality
88.55 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map