F470423

General Info

Members Datasets Scaffolds Average Seq Length
626 321 571 197

Family's Representative Sequence

Representative Sequence 3300001915|JGI24741J21665_1000514|JGI24741J21665_100051411
Length 221
Sequence MSKHKTARPAPSLAAAPADAAQILSANQTIATTEQTLHDKTTFGFWVYLMTDCVLFAALFATFAVLRNNTFGGPSGRELFDMPFVLAETLILLTSSFTCGLAMLAAHRQNKRLVLALFGITFLLGIAFLTLELTEFTHLVHEGNSWQRSGFLSAFFTLVGTHGAHITAGLLWMLVLLPRVWKRGVTYMTMRRLTLLSLFWHFLDIIWIFIFTIVYLMGVTS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
6 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
7 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
8 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
9 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
10 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
11 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
12 2671180694 Paenibacillus sp. A3 Isolate Unclassified
13 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
14 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
15 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
16 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
17 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
18 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
19 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
20 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
21 2818991459 Paenibacillus sp. 597 Isolate Unclassified
22 2854911287 Brucella lupini LUP21 Isolate Unclassified
23 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
24 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
25 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
26 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
27 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
28 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
29 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
30 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
31 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
32 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
33 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
34 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
35 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
36 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
37 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
38 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
39 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
40 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
41 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
42 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
43 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
44 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
45 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
46 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
47 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
48 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
49 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
50 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
51 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
52 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
54 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
55 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
56 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
57 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
58 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
59 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
60 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
61 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
62 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
63 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
64 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
65 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
66 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
67 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
68 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
69 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
70 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
79 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
110 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
123 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
124 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
184 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
192 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
193 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
194 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
197 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
198 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
199 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
200 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
201 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
202 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
203 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
204 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
217 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
218 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
219 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
220 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
221 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
222 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
223 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
224 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
225 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
226 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
227 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
228 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
229 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
230 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
231 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
236 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
237 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
238 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
239 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
240 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
243 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
244 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
262 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
268 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
283 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
284 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
285 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
286 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
292 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
293 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
294 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
295 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
296 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
297 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
298 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
299 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
300 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
301 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
302 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
303 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
304 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
305 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
306 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
307 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
309 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
310 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere
311 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
314 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
315 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
316 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
317 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
318 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
319 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
320 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
321 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.1
Metatranscriptomes 1.12
Isolates 8.79

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 11.82
Nodule 1.28
Rhizoplane 1.12
Rhizosphere 77.16
Stem 0
Stem Tuber 0
Unclassified 8.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_719263 2162886012 Bacteria 2361
2 JGI24741J21665_1000514 3300001915 Bacteria 11779
3 JGI25151J46595_10031751 3300003187 Bacteria 2058
4 JGI25406J46586_10056662 3300003203 Bacteria 1284
5 rootH1_10002936 3300003316 Bacteria 45055
6 rootH2_10000244 3300003320 Bacteria 697651
7 rootH1_10120216 3300003323 Bacteria 7533
8 rootH1_10239005 3300003323 Bacteria 2529
9 Ga0006562J51391_1001508 3300003578 Bacteria 5080
10 Ga0055536_1007556 3300003781 Bacteria 4839
11 Ga0065704_10007185 3300005289 Bacteria 2554
12 Ga0065704_10007667 3300005289 Bacteria 2465
13 Ga0065704_10013130 3300005289 Bacteria 2594
14 Ga0070658_10115392 3300005327 Unclassified 2228
15 Ga0070683_100000112 3300005329 Bacteria 53123
16 Ga0070683_100000505 3300005329 Bacteria 27371
17 Ga0070683_100039621 3300005329 Bacteria 4327
18 Ga0070683_100125735 3300005329 Bacteria 2424
