F470475

General Info

Members Datasets Scaffolds Average Seq Length
626 381 1252 137

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10990227|Ga0307406_109902272
Length 137
Sequence MGGMDISIHASFLPHDDPEAAIAFYRDVLGFEIRNDVGYDGMRWITVGPKDQATSIVLHPPAADPAVTEDERRVIAEMMAKGTYGGVTLATKDLGGVFERLVAAGADVVQEPTDQPYGIRDCAFRDPAGNMIRINQL

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
81 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
105 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
165 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
178 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
179 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
180 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
181 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
182 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
183 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
184 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
185 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
186 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
187 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
188 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
189 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
190 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
191 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
192 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
195 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
196 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
197 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
198 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
199 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
200 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
201 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
202 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
203 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
204 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
205 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
237 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
238 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
239 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
240 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
241 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
254 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
255 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
256 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
264 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
265 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
266 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
280 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
281 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
282 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
283 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
284 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
285 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
298 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
309 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
310 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
312 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
313 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
314 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
315 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
316 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
317 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
318 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
323 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
324 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
325 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
326 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
327 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
328 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
329 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
330 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
331 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
334 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
335 2506783011 Frankia datiscae Dg1 Isolate Nodule
336 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
337 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
338 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
339 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
340 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
341 2619618881 Frankia sp. ACN1ag Isolate Unclassified
342 2619619003 Frankia sp. CpI1-P Isolate Nodule
343 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
344 2643221548 Streptomyces sp. Root55 Isolate Unclassified
345 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
346 2643221573 Lysobacter sp. Root604 Isolate Unclassified
347 2643221585 Pelomonas sp. Root662 Isolate Unclassified
348 2643221619 Agromyces sp. Root81 Isolate Unclassified
349 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
350 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
351 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
352 2643221656 Pelomonas sp. Root405 Isolate Unclassified
353 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
354 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
355 2643221692 Nocardia sp. Root136 Isolate Unclassified
356 2643221720 Lysobacter sp. Root916 Isolate Unclassified
357 2643221728 Lysobacter sp. Root983 Isolate Unclassified
358 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
359 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
360 2738541337 Pelomonas sp. BT06 Isolate Unclassified
361 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
362 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
363 2773857933 Frankia sp. BMG5.30 Isolate Nodule
364 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
365 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
366 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
367 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
368 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
369 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
370 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
371 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
372 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
373 2922554459 Rhodococcus sp. 66b Isolate Unclassified
374 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
375 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