19 Ga0070683_100212405 3300005329 Bacteria 1838
20 Ga0070690_100070745 3300005330 Bacteria 2266
21 Ga0070670_100190071 3300005331 Unclassified 1784
22 Ga0070670_100934070 3300005331 Bacteria 787
23 Ga0068869_100329953 3300005334 Bacteria 1239
24 Ga0068869_100699203 3300005334 Bacteria 864
25 Ga0070666_10011738 3300005335 Bacteria 5509
26 Ga0070680_100010777 3300005336 Bacteria 7056
27 Ga0070680_100013463 3300005336 Bacteria 6371
28 Ga0070680_100015091 3300005336 Bacteria 6049
29 Ga0070680_100093206 3300005336 Bacteria 2495
30 Ga0070680_100388673 3300005336 Bacteria 1188
31 Ga0070680_100609685 3300005336 Unclassified 937
32 Ga0070680_100615370 3300005336 Bacteria 932
33 Ga0070682_100001074 3300005337 Bacteria 15750
34 Ga0070682_100002842 3300005337 Bacteria 9591
35 Ga0068868_100059412 3300005338 Bacteria 3024
36 Ga0070660_100000078 3300005339 Bacteria 58990
37 Ga0070660_100000837 3300005339 Bacteria 20454
38 Ga0070660_100193610 3300005339 Bacteria 1647
39 Ga0070660_100485950 3300005339 Bacteria 1026
40 Ga0070668_100280584 3300005347 Bacteria 1391
41 Ga0070671_100000001 3300005355 Bacteria 1228151
42 Ga0070671_100048965 3300005355 Bacteria 3516
43 Ga0070671_100493576 3300005355 Bacteria 1053
44 Ga0070671_101204876 3300005355 Unclassified 666
45 Ga0070667_100000001 3300005367 Bacteria 1108638
46 Ga0070714_100025912 3300005435 Bacteria 4842
47 Ga0070663_100131158 3300005455 Unclassified 1903
48 Ga0070681_10000759 3300005458 Bacteria 26785
49 Ga0070681_10046333 3300005458 Bacteria 4347
50 Ga0070681_10154037 3300005458 Bacteria 2224
51 Ga0070681_10251128 3300005458 Bacteria 1681
52 Ga0070681_10254224 3300005458 Bacteria 1669
53 Ga0070681_10319874 3300005458 Unclassified 1461
54 Ga0070681_10392718 3300005458 Unclassified 1298
55 Ga0070681_10472474 3300005458 Bacteria 1166
56 Ga0070681_10626418 3300005458 Bacteria 990
57 Ga0068867_100011888 3300005459 Bacteria 6149
58 Ga0070699_100069469 3300005518 Bacteria 3061
59 Ga0070679_100000257 3300005530 Bacteria 44414
60 Ga0070679_100000389 3300005530 Bacteria 37362
61 Ga0070679_100006394 3300005530 Bacteria 10972
62 Ga0070679_100007222 3300005530 Bacteria 10375
63 Ga0070679_100012264 3300005530 Bacteria 8189
64 Ga0070679_100020648 3300005530 Bacteria 6423
65 Ga0070679_100020714 3300005530 Bacteria 6415
66 Ga0070679_100059134 3300005530 Bacteria 3820
67 Ga0070679_100101721 3300005530 Bacteria 2860
68 Ga0070679_100184271 3300005530 Bacteria 2059
69 Ga0070679_100220044 3300005530 Unclassified 1860
70 Ga0070679_100280697 3300005530 Bacteria 1618
71 Ga0070679_100289112 3300005530 Bacteria 1591
72 Ga0070679_100472981 3300005530 Bacteria 1197
73 Ga0070679_101310908 3300005530 Unclassified 670
74 Ga0070684_100000049 3300005535 Bacteria 79768
75 Ga0070684_100043297 3300005535 Bacteria 3887
76 Ga0070684_100060651 3300005535 Bacteria 3309
77 Ga0070684_100123109 3300005535 Bacteria 2334
78 Ga0070684_100541094 3300005535 Bacteria 1080
79 Ga0070686_100061199 3300005544 Bacteria 2432
80 Ga0070686_100344773 3300005544 Bacteria 1117
81 Ga0070693_100088354 3300005547 Bacteria 1863
82 Ga0070665_100608974 3300005548 Bacteria 1105
83 Ga0068855_100000011 3300005563 Bacteria 244140
84 Ga0068855_100001288 3300005563 Bacteria 31095
85 Ga0068855_100002255 3300005563 Bacteria 23808
86 Ga0068855_100011942 3300005563 Bacteria 10501
87 Ga0068855_100045297 3300005563 Bacteria 5202
88 Ga0068855_100125581 3300005563 Bacteria 2934
89 Ga0068855_100338897 3300005563 Bacteria 1658
90 Ga0068855_100780998 3300005563 Unclassified 1016
91 Ga0068857_100056471 3300005577 Bacteria 3484
92 Ga0068857_100059939 3300005577 Bacteria 3382
93 Ga0068857_100132793 3300005577 Bacteria 2246
94 Ga0068857_100317049 3300005577 Bacteria 1439
95 Ga0068854_100033781 3300005578 Bacteria 3567
96 Ga0068854_100158599 3300005578 Bacteria 1750
97 Ga0068856_100000001 3300005614 Bacteria 565602
98 Ga0068856_100004033 3300005614 Bacteria 14706
99 Ga0068856_100040384 3300005614 Bacteria 4583
100 Ga0068856_100041933 3300005614 Bacteria 4500
101 Ga0068856_100850974 3300005614 Bacteria 931
102 Ga0068856_100992389 3300005614 Bacteria 858
103 Ga0068852_100130302 3300005616 Bacteria 2315
104 Ga0068852_100476760 3300005616 Bacteria 1239
105 Ga0068852_100594514 3300005616 Bacteria 1110
106 Ga0068859_100341811 3300005617 Bacteria 1591
107 Ga0068859_100493052 3300005617 Bacteria 1320
108 Ga0068864_101002898 3300005618 Bacteria 828
109 Ga0068866_10000503 3300005718 Bacteria 18051
110 Ga0068861_100938524 3300005719 Unclassified 822
111 Ga0068858_100013351 3300005842 Bacteria 7749
112 Ga0068860_100000012 3300005843 Bacteria 326398
113 Ga0068860_100006387 3300005843 Bacteria 11833
114 Ga0068860_100158980 3300005843 Bacteria 2178
115 Ga0081455_10000003 3300005937 Bacteria 367763
116 Ga0081539_10007261 3300005985 Bacteria 10179
117 Ga0075365_10000001 3300006038 Bacteria 371589
118 Ga0075365_10000023 3300006038 Bacteria 64393
119 Ga0075365_10004036 3300006038 Bacteria 7700
120 Ga0075365_10405449 3300006038 Bacteria 962
121 Ga0075368_10000001 3300006042 Bacteria 62048
122 Ga0075363_100000036 3300006048 Bacteria 24952
123 Ga0075364_10007101 3300006051 Bacteria 6623
124 Ga0075364_10025049 3300006051 Bacteria 3795
125 Ga0075364_10114248 3300006051 Bacteria 1804
126 Ga0075432_10010884 3300006058 Bacteria 3088
127 Ga0075432_10024318 3300006058 Bacteria 2076
128 Ga0075362_10067176 3300006177 Unclassified 1631
129 Ga0075367_10000005 3300006178 Bacteria 47809
130 Ga0075369_10000020 3300006186 Bacteria 45510
131 Ga0075366_10000001 3300006195 Bacteria 569172
132 Ga0075366_10000046 3300006195 Bacteria 43756
133 Ga0075366_10023362 3300006195 Bacteria 3602
134 Ga0075370_10001399 3300006353 Bacteria 10413
135 Ga0075370_10035461 3300006353 Bacteria 2799
136 Ga0068871_100000177 3300006358 Bacteria 43038
137 Ga0075428_100016402 3300006844 Bacteria 8185
138 Ga0068865_100245218 3300006881 Bacteria 1411
139 Ga0097620_100341818 3300006931 Bacteria 1591
140 Ga0097620_100493032 3300006931 Bacteria 1320
141 Ga0079104_1003845 3300006946 Bacteria 6727
142 Ga0079104_1015298 3300006946 Bacteria 2278
143 Ga0105251_10000057 3300009011 Bacteria 104178
144 Ga0105251_10013468 3300009011 Bacteria 4574
145 Ga0105251_10013641 3300009011 Bacteria 4538
146 Ga0105244_10004173 3300009036 Bacteria 10051
147 Ga0105244_10005826 3300009036 Bacteria 8097
148 Ga0105244_10006746 3300009036 Bacteria 7384
149 Ga0105250_10009653 3300009092 Bacteria 4055
150 Ga0105250_10019192 3300009092 Bacteria 2763
151 Ga0105240_10000003 3300009093 Bacteria 1183681
152 Ga0105240_10000004 3300009093 Bacteria 708156
153 Ga0105240_10000501 3300009093 Bacteria 72270
154 Ga0105240_10000638 3300009093 Bacteria 64636
155 Ga0105240_10002332 3300009093 Bacteria 30702
156 Ga0105240_10006840 3300009093 Bacteria 16675
157 Ga0105240_10013030 3300009093 Bacteria 11448
158 Ga0105240_10015410 3300009093 Bacteria 10392
159 Ga0105240_10061829 3300009093 Bacteria 4665
160 Ga0105240_10097122 3300009093 Bacteria 3590
161 Ga0105240_10134355 3300009093 Bacteria 2963
162 Ga0105240_10157900 3300009093 Bacteria 2696
163 Ga0105240_10158464 3300009093 Bacteria 2690
164 Ga0105240_10295291 3300009093 Bacteria 1856
165 Ga0105240_10605903 3300009093 Bacteria 1205
166 Ga0105240_10834989 3300009093 Bacteria 996
167 Ga0111539_10001117 3300009094 Bacteria 35477
168 Ga0111539_10547796 3300009094 Bacteria 1348
169 Ga0105245_10000002 3300009098 Bacteria 634374
170 Ga0105245_10000050 3300009098 Bacteria 128014
171 Ga0105245_10002107 3300009098 Bacteria 17998
172 Ga0105245_10018473 3300009098 Bacteria 6096
173 Ga0105245_10566570 3300009098 Unclassified 1159
174 Ga0105243_10000001 3300009148 Bacteria 1156578
175 Ga0105243_10097525 3300009148 Bacteria 2433
176 Ga0105241_10000225 3300009174 Bacteria 42642
177 Ga0105241_10050251 3300009174 Bacteria 3177
178 Ga0105241_10119222 3300009174 Bacteria 2122
179 Ga0105241_10133619 3300009174 Bacteria 2012
180 Ga0105241_10141745 3300009174 Bacteria 1958
181 Ga0105241_10230223 3300009174 Bacteria 1562
182 Ga0105241_10249282 3300009174 Bacteria 1505
183 Ga0105241_10543494 3300009174 Bacteria 1042
184 Ga0105241_10937812 3300009174 Bacteria 806
185 Ga0105242_10000011 3300009176 Bacteria 149791
186 Ga0105242_10001558 3300009176 Bacteria 18055
187 Ga0105237_10000001 3300009545 Bacteria 1009213
188 Ga0105237_10001685 3300009545 Bacteria 28614
189 Ga0105237_10057233 3300009545 Bacteria 3902
190 Ga0105238_10003536 3300009551 Bacteria 15582
191 Ga0105238_10011803 3300009551 Bacteria 8803
192 Ga0105238_10068656 3300009551 Bacteria 3545
193 Ga0105249_10004446 3300009553 Bacteria 12125
194 Ga0105249_10007441 3300009553 Bacteria 9553
195 Ga0105029_100074 3300009984 Bacteria 4724
196 Ga0105033_100852 3300009986 Bacteria 2401
197 Ga0105028_100019 3300009993 Bacteria 20066
198 Ga0105028_100245 3300009993 Bacteria 5926
199 Ga0105028_100770 3300009993 Bacteria 3424
200 Ga0105239_10004476 3300010375 Bacteria 16687
201 Ga0105239_10012551 3300010375 Bacteria 9434
202 Ga0105239_10016668 3300010375 Bacteria 8122
203 Ga0105239_10355011 3300010375 Unclassified 1655
204 Ga0105239_10916460 3300010375 Unclassified 1006
205 Ga0105239_11574612 3300010375 Bacteria 760
206 Ga0105246_10179908 3300011119 Bacteria 1627
207 Ga0157373_10000061 3300013100 Bacteria 95718
208 Ga0157373_10080406 3300013100 Bacteria 2298
209 Ga0157371_10000176 3300013102 Bacteria 93047
210 Ga0157371_10003618 3300013102 Bacteria 13917
211 Ga0157371_10245764 3300013102 Bacteria 1288
212 Ga0157370_10000115 3300013104 Bacteria 92585
213 Ga0157370_10019304 3300013104 Bacteria 6842
214 Ga0157370_10034557 3300013104 Bacteria 4920
215 Ga0157370_10034708 3300013104 Bacteria 4907
216 Ga0157369_10000063 3300013105 Bacteria 147327
217 Ga0157369_10000768 3300013105 Bacteria 41480
218 Ga0157369_10012990 3300013105 Bacteria 9434
219 Ga0157369_10043054 3300013105 Unclassified 4923
220 Ga0157369_10086041 3300013105 Bacteria 3358
221 Ga0157369_11169772 3300013105 Unclassified 785
222 Ga0157369_11378198 3300013105 Unclassified 718
223 Ga0157374_10000018 3300013296 Bacteria 286683
224 Ga0157374_10000064 3300013296 Bacteria 108743
225 Ga0157374_10004912 3300013296 Bacteria 11219
226 Ga0157374_10031041 3300013296 Bacteria 4852
227 Ga0157374_10282024 3300013296 Bacteria 1640
228 Ga0157374_10474437 3300013296 Unclassified 1254
229 Ga0157374_10683690 3300013296 Bacteria 1039
230 Ga0157378_10009088 3300013297 Bacteria 8650
231 Ga0157372_10000002 3300013307 Bacteria 687862
232 Ga0157372_10005893 3300013307 Bacteria 13044
233 Ga0157372_10018029 3300013307 Bacteria 7589
234 Ga0157372_10039759 3300013307 Bacteria 5192
235 Ga0157372_10052066 3300013307 Bacteria 4557
236 Ga0157372_10270537 3300013307 Bacteria 1974
237 Ga0157372_10391203 3300013307 Bacteria 1620
238 Ga0157372_10686938 3300013307 Bacteria 1191
239 Ga0157375_10316547 3300013308 Bacteria 1725
240 Ga0157375_10484876 3300013308 Bacteria 1401
241 Ga0163163_10050262 3300014325 Bacteria 4106
242 Ga0157380_10207082 3300014326 Unclassified 1745
243 Ga0157377_10013285 3300014745 Bacteria 4166
244 Ga0157377_10091720 3300014745 Unclassified 1795
245 Ga0157379_10686392 3300014968 Bacteria 960
246 Ga0157376_10000007 3300014969 Bacteria 368004
247 Ga0183365_10001 3300015684 Bacteria 2090444
248 Ga0163161_10222416 3300017792 Bacteria 1462
249 Ga0163161_10284035 3300017792 Unclassified 1299
250 Ga0154015_1639401 3300020610 Bacteria 975
251 Ga0209566_101212 3300025225 Bacteria 9075
252 Ga0209566_106293 3300025225 Bacteria 1414
253 Ga0209437_100889 3300025233 Bacteria 12056
254 Ga0209675_1014633 3300025291 Bacteria 2377
255 Ga0209676_1000306 3300025292 Bacteria 97332
256 Ga0209025_1000769 3300025294 Bacteria 53174
257 Ga0209025_1007291 3300025294 Bacteria 8296
258 Ga0209051_1017553 3300025303 Bacteria 3194
259 Ga0207697_10129778 3300025315 Bacteria 1089
260 Ga0207696_1021987 3300025711 Bacteria 2034
261 Ga0207655_1000836 3300025728 Bacteria 33126
262 Ga0207655_1006030 3300025728 Bacteria 8102
263 Ga0207713_1000014 3300025735 Bacteria 432450
264 Ga0207713_1022673 3300025735 Bacteria 2973
265 Ga0207713_1022846 3300025735 Bacteria 2957
266 Ga0207713_1035422 3300025735 Bacteria 2154
267 Ga0207713_1089170 3300025735 Bacteria 1088
268 Ga0207642_10000184 3300025899 Bacteria 18031
269 Ga0207647_10043391 3300025904 Bacteria 2815
270 Ga0207705_10102917 3300025909 Unclassified 2103
271 Ga0207654_10151425 3300025911 Bacteria 1489
272 Ga0207654_10449716 3300025911 Bacteria 903
273 Ga0207707_10020943 3300025912 Bacteria 5713
274 Ga0207707_10032501 3300025912 Bacteria 4567
275 Ga0207707_10065105 3300025912 Bacteria 3175
276 Ga0207707_10077329 3300025912 Bacteria 2905
277 Ga0207707_10139990 3300025912 Bacteria 2116
278 Ga0207707_10274433 3300025912 Bacteria 1461
279 Ga0207707_10543175 3300025912 Bacteria 988
280 Ga0207707_10894741 3300025912 Bacteria 734
281 Ga0207695_10000005 3300025913 Bacteria 1196715
282 Ga0207695_10000009 3300025913 Bacteria 1034276
283 Ga0207695_10000109 3300025913 Bacteria 251757
284 Ga0207695_10002301 3300025913 Bacteria 28477
285 Ga0207695_10005572 3300025913 Bacteria 16628
286 Ga0207695_10021060 3300025913 Bacteria 7448
287 Ga0207695_10033021 3300025913 Bacteria 5654
288 Ga0207695_10044777 3300025913 Bacteria 4704
289 Ga0207695_10111733 3300025913 Bacteria 2711
290 Ga0207695_10357984 3300025913 Bacteria 1346
291 Ga0207695_10578037 3300025913 Bacteria 1005
292 Ga0207671_10000003 3300025914 Bacteria 1065461
293 Ga0207671_10000014 3300025914 Bacteria 461481
294 Ga0207671_10203724 3300025914 Bacteria 1546
295 Ga0207660_10001981 3300025917 Bacteria 13653
296 Ga0207660_10005822 3300025917 Bacteria 7997
297 Ga0207660_10014750 3300025917 Bacteria 5149
298 Ga0207660_10050196 3300025917 Bacteria 2961
299 Ga0207660_10125739 3300025917 Bacteria 1947
300 Ga0207660_10504324 3300025917 Bacteria 982
301 Ga0207657_10002660 3300025919 Bacteria 19285
302 Ga0207657_10003164 3300025919 Bacteria 17610
303 Ga0207657_10178910 3300025919 Bacteria 1715
304 Ga0207657_10598166 3300025919 Bacteria 861
305 Ga0207652_10000322 3300025921 Bacteria 49586
306 Ga0207652_10001771 3300025921 Bacteria 18822
307 Ga0207652_10005379 3300025921 Bacteria 10387
308 Ga0207652_10010483 3300025921 Bacteria 7459
309 Ga0207652_10011316 3300025921 Bacteria 7189
310 Ga0207652_10027248 3300025921 Bacteria 4760
311 Ga0207652_10056308 3300025921 Bacteria 3385
312 Ga0207652_10107974 3300025921 Bacteria 2466
313 Ga0207652_10131536 3300025921 Bacteria 2232
314 Ga0207652_10235542 3300025921 Bacteria 1650
315 Ga0207652_10368795 3300025921 Bacteria 1296
316 Ga0207681_10671154 3300025923 Unclassified 860
317 Ga0207694_10001648 3300025924 Bacteria 18787
318 Ga0207694_10074619 3300025924 Bacteria 2655
319 Ga0207687_10000001 3300025927 Bacteria 1130810
320 Ga0207687_10000117 3300025927 Bacteria 56652
321 Ga0207687_10020880 3300025927 Bacteria 4346
322 Ga0207687_10212466 3300025927 Bacteria 1518
323 Ga0207687_10326885 3300025927 Unclassified 1243
324 Ga0207664_10022486 3300025929 Bacteria 4710
325 Ga0207644_10000001 3300025931 Bacteria 1243214
326 Ga0207644_10018955 3300025931 Bacteria 4666
327 Ga0207644_10429891 3300025931 Bacteria 1083
328 Ga0207686_10000001 3300025934 Bacteria 1169580
329 Ga0207686_10000889 3300025934 Bacteria 18051
330 Ga0207709_10000002 3300025935 Bacteria 1171536
331 Ga0207709_10140438 3300025935 Bacteria 1660
332 Ga0207704_10141262 3300025938 Bacteria 1685
333 Ga0207661_10000077 3300025944 Bacteria 67190
334 Ga0207661_10000129 3300025944 Bacteria 47940
335 Ga0207661_10158690 3300025944 Bacteria 1961
336 Ga0207661_10455773 3300025944 Bacteria 1165
337 Ga0207661_10889042 3300025944 Bacteria 820
338 Ga0207667_10000042 3300025949 Bacteria 263461
339 Ga0207667_10000660 3300025949 Bacteria 44705
340 Ga0207667_10017183 3300025949 Bacteria 8154
341 Ga0207667_10021980 3300025949 Bacteria 7059
342 Ga0207667_10102624 3300025949 Bacteria 2950
343 Ga0207667_10119734 3300025949 Bacteria 2713
344 Ga0207667_10189705 3300025949 Bacteria 2109
345 Ga0207667_10198444 3300025949 Bacteria 2059
346 Ga0207667_10340214 3300025949 Bacteria 1531
347 Ga0207667_10539103 3300025949 Bacteria 1181
348 Ga0207712_10000432 3300025961 Bacteria 35770
349 Ga0207640_10025344 3300025981 Bacteria 3589
350 Ga0207658_10000003 3300025986 Bacteria 1151934
351 Ga0207658_10009963 3300025986 Bacteria 6459
352 Ga0207677_10007434 3300026023 Bacteria 6060
353 Ga0207703_10985904 3300026035 Bacteria 808
354 Ga0207639_10114995 3300026041 Bacteria 2199
355 Ga0207678_10078692 3300026067 Bacteria 2823
356 Ga0207678_10233679 3300026067 Bacteria 1574
357 Ga0207702_10000001 3300026078 Bacteria 895738
358 Ga0207702_10000739 3300026078 Bacteria 34921
359 Ga0207702_10028728 3300026078 Bacteria 4624
360 Ga0207702_10206447 3300026078 Bacteria 1824
361 Ga0207702_10565603 3300026078 Bacteria 1113
362 Ga0207674_10008133 3300026116 Bacteria 12159
363 Ga0207674_10071296 3300026116 Bacteria 3492
364 Ga0207698_10019644 3300026142 Bacteria 4630
365 Ga0209281_1000041 3300027111 Bacteria 347825
366 Ga0209371_1006598 3300027312 Bacteria 4259
367 Ga0209371_1011655 3300027312 Bacteria 2595
368 Ga0209371_1012661 3300027312 Bacteria 2422
369 Ga0210002_1012142 3300027617 Bacteria 1335
370 Ga0209813_10000006 3300027866 Bacteria 113121
371 Ga0209974_10002444 3300027876 Bacteria 6718
372 Ga0207428_10206415 3300027907 Bacteria 1477
373 Ga0207428_10416117 3300027907 Bacteria 983
374 Ga0268266_10550733 3300028379 Bacteria 1105
375 Ga0268264_10000292 3300028381 Bacteria 84089
376 Ga0268264_10002058 3300028381 Bacteria 17945
377 Ga0268264_10383513 3300028381 Bacteria 1346
378 Ga0265326_10005826 3300028558 Bacteria 3868
379 Ga0265319_1002944 3300028563 Bacteria 9063
380 Ga0265334_10000337 3300028573 Bacteria 25095
381 Ga0265334_10002134 3300028573 Bacteria 9326
382 Ga0265322_10007416 3300028654 Bacteria 3203
383 Ga0265338_10000925 3300028800 Bacteria 49504
384 Ga0265338_10001149 3300028800 Bacteria 43743
385 Ga0265338_10002029 3300028800 Bacteria 31401
386 Ga0265338_10002326 3300028800 Bacteria 28740
387 Ga0265338_10002976 3300028800 Bacteria 24563
388 Ga0265338_10021997 3300028800 Bacteria 6625
389 Ga0265338_10089830 3300028800 Bacteria 2545
390 Ga0265338_10129951 3300028800 Bacteria 1991
391 Ga0265338_10399948 3300028800 Bacteria 979
392 Ga0265324_10000345 3300029957 Bacteria 33698
393 Ga0265324_10002943 3300029957 Bacteria 8339
394 Ga0265324_10188251 3300029957 Bacteria 701
395 Ga0268256_1012658 3300030500 Bacteria 2595
396 Ga0268256_1020027 3300030500 Bacteria 1815
397 Ga0268256_1024295 3300030500 Bacteria 1557
398 Ga0316178_1033575 3300030735 Unclassified 1828
399 Ga0316182_1211437 3300030745 Bacteria 2137
400 Ga0265332_10007223 3300031238 Bacteria 5029
401 Ga0265332_10227583 3300031238 Bacteria 773
402 Ga0265320_10032017 3300031240 Bacteria 2697
403 Ga0265340_10000152 3300031247 Bacteria 35168
404 Ga0265339_10007423 3300031249 Bacteria 7086
405 Ga0265327_10001794 3300031251 Bacteria 25181
406 Ga0265316_10001231 3300031344 Bacteria 27541
407 Ga0265314_10100820 3300031711 Bacteria 1856
408 Ga0265314_10344175 3300031711 Bacteria 822
409 Ga0265342_10006667 3300031712 Bacteria 8565
410 Ga0307406_10001130 3300031901 Bacteria 14911
411 Ga0373930_0049808 3300034816 Bacteria 912
412 Ga0373923_0034081 3300035111 Unclassified 2065
413 Ga0395899_0023574 3300037312 Bacteria 4659
414 Ga0395899_0069327 3300037312 Bacteria 2583
415 Ga0395899_0201967 3300037312 Bacteria 1385
416 Ga0395900_0172844 3300037418 Bacteria 2198
417 Ga0395900_0735524 3300037418 Bacteria 918
418 Ga0395898_0014631 3300037466 Bacteria 8057
419 Ga0395898_0059193 3300037466 Bacteria 3728
420 Ga0395905_0000135 3300037471 Bacteria 121352
421 Ga0395905_0002031 3300037471 Bacteria 23129
422 Ga0395905_0135972 3300037471 Bacteria 2312
423 Ga0395905_0590731 3300037471 Bacteria 1012
424 Ga0395901_0009227 3300038443 Bacteria 9996
425 Ga0395901_0075402 3300038443 Bacteria 3518
426 Ga0395901_1204227 3300038443 Bacteria 723
427 Ga0439438_011278 3300041405 Unclassified 2790
428 Ga0439439_0001786 3300041406 Bacteria 4393
429 Ga0439447_013111 3300041407 Unclassified 2360
430 Ga0439461_0000490 3300041410 Bacteria 5707
431 Ga0439466_0010627 3300041411 Bacteria 3421
432 Ga0439431_0060709 3300041997 Bacteria 994
433 Ga0439442_003494 3300042002 Bacteria 3106
434 Ga0439432_010735 3300042006 Bacteria 3167
435 Ga0439432_101908 3300042006 Unclassified 858
436 Ga0439449_0106352 3300042007 Bacteria 1038
437 Ga0439456_000042 3300042013 Bacteria 46567
438 Ga0439457_003129 3300042014 Bacteria 4571
439 Ga0439457_015177 3300042014 Unclassified 1722
440 Ga0439462_0000460 3300042015 Bacteria 7988
441 Ga0450919_017705 3300042121 Bacteria 803
442 Ga0450905_002057 3300042142 Bacteria 2568
443 Ga0439446_0000001 3300042156 Bacteria 275840
444 Ga0439446_0002635 3300042156 Bacteria 4331
445 Ga0439434_0001673 3300042435 Bacteria 6424
446 Ga0451576_0000438 3300045051 Bacteria 95259
447 Ga0466967_0397124 3300045976 Bacteria 1341
448 Ga0495638_0000227 3300046460 Bacteria 77425
449 Ga0495638_0140474 3300046460 Bacteria 1410
450 Ga0495580_0003111 3300046472 Bacteria 14211
451 Ga0495580_0734846 3300046472 Bacteria 644
452 Ga0495582_0488617 3300046473 Bacteria 711
453 Ga0495594_0002832 3300046499 Bacteria 9020
454 Ga0495620_0000027 3300046515 Bacteria 123465
455 Ga0495632_0028538 3300046519 Bacteria 2911
456 Ga0495643_0000955 3300046522 Bacteria 29765
457 Ga0495648_0035813 3300046524 Bacteria 3212
458 Ga0495666_0015496 3300046526 Bacteria 3795
459 Ga0495611_0468485 3300046648 Unclassified 573
460 Ga0495649_0001296 3300046694 Bacteria 19122
461 Ga0495649_0093359 3300046694 Bacteria 1602
462 Ga0495636_0054169 3300047318 Bacteria 1685
463 Ga0495672_0000016 3300047320 Bacteria 500601
464 Ga0495626_0348544 3300048091 Bacteria 578
465 Ga0496100_0106065 3300048903 Bacteria 1944
466 Ga0496110_0478593 3300048913 Bacteria 1134
467 Ga0496111_0459628 3300048914 Bacteria 939
468 Ga0496112_0125880 3300048915 Bacteria 2533
469 Ga0496113_0319722 3300048916 Bacteria 1244
470 Ga0496114_0111022 3300048917 Bacteria 2349
471 Ga0496115_0000007 3300048918 Bacteria 244991
472 Ga0496116_0012736 3300048919 Bacteria 6840
473 Ga0496116_0017923 3300048919 Bacteria 5475
474 Ga0496116_0067778 3300048919 Bacteria 2277
475 Ga0496116_0123680 3300048919 Bacteria 1491
476 Ga0496116_0188592 3300048919 Bacteria 1094
477 Ga0496116_0246031 3300048919 Bacteria 894
478 Ga0496117_0009629 3300048920 Bacteria 8939
479 Ga0496117_0077072 3300048920 Bacteria 2207
480 Ga0496118_0007541 3300048921 Bacteria 11490
481 Ga0496119_0008969 3300048922 Bacteria 8684
482 Ga0496120_0004455 3300048923 Bacteria 11738
483 Ga0496121_0040980 3300048924 Bacteria 4054
484 Ga0496121_0121399 3300048924 Bacteria 1973
485 Ga0496121_0211983 3300048924 Bacteria 1371
486 Ga0496121_0335082 3300048924 Bacteria 1013
487 Ga0496122_0007310 3300048925 Bacteria 12334
488 Ga0496122_0013878 3300048925 Bacteria 7842
489 Ga0496122_0054136 3300048925 Bacteria 3017
490 Ga0496123_0081564 3300048926 Bacteria 1965
491 Ga0496124_0000078 3300048927 Bacteria 213239
492 Ga0496124_0060756 3300048927 Bacteria 3170
493 Ga0496124_0106499 3300048927 Bacteria 2264
494 Ga0496124_0356652 3300048927 Bacteria 1032
495 Ga0496125_0001704 3300048928 Bacteria 30635
496 Ga0496125_0001786 3300048928 Bacteria 29725
497 Ga0496126_0220187 3300048929 Bacteria 1595
498 Ga0496126_0283642 3300048929 Bacteria 1371
499 Ga0501305_015110 3300049161 Bacteria 1087
500 Ga0495682_0000200 3300049460 Bacteria 48266
501 Ga0501313_014224 3300049529 Bacteria 940
502 Ga0501318_006435 3300049534 Bacteria 1199
503 Ga0501031_0011085 3300049568 Bacteria 5875
504 Ga0501034_0000241 3300049571 Bacteria 101160
505 Ga0501034_0000557 3300049571 Bacteria 58990
506 Ga0501034_0000588 3300049571 Bacteria 57446
507 Ga0501034_0019372 3300049571 Bacteria 6960
508 Ga0501034_0189335 3300049571 Bacteria 2020
509 Ga0501034_0588546 3300049571 Bacteria 1019
510 Ga0501037_0000001 3300049573 Bacteria 753276
511 Ga0501037_0004473 3300049573 Bacteria 10159
512 Ga0501039_0162703 3300049575 Bacteria 1754
513 Ga0501042_0087401 3300049578 Bacteria 2236
514 Ga0501043_0360809 3300049579 Bacteria 1103
515 Ga0501046_0029051 3300049580 Bacteria 4498
516 Ga0501073_0364544 3300049589 Bacteria 998
517 Ga0501080_0236647 3300049742 Bacteria 1668
518 Ga0501083_0020685 3300049744 Bacteria 4575
519 Ga0501035_0079229 3300049822 Bacteria 2902
520 Ga0501044_0282009 3300049823 Unclassified 1595
521 nmdc:mga03683_4533_c1 3300050489 Unclassified 1842
522 nmdc:mga03n38_26_c1 3300050490 Bacteria 35528
523 nmdc:mga00v17_13233_c1 3300050491 Bacteria 4573
524 nmdc:mga00v17_15069_c1 3300050491 Bacteria 4333
525 nmdc:mga00v17_4818_c1 3300050491 Bacteria 7064
526 nmdc:mga00v17_5598_c1 3300050491 Bacteria 6622
527 nmdc:mga00v17_686_c1 3300050491 Bacteria 18637
528 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
529 nmdc:mga0yw44_326_c1 3300050492 Bacteria 16654
530 nmdc:mga0yw44_9_c1 3300050492 Bacteria 178503
531 nmdc:mga0k408_13_c2 3300050493 Bacteria 76830
532 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
533 nmdc:mga0k408_252990_c1 3300050493 Bacteria 1052
534 nmdc:mga0k408_4932_c2 3300050493 Bacteria 5984
535 nmdc:mga06z11_1_c1 3300050494 Bacteria 196297
536 nmdc:mga04h51_6_c1 3300050495 Bacteria 126812
537 nmdc:mga07m45_102296_c1 3300050496 Bacteria 1645
538 nmdc:mga07m45_138566_c1 3300050496 Unclassified 1409
539 nmdc:mga07m45_430745_c1 3300050496 Bacteria 765
540 nmdc:mga08y16_1948_c1 3300050511 Bacteria 21042
541 nmdc:mga0sz30_8_c1 3300050516 Bacteria 107909
542 Ga0500635_0004345 3300053080 Bacteria 3646
543 Ga0500643_000010 3300053087 Bacteria 408084
544 Ga0500643_000133 3300053087 Bacteria 75773
545 Ga0500643_001206 3300053087 Bacteria 15437
546 Ga0500643_039261 3300053087 Bacteria 1399
547 Ga0500644_0003511 3300053088 Bacteria 3885
548 Ga0500644_0074628 3300053088 Bacteria 1231
549 Ga0500583_0002826 3300053092 Bacteria 5323
550 Ga0500651_0000047 3300053093 Bacteria 83743
551 Ga0500651_0000447 3300053093 Bacteria 22020
552 Ga0500651_0004746 3300053093 Bacteria 7665
553 Ga0500555_000006 3300053103 Bacteria 304416
554 Ga0500569_000006 3300053109 Bacteria 77425
555 Ga0500594_0000159 3300053118 Bacteria 17698
556 Ga0500608_000394 3300053122 Bacteria 16764
557 Ga0500628_000028 3300053129 Bacteria 59993
558 Ga0500655_001665 3300053133 Bacteria 4184
559 Ga0500659_0034139 3300053135 Bacteria 2772
560 Ga0500568_0029113 3300053139 Bacteria 2295
561 Ga0500577_0001682 3300053142 Bacteria 5660
562 Ga0500588_0000011 3300053146 Bacteria 48690
563 Ga0500589_023211 3300053147 Bacteria 2858
564 Ga0500616_0000012 3300053153 Bacteria 681798
565 Ga0500616_0000055 3300053153 Bacteria 289080
566 Ga0500570_034109 3300053724 Bacteria 2722
567 Ga0500613_000650 3300053738 Unclassified 2016
568 Ga0587098_018275 3300059604 Bacteria 867
569 Ga0587072_041953 3300059643 Bacteria 892
570 Ga0501082_0000069 3300060353 Bacteria 73946
571 Ga0466962_0149419 3300061719 Bacteria 1133

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031711 Ga0265314_10100820 Ga0265314_101008203 163
2 3300046648 Ga0495611_0468485 Ga0495611_0468485_59_562 163
3 3300046472 Ga0495580_0734846 Ga0495580_0734846_35_610 171
4 3300028558 Ga0265326_10005826 Ga0265326_100058262 172
5 3300028573 Ga0265334_10002134 Ga0265334_100021346 172
6 3300028654 Ga0265322_10007416 Ga0265322_100074163 172
7 3300028800 Ga0265338_10000925 Ga0265338_1000092526 172
8 3300029957 Ga0265324_10000345 Ga0265324_100003458 172
9 3300031238 Ga0265332_10227583 Ga0265332_102275831 172
10 3300031249 Ga0265339_10007423 Ga0265339_100074233 172
11 3300031251 Ga0265327_10001794 Ga0265327_1000179416 172
12 3300031344 Ga0265316_10001231 Ga0265316_1000123120 172
13 3300031711 Ga0265314_10344175 Ga0265314_103441752 172
14 3300053139 Ga0500568_0029113 Ga0500568_0029113_179_778 172
15 3300053087 Ga0500643_000010 Ga0500643_000010_252417_253016 173
16 3300053087 Ga0500643_039261 Ga0500643_039261_666_1250 173
17 3300005330 Ga0070690_100070745 Ga0070690_1000707452 179
18 3300025913 Ga0207695_10578037 Ga0207695_105780372 180
19 3300005289 Ga0065704_10007185 Ga0065704_100071853 181
20 3300005289 Ga0065704_10007667 Ga0065704_100076672 181
21 3300005329 Ga0070683_100039621 Ga0070683_1000396216 181
22 3300006058 Ga0075432_10010884 Ga0075432_100108842 181
23 3300006058 Ga0075432_10024318 Ga0075432_100243182 181
24 3300006946 Ga0079104_1015298 Ga0079104_10152982 181
25 3300009011 Ga0105251_10000057 Ga0105251_1000005746 181
26 3300009092 Ga0105250_10009653 Ga0105250_100096533 181
27 3300009092 Ga0105250_10019192 Ga0105250_100191922 181
28 3300017792 Ga0163161_10222416 Ga0163161_102224162 181
29 3300025292 Ga0209676_1000306 Ga0209676_100030623 181
30 3300025711 Ga0207696_1021987 Ga0207696_10219872 181
31 3300025735 Ga0207713_1000014 Ga0207713_100001453 181
32 3300025735 Ga0207713_1022673 Ga0207713_10226733 181
33 3300025735 Ga0207713_1035422 Ga0207713_10354222 181
34 3300025944 Ga0207661_10158690 Ga0207661_101586902 181
35 3300027907 Ga0207428_10416117 Ga0207428_104161171 181
36 3300042013 Ga0439456_000042 Ga0439456_000042_986_1531 181
37 3300046460 Ga0495638_0140474 Ga0495638_0140474_680_1225 181
38 3300048091 Ga0495626_0348544 Ga0495626_0348544_21_566 181
39 3300048914 Ga0496111_0459628 Ga0496111_0459628_62_607 181
40 3300048919 Ga0496116_0246031 Ga0496116_0246031_285_830 181
41 3300048924 Ga0496121_0335082 Ga0496121_0335082_37_582 181
42 3300049460 Ga0495682_0000200 Ga0495682_0000200_13341_13886 181
43 3300050493 nmdc:mga0k408_252990_c1 nmdc:mga0k408_252990_c1_65_610 181
44 3300053088 Ga0500644_0074628 Ga0500644_0074628_426_995 181
45 3300060353 Ga0501082_0000069 Ga0501082_0000069_64827_65411 182
46 3300028800 Ga0265338_10002976 Ga0265338_100029768 183
47 3300041406 Ga0439439_0001786 Ga0439439_0001786_1533_2174 183
48 3300042007 Ga0439449_0106352 Ga0439449_0106352_147_791 183
49 3300042014 Ga0439457_003129 Ga0439457_003129_3678_4319 183
50 3300042015 Ga0439462_0000460 Ga0439462_0000460_1250_1891 183
51 3300005336 Ga0070680_100015091 Ga0070680_1000150913 184
52 3300005458 Ga0070681_10046333 Ga0070681_100463333 184
53 3300005530 Ga0070679_100280697 Ga0070679_1002806972 184
54 3300005563 Ga0068855_100002255 Ga0068855_10000225510 184
55 3300005614 Ga0068856_100992389 Ga0068856_1009923892 184
56 3300009093 Ga0105240_10000638 Ga0105240_100006387 184
57 3300009093 Ga0105240_10061829 Ga0105240_100618292 184
58 3300025225 Ga0209566_101212 Ga0209566_1012127 184
59 3300025912 Ga0207707_10077329 Ga0207707_100773292 184
60 3300025913 Ga0207695_10000109 Ga0207695_1000010963 184
61 3300025917 Ga0207660_10050196 Ga0207660_100501962 184
62 3300025949 Ga0207667_10198444 Ga0207667_101984442 184
63 3300026078 Ga0207702_10565603 Ga0207702_105656031 184
64 3300037471 Ga0395905_0000135 Ga0395905_0000135_103853_104509 184
65 3300042006 Ga0439432_101908 Ga0439432_101908_18_572 184
66 3300049568 Ga0501031_0011085 Ga0501031_0011085_1670_2224 184
67 3300049571 Ga0501034_0189335 Ga0501034_0189335_1307_1861 184
68 3300049573 Ga0501037_0004473 Ga0501037_0004473_5274_5828 184
69 3300049575 Ga0501039_0162703 Ga0501039_0162703_76_630 184
70 3300049578 Ga0501042_0087401 Ga0501042_0087401_889_1443 184
71 3300049744 Ga0501083_0020685 Ga0501083_0020685_3980_4555 184
72 3300049822 Ga0501035_0079229 Ga0501035_0079229_689_1243 184
73 3300061719 Ga0466962_0149419 Ga0466962_0149419_161_817 184
74 3300006946 Ga0079104_1003845 Ga0079104_10038453 185
75 3300027111 Ga0209281_1000041 Ga0209281_10000418 185
76 3300027312 Ga0209371_1006598 Ga0209371_10065984 185
77 3300030500 Ga0268256_1024295 Ga0268256_10242952 185
78 3300046472 Ga0495580_0003111 Ga0495580_0003111_5253_5819 185
79 3300046473 Ga0495582_0488617 Ga0495582_0488617_13_579 185
80 3300046499 Ga0495594_0002832 Ga0495594_0002832_140_706 185
81 3300046526 Ga0495666_0015496 Ga0495666_0015496_92_658 185
82 3300048919 Ga0496116_0067778 Ga0496116_0067778_236_892 185
83 3300048925 Ga0496122_0007310 Ga0496122_0007310_6202_6858 185
84 3300048927 Ga0496124_0000078 Ga0496124_0000078_172705_173361 185
85 3300048928 Ga0496125_0001786 Ga0496125_0001786_5124_5780 185
86 3300053093 Ga0500651_0000447 Ga0500651_0000447_5800_6357 185
87 3300053142 Ga0500577_0001682 Ga0500577_0001682_3689_4246 185
88 3300003187 JGI25151J46595_10031751 JGI25151J46595_100317512 186
89 3300003781 Ga0055536_1007556 Ga0055536_10075564 186
90 3300005289 Ga0065704_10013130 Ga0065704_100131302 186
91 3300006038 Ga0075365_10000023 Ga0075365_1000002350 186
92 3300009093 Ga0105240_10134355 Ga0105240_101343553 186
93 3300009148 Ga0105243_10097525 Ga0105243_100975252 186
94 3300009993 Ga0105028_100019 Ga0105028_10001921 186
95 3300010375 Ga0105239_11574612 Ga0105239_115746121 186
96 3300013307 Ga0157372_10039759 Ga0157372_100397593 186
97 3300025294 Ga0209025_1000769 Ga0209025_100076924 186
98 3300025303 Ga0209051_1017553 Ga0209051_10175533 186
99 3300025935 Ga0207709_10140438 Ga0207709_101404382 186
100 3300027312 Ga0209371_1011655 Ga0209371_10116553 186
101 3300030500 Ga0268256_1012658 Ga0268256_10126583 186
102 3300035111 Ga0373923_0034081 Ga0373923_0034081_1063_1635 186
103 3300037471 Ga0395905_0135972 Ga0395905_0135972_789_1433 186
104 3300042006 Ga0439432_010735 Ga0439432_010735_1710_2318 186
105 3300042142 Ga0450905_002057 Ga0450905_002057_35_643 186
106 3300046515 Ga0495620_0000027 Ga0495620_0000027_5669_6277 186
107 3300046519 Ga0495632_0028538 Ga0495632_0028538_1332_1940 186
108 3300046522 Ga0495643_0000955 Ga0495643_0000955_3000_3608 186
109 3300046524 Ga0495648_0035813 Ga0495648_0035813_1145_1753 186
110 3300048917 Ga0496114_0111022 Ga0496114_0111022_537_1145 186
111 3300048919 Ga0496116_0123680 Ga0496116_0123680_439_1047 186
112 3300048920 Ga0496117_0077072 Ga0496117_0077072_445_1053 186
113 3300049571 Ga0501034_0000557 Ga0501034_0000557_53855_54463 186
114 3300049571 Ga0501034_0000588 Ga0501034_0000588_43803_44447 186
115 3300050491 nmdc:mga00v17_686_c1 nmdc:mga00v17_686_c1_16596_17159 186
116 3300050492 nmdc:mga0yw44_9_c1 nmdc:mga0yw44_9_c1_16605_17168 186
117 3300050496 nmdc:mga07m45_430745_c1 nmdc:mga07m45_430745_c1_46_609 186
118 3300053135 Ga0500659_0034139 Ga0500659_0034139_1351_1959 186
119 3300003578 Ga0006562J51391_1001508 Ga0006562J51391_10015085 187
120 3300005458 Ga0070681_10319874 Ga0070681_103198742 187
121 3300005530 Ga0070679_100012264 Ga0070679_1000122647 187
122 3300005535 Ga0070684_100541094 Ga0070684_1005410942 187
123 3300005563 Ga0068855_100125581 Ga0068855_1001255813 187
124 3300005577 Ga0068857_100056471 Ga0068857_1000564716 187
125 3300005616 Ga0068852_100594514 Ga0068852_1005945142 187
126 3300009174 Ga0105241_10543494 Ga0105241_105434942 187
127 3300013296 Ga0157374_10282024 Ga0157374_102820243 187
128 3300025225 Ga0209566_106293 Ga0209566_1062932 187
129 3300025912 Ga0207707_10543175 Ga0207707_105431752 187
130 3300025949 Ga0207667_10102624 Ga0207667_101026243 187
131 3300026116 Ga0207674_10071296 Ga0207674_100712966 187
132 3300027617 Ga0210002_1012142 Ga0210002_10121423 187
133 3300027876 Ga0209974_10002444 Ga0209974_100024442 187
134 3300037466 Ga0395898_0059193 Ga0395898_0059193_1217_1789 187
135 3300046694 Ga0495649_0093359 Ga0495649_0093359_530_1156 187
136 3300048913 Ga0496110_0478593 Ga0496110_0478593_392_967 187
137 3300048919 Ga0496116_0188592 Ga0496116_0188592_363_971 187
138 3300048924 Ga0496121_0211983 Ga0496121_0211983_29_637 187
139 3300048926 Ga0496123_0081564 Ga0496123_0081564_664_1272 187
140 3300048927 Ga0496124_0060756 Ga0496124_0060756_1949_2524 187
141 3300049571 Ga0501034_0000241 Ga0501034_0000241_83828_84406 187
142 3300049573 Ga0501037_0000001 Ga0501037_0000001_212197_212775 187
143 3300049579 Ga0501043_0360809 Ga0501043_0360809_424_1002 187
144 3300049823 Ga0501044_0282009 Ga0501044_0282009_364_942 187
145 3300003203 JGI25406J46586_10056662 JGI25406J46586_100566621 188
146 3300005331 Ga0070670_100934070 Ga0070670_1009340701 188
147 3300005335 Ga0070666_10011738 Ga0070666_100117385 188
148 3300005338 Ga0068868_100059412 Ga0068868_1000594122 188
149 3300005355 Ga0070671_101204876 Ga0070671_1012048761 188
150 3300005367 Ga0070667_100000001 Ga0070667_100000001889 188
151 3300005530 Ga0070679_100289112 Ga0070679_1002891122 188
152 3300005544 Ga0070686_100344773 Ga0070686_1003447732 188
153 3300005547 Ga0070693_100088354 Ga0070693_1000883543 188
154 3300005578 Ga0068854_100158599 Ga0068854_1001585992 188
155 3300005842 Ga0068858_100013351 Ga0068858_1000133512 188
156 3300005843 Ga0068860_100006387 Ga0068860_1000063875 188
157 3300005843 Ga0068860_100158980 Ga0068860_1001589804 188
158 3300005985 Ga0081539_10007261 Ga0081539_100072615 188
159 3300009011 Ga0105251_10013468 Ga0105251_100134683 188
160 3300009036 Ga0105244_10005826 Ga0105244_100058263 188
161 3300009093 Ga0105240_10295291 Ga0105240_102952912 188
162 3300009093 Ga0105240_10605903 Ga0105240_106059032 188
163 3300009098 Ga0105245_10018473 Ga0105245_100184735 188
164 3300009098 Ga0105245_10566570 Ga0105245_105665703 188
165 3300009174 Ga0105241_10050251 Ga0105241_100502513 188
166 3300009551 Ga0105238_10068656 Ga0105238_100686562 188
167 3300009993 Ga0105028_100770 Ga0105028_1007703 188
168 3300011119 Ga0105246_10179908 Ga0105246_101799082 188
169 3300013104 Ga0157370_10034557 Ga0157370_100345573 188
170 3300013105 Ga0157369_10012990 Ga0157369_100129908 188
171 3300013296 Ga0157374_10474437 Ga0157374_104744373 188
172 3300013297 Ga0157378_10009088 Ga0157378_100090884 188
173 3300013307 Ga0157372_10686938 Ga0157372_106869381 188
174 3300013308 Ga0157375_10316547 Ga0157375_103165472 188
175 3300025233 Ga0209437_100889 Ga0209437_1008895 188
176 3300025315 Ga0207697_10129778 Ga0207697_101297782 188
177 3300025728 Ga0207655_1006030 Ga0207655_10060305 188
178 3300025735 Ga0207713_1022846 Ga0207713_10228462 188
179 3300025921 Ga0207652_10131536 Ga0207652_101315363 188
180 3300025924 Ga0207694_10074619 Ga0207694_100746192 188
181 3300025927 Ga0207687_10212466 Ga0207687_102124662 188
182 3300025927 Ga0207687_10326885 Ga0207687_103268853 188
183 3300025986 Ga0207658_10000003 Ga0207658_10000003490 188
184 3300026023 Ga0207677_10007434 Ga0207677_100074344 188
185 3300026035 Ga0207703_10985904 Ga0207703_109859042 188
186 3300028381 Ga0268264_10002058 Ga0268264_100020587 188
187 3300028381 Ga0268264_10383513 Ga0268264_103835132 188
188 3300047318 Ga0495636_0054169 Ga0495636_0054169_889_1527 188
189 3300048919 Ga0496116_0012736 Ga0496116_0012736_5047_5655 188
190 3300048919 Ga0496116_0017923 Ga0496116_0017923_336_956 188
191 3300048920 Ga0496117_0009629 Ga0496117_0009629_2925_3533 188
192 3300048921 Ga0496118_0007541 Ga0496118_0007541_2932_3540 188
193 3300048922 Ga0496119_0008969 Ga0496119_0008969_5414_6022 188
194 3300048923 Ga0496120_0004455 Ga0496120_0004455_10710_11318 188
195 3300048924 Ga0496121_0040980 Ga0496121_0040980_1169_1777 188
196 3300048925 Ga0496122_0013878 Ga0496122_0013878_1005_1613 188
197 3300048925 Ga0496122_0054136 Ga0496122_0054136_113_733 188
198 3300048927 Ga0496124_0106499 Ga0496124_0106499_83_703 188
199 3300048927 Ga0496124_0356652 Ga0496124_0356652_80_688 188
200 3300048928 Ga0496125_0001704 Ga0496125_0001704_10966_11574 188
201 3300048929 Ga0496126_0220187 Ga0496126_0220187_500_1108 188
202 3300049161 Ga0501305_015110 Ga0501305_015110_209_829 188
203 3300049529 Ga0501313_014224 Ga0501313_014224_19_639 188
204 3300049534 Ga0501318_006435 Ga0501318_006435_243_863 188
205 3300059604 Ga0587098_018275 Ga0587098_018275_228_848 188
206 3300059643 Ga0587072_041953 Ga0587072_041953_23_643 188
207 3300005435 Ga0070714_100025912 Ga0070714_1000259123 189
208 3300005458 Ga0070681_10626418 Ga0070681_106264182 189
209 3300005530 Ga0070679_100000257 Ga0070679_10000025727 189
210 3300005544 Ga0070686_100061199 Ga0070686_1000611994 189
211 3300005563 Ga0068855_100000011 Ga0068855_100000011201 189
212 3300005563 Ga0068855_100045297 Ga0068855_1000452976 189
213 3300006051 Ga0075364_10025049 Ga0075364_100250492 189
214 3300006358 Ga0068871_100000177 Ga0068871_1000001776 189
215 3300009098 Ga0105245_10000002 Ga0105245_10000002413 189
216 3300009174 Ga0105241_10249282 Ga0105241_102492822 189
217 3300009551 Ga0105238_10003536 Ga0105238_1000353617 189
218 3300009993 Ga0105028_100245 Ga0105028_1002455 189
219 3300013105 Ga0157369_11169772 Ga0157369_111697722 189
220 3300013296 Ga0157374_10000018 Ga0157374_10000018254 189
221 3300025911 Ga0207654_10449716 Ga0207654_104497162 189
222 3300025913 Ga0207695_10002301 Ga0207695_100023018 189
223 3300025921 Ga0207652_10000322 Ga0207652_1000032235 189
224 3300025924 Ga0207694_10001648 Ga0207694_100016482 189
225 3300025927 Ga0207687_10000001 Ga0207687_10000001798 189
226 3300025929 Ga0207664_10022486 Ga0207664_100224865 189
227 3300025949 Ga0207667_10000042 Ga0207667_1000004289 189
228 3300025949 Ga0207667_10000660 Ga0207667_1000066012 189
229 3300025949 Ga0207667_10119734 Ga0207667_101197342 189
230 3300028800 Ga0265338_10002029 Ga0265338_1000202928 189
231 3300045976 Ga0466967_0397124 Ga0466967_0397124_287_871 189
232 3300049742 Ga0501080_0236647 Ga0501080_0236647_855_1436 189
233 3300050491 nmdc:mga00v17_13233_c1 nmdc:mga00v17_13233_c1_2065_2646 189
234 iso_pu_bacteria 8057473075 8057476798 189
235 3300003323 rootH1_10120216 rootH1_101202168 190
236 3300005329 Ga0070683_100212405 Ga0070683_1002124052 190
237 3300005334 Ga0068869_100329953 Ga0068869_1003299531 190
238 3300005355 Ga0070671_100000001 Ga0070671_100000001630 190
239 3300005535 Ga0070684_100060651 Ga0070684_1000606513 190
240 3300005577 Ga0068857_100317049 Ga0068857_1003170492 190
241 3300005614 Ga0068856_100040384 Ga0068856_1000403845 190
242 3300005617 Ga0068859_100493052 Ga0068859_1004930523 190
243 3300006195 Ga0075366_10023362 Ga0075366_100233622 190
244 3300006353 Ga0075370_10035461 Ga0075370_100354612 190
245 3300006881 Ga0068865_100245218 Ga0068865_1002452183 190
246 3300006931 Ga0097620_100493032 Ga0097620_1004930323 190
247 3300009093 Ga0105240_10097122 Ga0105240_100971221 190
248 3300009986 Ga0105033_100852 Ga0105033_1008522 190
249 3300013307 Ga0157372_10391203 Ga0157372_103912032 190
250 3300020610 Ga0154015_1639401 Ga0154015_16394012 190
251 3300025913 Ga0207695_10357984 Ga0207695_103579841 190
252 3300025921 Ga0207652_10107974 Ga0207652_101079742 190
253 3300025931 Ga0207644_10000001 Ga0207644_10000001806 190
254 3300025938 Ga0207704_10141262 Ga0207704_101412622 190
255 3300025944 Ga0207661_10455773 Ga0207661_104557732 190
256 3300026078 Ga0207702_10028728 Ga0207702_100287285 190
257 3300028563 Ga0265319_1002944 Ga0265319_10029447 190
258 3300028800 Ga0265338_10021997 Ga0265338_100219976 190
259 3300028800 Ga0265338_10089830 Ga0265338_100898302 190
260 3300029957 Ga0265324_10188251 Ga0265324_101882512 190
261 3300034816 Ga0373930_0049808 Ga0373930_0049808_73_645 190
262 3300037312 Ga0395899_0023574 Ga0395899_0023574_3863_4471 190
263 3300049580 Ga0501046_0029051 Ga0501046_0029051_804_1379 190
264 3300050493 nmdc:mga0k408_4932_c2 nmdc:mga0k408_4932_c2_4484_5095 190
265 3300050496 nmdc:mga07m45_102296_c1 nmdc:mga07m45_102296_c1_496_1086 190
266 3300050496 nmdc:mga07m45_138566_c1 nmdc:mga07m45_138566_c1_229_819 190
267 3300053093 Ga0500651_0000047 Ga0500651_0000047_57890_58471 190
268 3300053093 Ga0500651_0004746 Ga0500651_0004746_2833_3414 190
269 3300053153 Ga0500616_0000012 Ga0500616_0000012_423607_424197 190
270 iso_pu_bacteria 2585428059 2587741343 190
271 iso_pu_bacteria 2643221543 2643736773 190
272 iso_pu_bacteria 2643221676 2644422678 190
273 iso_pu_bacteria 2864733723 2864735876 190
274 iso_pu_bacteria 2889042446 2889047837 190
275 iso_pu_bacteria 2904162308 2904166981 190
276 iso_pu_bacteria 2904490793 2904496212 190
277 iso_pu_bacteria 2915597211 2915597605 190
278 iso_pu_bacteria 2919160200 2919165509 190
279 iso_pu_bacteria 2931384279 2931384946 190
280 iso_pu_bacteria 2939679117 2939685340 190
281 iso_pu_bacteria 2945991243 2945996441 190
282 iso_pu_bacteria 2946053406 2946059129 190
283 3300001915 JGI24741J21665_1000514 JGI24741J21665_100051411 191
284 3300003320 rootH2_10000244 rootH2_10000244509 191
285 3300003323 rootH1_10239005 rootH1_102390052 191
286 3300005329 Ga0070683_100000112 Ga0070683_10000011235 191
287 3300005329 Ga0070683_100000505 Ga0070683_10000050528 191
288 3300005329 Ga0070683_100125735 Ga0070683_1001257352 191
289 3300005331 Ga0070670_100190071 Ga0070670_1001900713 191
290 3300005336 Ga0070680_100010777 Ga0070680_1000107773 191
291 3300005336 Ga0070680_100388673 Ga0070680_1003886732 191
292 3300005336 Ga0070680_100615370 Ga0070680_1006153701 191
293 3300005337 Ga0070682_100001074 Ga0070682_1000010744 191
294 3300005337 Ga0070682_100002842 Ga0070682_1000028424 191
295 3300005339 Ga0070660_100000078 Ga0070660_10000007848 191
296 3300005339 Ga0070660_100000837 Ga0070660_1000008375 191
297 3300005339 Ga0070660_100193610 Ga0070660_1001936102 191
298 3300005455 Ga0070663_100131158 Ga0070663_1001311583 191
299 3300005458 Ga0070681_10251128 Ga0070681_102511282 191
300 3300005458 Ga0070681_10254224 Ga0070681_102542242 191
301 3300005458 Ga0070681_10392718 Ga0070681_103927182 191
302 3300005458 Ga0070681_10472474 Ga0070681_104724742 191
303 3300005530 Ga0070679_100006394 Ga0070679_1000063945 191
304 3300005530 Ga0070679_100020648 Ga0070679_1000206482 191
305 3300005530 Ga0070679_100020714 Ga0070679_1000207148 191
306 3300005530 Ga0070679_100059134 Ga0070679_1000591343 191
307 3300005530 Ga0070679_100184271 Ga0070679_1001842713 191
308 3300005530 Ga0070679_100220044 Ga0070679_1002200443 191
309 3300005530 Ga0070679_100472981 Ga0070679_1004729812 191
310 3300005535 Ga0070684_100000049 Ga0070684_10000004935 191
311 3300005535 Ga0070684_100043297 Ga0070684_1000432974 191
312 3300005535 Ga0070684_100123109 Ga0070684_1001231093 191
313 3300005563 Ga0068855_100001288 Ga0068855_10000128825 191
314 3300005563 Ga0068855_100011942 Ga0068855_1000119424 191
315 3300005563 Ga0068855_100338897 Ga0068855_1003388972 191
316 3300005577 Ga0068857_100059939 Ga0068857_1000599394 191
317 3300005578 Ga0068854_100033781 Ga0068854_1000337815 191
318 3300005614 Ga0068856_100004033 Ga0068856_10000403319 191
319 3300005614 Ga0068856_100041933 Ga0068856_1000419332 191
320 3300005616 Ga0068852_100130302 Ga0068852_1001303022 191
321 3300005616 Ga0068852_100476760 Ga0068852_1004767602 191
322 3300005617 Ga0068859_100341811 Ga0068859_1003418112 191
323 3300005618 Ga0068864_101002898 Ga0068864_1010028982 191
324 3300005843 Ga0068860_100000012 Ga0068860_10000001228 191
325 3300006186 Ga0075369_10000020 Ga0075369_1000002020 191
326 3300006195 Ga0075366_10000001 Ga0075366_10000001263 191
327 3300006931 Ga0097620_100341818 Ga0097620_1003418182 191
328 3300009093 Ga0105240_10000004 Ga0105240_10000004233 191
329 3300009093 Ga0105240_10000501 Ga0105240_1000050134 191
330 3300009093 Ga0105240_10002332 Ga0105240_100023327 191
331 3300009093 Ga0105240_10013030 Ga0105240_100130303 191
332 3300009093 Ga0105240_10157900 Ga0105240_101579002 191
333 3300009093 Ga0105240_10158464 Ga0105240_101584641 191
334 3300009093 Ga0105240_10834989 Ga0105240_108349891 191
335 3300009094 Ga0111539_10001117 Ga0111539_1000111735 191
336 3300009174 Ga0105241_10119222 Ga0105241_101192221 191
337 3300009174 Ga0105241_10133619 Ga0105241_101336192 191
338 3300009174 Ga0105241_10141745 Ga0105241_101417453 191
339 3300009545 Ga0105237_10000001 Ga0105237_10000001666 191
340 3300009545 Ga0105237_10001685 Ga0105237_1000168523 191
341 3300009551 Ga0105238_10011803 Ga0105238_1001180313 191
342 3300009984 Ga0105029_100074 Ga0105029_1000742 191
343 3300010375 Ga0105239_10916460 Ga0105239_109164601 191
344 3300013100 Ga0157373_10000061 Ga0157373_1000006171 191
345 3300013102 Ga0157371_10000176 Ga0157371_1000017668 191
346 3300013104 Ga0157370_10000115 Ga0157370_1000011549 191
347 3300013104 Ga0157370_10019304 Ga0157370_100193043 191
348 3300013105 Ga0157369_10000063 Ga0157369_1000006387 191
349 3300013296 Ga0157374_10683690 Ga0157374_106836902 191
350 3300013307 Ga0157372_10000002 Ga0157372_10000002211 191
351 3300013307 Ga0157372_10018029 Ga0157372_100180293 191
352 3300013307 Ga0157372_10052066 Ga0157372_100520666 191
353 3300014326 Ga0157380_10207082 Ga0157380_102070823 191
354 3300025291 Ga0209675_1014633 Ga0209675_10146332 191
355 3300025294 Ga0209025_1007291 Ga0209025_10072913 191
356 3300025912 Ga0207707_10032501 Ga0207707_100325014 191
357 3300025912 Ga0207707_10274433 Ga0207707_102744332 191
358 3300025912 Ga0207707_10894741 Ga0207707_108947411 191
359 3300025913 Ga0207695_10000009 Ga0207695_10000009613 191
360 3300025913 Ga0207695_10033021 Ga0207695_100330212 191
361 3300025913 Ga0207695_10044777 Ga0207695_100447772 191
362 3300025913 Ga0207695_10111733 Ga0207695_101117332 191
363 3300025914 Ga0207671_10000003 Ga0207671_10000003669 191
364 3300025914 Ga0207671_10000014 Ga0207671_10000014445 191
365 3300025917 Ga0207660_10001981 Ga0207660_100019817 191
366 3300025917 Ga0207660_10005822 Ga0207660_100058225 191
367 3300025917 Ga0207660_10014750 Ga0207660_100147507 191
368 3300025917 Ga0207660_10504324 Ga0207660_105043241 191
369 3300025919 Ga0207657_10002660 Ga0207657_1000266016 191
370 3300025919 Ga0207657_10003164 Ga0207657_100031645 191
371 3300025919 Ga0207657_10178910 Ga0207657_101789102 191
372 3300025921 Ga0207652_10010483 Ga0207652_100104835 191
373 3300025921 Ga0207652_10027248 Ga0207652_100272485 191
374 3300025921 Ga0207652_10056308 Ga0207652_100563082 191
375 3300025921 Ga0207652_10235542 Ga0207652_102355422 191
376 3300025921 Ga0207652_10368795 Ga0207652_103687952 191
377 3300025944 Ga0207661_10000077 Ga0207661_1000007724 191
378 3300025944 Ga0207661_10000129 Ga0207661_1000012928 191
379 3300025944 Ga0207661_10889042 Ga0207661_108890422 191
380 3300025949 Ga0207667_10017183 Ga0207667_100171834 191
381 3300025949 Ga0207667_10021980 Ga0207667_100219805 191
382 3300025949 Ga0207667_10340214 Ga0207667_103402142 191
383 3300025981 Ga0207640_10025344 Ga0207640_100253442 191
384 3300026041 Ga0207639_10114995 Ga0207639_101149952 191
385 3300026067 Ga0207678_10233679 Ga0207678_102336792 191
386 3300026078 Ga0207702_10000739 Ga0207702_1000073943 191
387 3300026078 Ga0207702_10206447 Ga0207702_102064472 191
388 3300026142 Ga0207698_10019644 Ga0207698_100196442 191
389 3300027907 Ga0207428_10206415 Ga0207428_102064152 191
390 3300028381 Ga0268264_10000292 Ga0268264_1000029210 191
391 3300028800 Ga0265338_10001149 Ga0265338_1000114916 191
392 3300028800 Ga0265338_10129951 Ga0265338_101299512 191
393 3300028800 Ga0265338_10399948 Ga0265338_103999482 191
394 3300029957 Ga0265324_10002943 Ga0265324_100029433 191
395 3300030735 Ga0316178_1033575 Ga0316178_10335753 191
396 3300030745 Ga0316182_1211437 Ga0316182_12114372 191
397 3300031238 Ga0265332_10007223 Ga0265332_100072235 191
398 3300031712 Ga0265342_10006667 Ga0265342_100066672 191
399 3300037312 Ga0395899_0201967 Ga0395899_0201967_687_1280 191
400 3300037418 Ga0395900_0172844 Ga0395900_0172844_1562_2155 191
401 3300037466 Ga0395898_0014631 Ga0395898_0014631_1359_1952 191
402 3300037471 Ga0395905_0002031 Ga0395905_0002031_1503_2096 191
403 3300038443 Ga0395901_0075402 Ga0395901_0075402_508_1101 191
404 3300038443 Ga0395901_1204227 Ga0395901_1204227_62_652 191
405 3300041405 Ga0439438_011278 Ga0439438_011278_528_1121 191
406 3300041407 Ga0439447_013111 Ga0439447_013111_1200_1793 191
407 3300041410 Ga0439461_0000490 Ga0439461_0000490_1445_2038 191
408 3300041411 Ga0439466_0010627 Ga0439466_0010627_1090_1683 191
409 3300041997 Ga0439431_0060709 Ga0439431_0060709_383_976 191
410 3300042002 Ga0439442_003494 Ga0439442_003494_60_653 191
411 3300042014 Ga0439457_015177 Ga0439457_015177_669_1262 191
412 3300042121 Ga0450919_017705 Ga0450919_017705_100_693 191
413 3300042156 Ga0439446_0000001 Ga0439446_0000001_40483_41076 191
414 3300042156 Ga0439446_0002635 Ga0439446_0002635_1010_1603 191
415 3300042435 Ga0439434_0001673 Ga0439434_0001673_2738_3331 191
416 3300046460 Ga0495638_0000227 Ga0495638_0000227_42990_43595 191
417 3300046694 Ga0495649_0001296 Ga0495649_0001296_6679_7287 191
418 3300048929 Ga0496126_0283642 Ga0496126_0283642_323_931 191
419 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_821721_822317 191
420 3300050511 nmdc:mga08y16_1948_c1 nmdc:mga08y16_1948_c1_8311_8910 191
421 3300050516 nmdc:mga0sz30_8_c1 nmdc:mga0sz30_8_c1_27292_27888 191
422 3300053088 Ga0500644_0003511 Ga0500644_0003511_1793_2410 191
423 3300053109 Ga0500569_000006 Ga0500569_000006_42990_43595 191
424 3300053118 Ga0500594_0000159 Ga0500594_0000159_1386_2003 191
425 3300053129 Ga0500628_000028 Ga0500628_000028_53011_53628 191
426 3300053146 Ga0500588_0000011 Ga0500588_0000011_22872_23477 191
427 3300053153 Ga0500616_0000055 Ga0500616_0000055_32014_32607 191
428 3300053738 Ga0500613_000650 Ga0500613_000650_58_657 191
429 iso_pu_bacteria 2512564039 2512736205 191
430 iso_pu_bacteria 2513237150 2513953014 191
431 iso_pu_bacteria 2513237165 2514043883 191
432 iso_pu_bacteria 2524023129 2524186005 191
433 iso_pu_bacteria 2671180694 2673816843 191
434 iso_pu_bacteria 2721755763 2723878992 191
435 iso_pu_bacteria 2758568016 2758640614 191
436 iso_pu_bacteria 2854911287 2854913901 191
437 iso_pu_bacteria 2889049205 2889054227 191
438 iso_pu_bacteria 2915650412 2915650772 191
439 iso_pu_bacteria 2919125081 2919128261 191
440 iso_pu_bacteria 644736347 644747372 191
441 iso_pu_bacteria 8056533031 8056534657 191
442 iso_pu_bacteria 8057733483 8057738576 191
443 3300005327 Ga0070658_10115392 Ga0070658_101153922 192
444 3300005334 Ga0068869_100699203 Ga0068869_1006992031 192
445 3300005336 Ga0070680_100093206 Ga0070680_1000932063 192
446 3300005336 Ga0070680_100609685 Ga0070680_1006096852 192
447 3300005347 Ga0070668_100280584 Ga0070668_1002805842 192
448 3300005355 Ga0070671_100048965 Ga0070671_1000489653 192
449 3300005355 Ga0070671_100493576 Ga0070671_1004935762 192
450 3300005458 Ga0070681_10000759 Ga0070681_1000075925 192
451 3300005459 Ga0068867_100011888 Ga0068867_1000118887 192
452 3300005518 Ga0070699_100069469 Ga0070699_1000694692 192
453 3300005530 Ga0070679_100007222 Ga0070679_1000072227 192
454 3300005548 Ga0070665_100608974 Ga0070665_1006089743 192
455 3300005563 Ga0068855_100780998 Ga0068855_1007809982 192
456 3300005577 Ga0068857_100132793 Ga0068857_1001327931 192
457 3300005614 Ga0068856_100000001 Ga0068856_100000001411 192
458 3300005614 Ga0068856_100850974 Ga0068856_1008509742 192
459 3300005718 Ga0068866_10000503 Ga0068866_1000050310 192
460 3300005719 Ga0068861_100938524 Ga0068861_1009385242 192
461 3300006038 Ga0075365_10004036 Ga0075365_100040365 192
462 3300006051 Ga0075364_10114248 Ga0075364_101142483 192
463 3300006844 Ga0075428_100016402 Ga0075428_10001640210 192
464 3300009036 Ga0105244_10006746 Ga0105244_100067466 192
465 3300009093 Ga0105240_10000003 Ga0105240_10000003991 192
466 3300009093 Ga0105240_10006840 Ga0105240_1000684011 192
467 3300009093 Ga0105240_10015410 Ga0105240_100154107 192
468 3300009094 Ga0111539_10547796 Ga0111539_105477962 192
469 3300009098 Ga0105245_10000050 Ga0105245_10000050131 192
470 3300009098 Ga0105245_10002107 Ga0105245_100021076 192
471 3300009148 Ga0105243_10000001 Ga0105243_10000001301 192
472 3300009174 Ga0105241_10230223 Ga0105241_102302232 192
473 3300009174 Ga0105241_10937812 Ga0105241_109378121 192
474 3300009176 Ga0105242_10000011 Ga0105242_10000011151 192
475 3300009176 Ga0105242_10001558 Ga0105242_1000155811 192
476 3300009545 Ga0105237_10057233 Ga0105237_100572334 192
477 3300009553 Ga0105249_10004446 Ga0105249_1000444611 192
478 3300009553 Ga0105249_10007441 Ga0105249_100074411 192
479 3300010375 Ga0105239_10004476 Ga0105239_100044768 192
480 3300010375 Ga0105239_10012551 Ga0105239_100125514 192
481 3300010375 Ga0105239_10016668 Ga0105239_100166686 192
482 3300010375 Ga0105239_10355011 Ga0105239_103550112 192
483 3300013102 Ga0157371_10245764 Ga0157371_102457642 192
484 3300013104 Ga0157370_10034708 Ga0157370_100347083 192
485 3300013105 Ga0157369_10043054 Ga0157369_100430546 192
486 3300013105 Ga0157369_11378198 Ga0157369_113781981 192
487 3300013296 Ga0157374_10000064 Ga0157374_1000006485 192
488 3300013296 Ga0157374_10031041 Ga0157374_100310417 192
489 3300013307 Ga0157372_10005893 Ga0157372_1000589310 192
490 3300013308 Ga0157375_10484876 Ga0157375_104848762 192
491 3300014745 Ga0157377_10091720 Ga0157377_100917203 192
492 3300014968 Ga0157379_10686392 Ga0157379_106863922 192
493 3300014969 Ga0157376_10000007 Ga0157376_10000007328 192
494 3300015684 Ga0183365_10001 Ga0183365_100011987 192
495 3300017792 Ga0163161_10284035 Ga0163161_102840352 192
496 3300025728 Ga0207655_1000836 Ga0207655_100083612 192
497 3300025899 Ga0207642_10000184 Ga0207642_1000018411 192
498 3300025904 Ga0207647_10043391 Ga0207647_100433912 192
499 3300025909 Ga0207705_10102917 Ga0207705_101029173 192
500 3300025911 Ga0207654_10151425 Ga0207654_101514251 192
501 3300025912 Ga0207707_10020943 Ga0207707_100209433 192
502 3300025912 Ga0207707_10065105 Ga0207707_100651052 192
503 3300025913 Ga0207695_10000005 Ga0207695_100000051001 192
504 3300025913 Ga0207695_10005572 Ga0207695_1000557211 192
505 3300025913 Ga0207695_10021060 Ga0207695_100210602 192
506 3300025914 Ga0207671_10203724 Ga0207671_102037241 192
507 3300025917 Ga0207660_10125739 Ga0207660_101257392 192
508 3300025921 Ga0207652_10005379 Ga0207652_100053795 192
509 3300025923 Ga0207681_10671154 Ga0207681_106711542 192
510 3300025927 Ga0207687_10000117 Ga0207687_1000011747 192
511 3300025927 Ga0207687_10020880 Ga0207687_100208803 192
512 3300025931 Ga0207644_10018955 Ga0207644_100189553 192
513 3300025931 Ga0207644_10429891 Ga0207644_104298912 192
514 3300025934 Ga0207686_10000001 Ga0207686_10000001842 192
515 3300025934 Ga0207686_10000889 Ga0207686_1000088910 192
516 3300025935 Ga0207709_10000002 Ga0207709_10000002960 192
517 3300025949 Ga0207667_10189705 Ga0207667_101897054 192
518 3300025949 Ga0207667_10539103 Ga0207667_105391032 192
519 3300025961 Ga0207712_10000432 Ga0207712_1000043227 192
520 3300025986 Ga0207658_10009963 Ga0207658_100099637 192
521 3300026067 Ga0207678_10078692 Ga0207678_100786922 192
522 3300026078 Ga0207702_10000001 Ga0207702_10000001960 192
523 3300026116 Ga0207674_10008133 Ga0207674_100081337 192
524 3300028379 Ga0268266_10550733 Ga0268266_105507332 192
525 3300028573 Ga0265334_10000337 Ga0265334_1000033719 192
526 3300028800 Ga0265338_10002326 Ga0265338_100023268 192
527 3300031240 Ga0265320_10032017 Ga0265320_100320171 192
528 3300031247 Ga0265340_10000152 Ga0265340_1000015237 192
529 3300037312 Ga0395899_0069327 Ga0395899_0069327_1737_2363 192
530 3300037418 Ga0395900_0735524 Ga0395900_0735524_81_689 192
531 3300038443 Ga0395901_0009227 Ga0395901_0009227_2976_3584 192
532 3300045051 Ga0451576_0000438 Ga0451576_0000438_10878_11471 192
533 3300048915 Ga0496112_0125880 Ga0496112_0125880_740_1348 192
534 3300048916 Ga0496113_0319722 Ga0496113_0319722_81_689 192
535 3300048924 Ga0496121_0121399 Ga0496121_0121399_726_1355 192
536 3300050491 nmdc:mga00v17_4818_c1 nmdc:mga00v17_4818_c1_494_1108 192
537 3300050492 nmdc:mga0yw44_326_c1 nmdc:mga0yw44_326_c1_1685_2299 192
538 3300053080 Ga0500635_0004345 Ga0500635_0004345_2577_3233 192
539 3300053087 Ga0500643_000133 Ga0500643_000133_42184_42786 192
540 3300053092 Ga0500583_0002826 Ga0500583_0002826_2623_3225 192
541 3300053122 Ga0500608_000394 Ga0500608_000394_7606_8262 192
542 3300053147 Ga0500589_023211 Ga0500589_023211_588_1190 192
543 iso_pu_bacteria 2721755693 2723605972 192
544 iso_pu_bacteria 2728369359 2730136636 192
545 iso_pu_bacteria 2791355222 2793182541 192
546 iso_pu_bacteria 2802428803 2802439747 192
547 iso_pu_bacteria 2818991459 2819668791 192
548 iso_pu_bacteria 2857453340 2857454107 192
549 iso_pu_bacteria 2889276214 2889276522 192
550 iso_pu_bacteria 2904595352 2904599793 192
551 iso_pu_bacteria 2904755435 2904762374 192
552 iso_pu_bacteria 2915606848 2915608479 192
553 iso_pu_bacteria 2919425241 2919429460 192
554 iso_pu_bacteria 2939702853 2939704902 192
555 iso_pu_bacteria 2971410472 2971415057 192
556 iso_pu_bacteria 2980125574 2980126457 192
557 iso_pu_bacteria 2980182181 2980182866 192
558 iso_pu_bacteria 2996706504 2996710639 192
559 iso_pu_bacteria 648028048 648171983 192
560 3300005336 Ga0070680_100013463 Ga0070680_1000134634 193
561 3300005458 Ga0070681_10154037 Ga0070681_101540374 193
562 3300005530 Ga0070679_100000389 Ga0070679_10000038917 193
563 3300005937 Ga0081455_10000003 Ga0081455_10000003197 193
564 3300006042 Ga0075368_10000001 Ga0075368_1000000155 193
565 3300006048 Ga0075363_100000036 Ga0075363_1000000367 193
566 3300006178 Ga0075367_10000005 Ga0075367_1000000542 193
567 3300006353 Ga0075370_10001399 Ga0075370_100013994 193
568 3300009011 Ga0105251_10013641 Ga0105251_100136413 193
569 3300009036 Ga0105244_10004173 Ga0105244_100041735 193
570 3300009174 Ga0105241_10000225 Ga0105241_1000022535 193
571 3300013100 Ga0157373_10080406 Ga0157373_100804063 193
572 3300013102 Ga0157371_10003618 Ga0157371_100036182 193
573 3300013105 Ga0157369_10000768 Ga0157369_1000076810 193
574 3300013296 Ga0157374_10004912 Ga0157374_100049128 193
575 3300013307 Ga0157372_10270537 Ga0157372_102705373 193
576 3300014325 Ga0163163_10050262 Ga0163163_100502624 193
577 3300014745 Ga0157377_10013285 Ga0157377_100132855 193
578 3300025735 Ga0207713_1089170 Ga0207713_10891702 193
579 3300025912 Ga0207707_10139990 Ga0207707_101399902 193
580 3300025921 Ga0207652_10001771 Ga0207652_1000177113 193
581 3300027312 Ga0209371_1012661 Ga0209371_10126613 193
582 3300027866 Ga0209813_10000006 Ga0209813_1000000646 193
583 3300030500 Ga0268256_1020027 Ga0268256_10200273 193
584 3300037471 Ga0395905_0590731 Ga0395905_0590731_247_846 193
585 3300049571 Ga0501034_0019372 Ga0501034_0019372_774_1376 193
586 3300049571 Ga0501034_0588546 Ga0501034_0588546_39_680 193
587 3300049589 Ga0501073_0364544 Ga0501073_0364544_69_656 193
588 3300050490 nmdc:mga03n38_26_c1 nmdc:mga03n38_26_c1_27955_28569 193
589 3300050491 nmdc:mga00v17_15069_c1 nmdc:mga00v17_15069_c1_2542_3141 193
590 3300050494 nmdc:mga06z11_1_c1 nmdc:mga06z11_1_c1_117767_118381 193
591 3300050495 nmdc:mga04h51_6_c1 nmdc:mga04h51_6_c1_48578_49192 193
592 3300053087 Ga0500643_001206 Ga0500643_001206_4063_4656 193
593 3300053724 Ga0500570_034109 Ga0500570_034109_708_1301 193
594 iso_pu_bacteria 2510065053 2510284039 193
595 iso_pu_bacteria 2510065055 2510293285 193
596 iso_pu_bacteria 2510065058 2510312780 193
597 iso_pu_bacteria 2739367756 2739793774 193
598 iso_pu_bacteria 2773857672 2774130428 193
599 iso_pu_bacteria 2974298342 2974301414 193
600 iso_pu_bacteria 2984499530 2984503892 193
601 iso_pu_bacteria 2984504281 2984507524 193
602 iso_pu_bacteria 8016728285 8016730355 193
603 iso_pu_bacteria 8054795415 8054803812 193
604 2162886012 MBSR1b_contig_719263 MBSR1b_0241.00002460 194
605 3300003316 rootH1_10002936 rootH1_1000293616 194
606 3300005339 Ga0070660_100485950 Ga0070660_1004859501 194
607 3300005530 Ga0070679_100101721 Ga0070679_1001017213 194
608 3300005530 Ga0070679_101310908 Ga0070679_1013109081 194
609 3300006038 Ga0075365_10000001 Ga0075365_10000001183 194
610 3300006038 Ga0075365_10405449 Ga0075365_104054492 194
611 3300006051 Ga0075364_10007101 Ga0075364_100071013 194
612 3300006177 Ga0075362_10067176 Ga0075362_100671763 194
613 3300006195 Ga0075366_10000046 Ga0075366_1000004637 194
614 3300013105 Ga0157369_10086041 Ga0157369_100860415 194
615 3300025919 Ga0207657_10598166 Ga0207657_105981662 194
616 3300025921 Ga0207652_10011316 Ga0207652_100113164 194
617 3300031901 Ga0307406_10001130 Ga0307406_100011302 194
618 3300047320 Ga0495672_0000016 Ga0495672_0000016_191710_192345 194
619 3300048903 Ga0496100_0106065 Ga0496100_0106065_1070_1654 194
620 3300048918 Ga0496115_0000007 Ga0496115_0000007_161602_162186 194
621 3300050489 nmdc:mga03683_4533_c1 nmdc:mga03683_4533_c1_456_1082 194
622 3300050491 nmdc:mga00v17_5598_c1 nmdc:mga00v17_5598_c1_5121_5747 194
623 3300050492 nmdc:mga0yw44_1_c1 nmdc:mga0yw44_1_c1_258374_258958 194
624 3300050493 nmdc:mga0k408_13_c2 nmdc:mga0k408_13_c2_11373_11993 194
625 3300053103 Ga0500555_000006 Ga0500555_000006_57477_58061 194
626 3300053133 Ga0500655_001665 Ga0500655_001665_865_1449 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

21

219

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.9475 11 193
6uxt-assembly1.cif.gz_A crystal structure of unknown function protein yfdx from shigella flexneri 0.9377 62 98
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.9376 11 193
7qhm-assembly1.cif.gz_S cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.9223 15 190
8hcr-assembly1.cif.gz_S cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.9199 15 190
ID Description Score Start End Superfamily
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9551 11 194 1.20.120.80
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9403 11 194 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.936 15 190 1.20.120.80
af_Q8BLK9_233_308_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8949 64 155 1.20.58.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8921 15 190 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A1I1QUB2-F1-model_v4 Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) 0.9784 14 194 GO:0004129
GO:0005886
GO:0009486
GO:0019646
AF-A0A063BGP9-F1-model_v4 Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) 0.9778 13 191 GO:0004129
GO:0005886
GO:0009486
GO:0019646
AF-A0A2R6Y4B0-F1-model_v4 Cytochrome c oxidase polypeptide III 0.9778 12 194 GO:0004129
GO:0005886
GO:0019646
AF-A0A5C7J9A6-F1-model_v4 Cytochrome o ubiquinol oxidase subunit III 0.9777 4 191 GO:0004129
GO:0005886
GO:0019646
AF-A0A2U0Y2M7-F1-model_v4 deleted 0.9777 16 191

Feature Viewer

pLDDT pTM Quality
73.91 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map