376 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
377 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
378 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
379 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
380 8054920844 Frankia tisae Agncl-8 Isolate Nodule
381 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.01
Metatranscriptomes 0.48
Isolates 7.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.95
Nodule 0.96
Rhizoplane 6.87
Rhizosphere 71.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10990227 3300031901 Bacteria 721
2 JGI24740J21852_10066317 3300001979 Bacteria 980
3 JGI24738J21930_10000975 3300002075 Bacteria 8198
4 JGI25162J39368_1001162 3300002737 Bacteria 15643
5 JGI25162J39368_1001224 3300002737 Bacteria 14848
6 JGI25157J39369_1001910 3300002741 Bacteria 6313
7 JGI25164J39214_1000305 3300002772 Bacteria 32780
8 JGI25164J39214_1001741 3300002772 Bacteria 4329
9 JGI25165J46597_1001395 3300003214 Bacteria 13230
10 rootH1_10069402 3300003323 Bacteria 1069
11 JGI25407J50210_10017627 3300003373 Bacteria 1854
12 Ga0006562J51391_1028218 3300003578 Bacteria 682
13 Ga0065704_10206930 3300005289 Bacteria 1124
14 Ga0070658_10445086 3300005327 Bacteria 1116
15 Ga0070658_10463664 3300005327 Bacteria 1092
16 Ga0070676_10964486 3300005328 Bacteria 638
17 Ga0070670_100101297 3300005331 Bacteria 2480
18 Ga0068869_101392103 3300005334 Bacteria 621
19 Ga0070666_10002684 3300005335 Bacteria 10733
20 Ga0070682_100075656 3300005337 Bacteria 2166
21 Ga0068868_100010258 3300005338 Bacteria 6774
22 Ga0068868_101575178 3300005338 Bacteria 617
23 Ga0070687_100645466 3300005343 Bacteria 733
24 Ga0070661_100059362 3300005344 Bacteria 2804
25 Ga0070668_101725721 3300005347 Bacteria 575
26 Ga0070675_101259527 3300005354 Bacteria 681
27 Ga0070671_100143997 3300005355 Bacteria 2012
28 Ga0070674_100257169 3300005356 Bacteria 1374
29 Ga0070688_100372308 3300005365 Bacteria 1051
30 Ga0070667_100173522 3300005367 Bacteria 1904
31 Ga0070667_100302425 3300005367 Bacteria 1440
32 Ga0070667_100358177 3300005367 Bacteria 1322
33 Ga0070714_100014026 3300005435 Bacteria 6429
34 Ga0070713_100010075 3300005436 Bacteria 6814
35 Ga0070694_100307267 3300005444 Bacteria 1217
36 Ga0070708_100544765 3300005445 Bacteria 1095
37 Ga0070663_100003372 3300005455 Bacteria 9221
38 Ga0070663_100009229 3300005455 Bacteria 6102
39 Ga0070678_101357087 3300005456 Bacteria 663
40 Ga0070662_100041013 3300005457 Bacteria 3299
41 Ga0070681_10895539 3300005458 Bacteria 806
42 Ga0070685_10006926 3300005466 Bacteria 5786
43 Ga0070706_100002053 3300005467 Bacteria 20636
44 Ga0070707_100302746 3300005468 Bacteria 1553
45 Ga0070698_100509312 3300005471 Bacteria 1142
46 Ga0068853_100064483 3300005539 Bacteria 3177
47 Ga0068853_100067686 3300005539 Bacteria 3103
48 Ga0070665_100001450 3300005548 Bacteria 27780
49 Ga0070665_100107985 3300005548 Bacteria 2785
50 Ga0070665_100235179 3300005548 Bacteria 1833
51 Ga0068855_100000566 3300005563 Bacteria 45400
52 Ga0068855_100071644 3300005563 Bacteria 4029
53 Ga0070664_101066742 3300005564 Bacteria 760
54 Ga0068857_100426132 3300005577 Bacteria 1238
55 Ga0068857_100643291 3300005577 Bacteria 1004
56 Ga0068854_100002265 3300005578 Bacteria 11840
57 Ga0068854_100017076 3300005578 Bacteria 4852
58 Ga0068854_100062575 3300005578 Bacteria 2698
59 Ga0068856_100115940 3300005614 Bacteria 2679
60 Ga0068852_100307026 3300005616 Bacteria 1537
61 Ga0068852_101028373 3300005616 Bacteria 843
62 Ga0068870_10170373 3300005840 Bacteria 1299
63 Ga0068863_100115687 3300005841 Bacteria 2555
64 Ga0068863_100514407 3300005841 Bacteria 1180
65 Ga0068858_100007154 3300005842 Bacteria 10829
66 Ga0068860_100756421 3300005843 Bacteria 984
67 Ga0068860_101357513 3300005843 Bacteria 732
68 Ga0068862_101291164 3300005844 Bacteria 731
69 Ga0081538_10006617 3300005981 Bacteria 10162
70 Ga0081538_10025735 3300005981 Bacteria 4139
71 Ga0081539_10000983 3300005985 Bacteria 53107
72 Ga0081539_10097486 3300005985 Bacteria 1506
73 Ga0081539_10154899 3300005985 Bacteria 1099
74 Ga0070717_10496641 3300006028 Bacteria 1102
75 Ga0075368_10023747 3300006042 Bacteria 2345
76 Ga0075368_10036884 3300006042 Bacteria 1911
77 Ga0075363_100037649 3300006048 Bacteria 2541
78 Ga0075363_100041705 3300006048 Bacteria 2421
79 Ga0075363_100144504 3300006048 Bacteria 1341
80 Ga0075364_10058425 3300006051 Bacteria 2528
81 Ga0075362_10443749 3300006177 Bacteria 658
82 Ga0075367_10007041 3300006178 Bacteria 5729
83 Ga0075369_10110432 3300006186 Bacteria 1239
84 Ga0075366_10030379 3300006195 Bacteria 3176
85 Ga0075366_10056813 3300006195 Bacteria 2325
86 Ga0075366_10151737 3300006195 Bacteria 1403
87 Ga0075366_10993536 3300006195 Bacteria 523
88 Ga0097621_101327422 3300006237 Bacteria 680
89 Ga0075370_10007001 3300006353 Bacteria 5718
90 Ga0075370_10018136 3300006353 Bacteria 3813
91 Ga0075370_10126624 3300006353 Bacteria 1489
92 Ga0075370_10143350 3300006353 Bacteria 1397
93 Ga0068871_100134995 3300006358 Bacteria 2095
94 Ga0075428_100157661 3300006844 Bacteria 2465
95 Ga0075428_101491688 3300006844 Bacteria 708
96 Ga0075430_100023763 3300006846 Bacteria 5219
97 Ga0068865_100169562 3300006881 Bacteria 1672
98 Ga0105251_10037865 3300009011 Bacteria 2364
99 Ga0105244_10118424 3300009036 Bacteria 1283
100 Ga0105240_10001066 3300009093 Bacteria 48453
101 Ga0105240_10004727 3300009093 Bacteria 20549
102 Ga0105240_10103594 3300009093 Bacteria 3457
103 Ga0105240_11051844 3300009093 Bacteria 868
104 Ga0105245_10932144 3300009098 Bacteria 911
105 Ga0114129_10513259 3300009147 Bacteria 1564
106 Ga0105243_10312156 3300009148 Bacteria 1429
107 Ga0105243_10577346 3300009148 Bacteria 1079
108 Ga0105243_10616530 3300009148 Bacteria 1047
109 Ga0105241_10000791 3300009174 Bacteria 24038
110 Ga0105241_10041011 3300009174 Bacteria 3496
111 Ga0105241_10134992 3300009174 Bacteria 2002
112 Ga0105241_11119772 3300009174 Bacteria 742
113 Ga0105237_10008676 3300009545 Bacteria 10980
114 Ga0105237_10016168 3300009545 Bacteria 7761
115 Ga0105237_10055095 3300009545 Bacteria 3983
116 Ga0105237_10083747 3300009545 Bacteria 3180
117 Ga0105237_10424534 3300009545 Bacteria 1335
118 Ga0105238_10009688 3300009551 Bacteria 9644
119 Ga0105238_10010854 3300009551 Bacteria 9155
120 Ga0105238_10016769 3300009551 Bacteria 7426
121 Ga0105238_10026037 3300009551 Bacteria 5962
122 Ga0105238_10731729 3300009551 Bacteria 1002
123 Ga0105238_11175853 3300009551 Bacteria 791
124 Ga0105238_11394892 3300009551 Bacteria 728
125 Ga0105249_10008046 3300009553 Bacteria 9192
126 Ga0105239_10003150 3300010375 Bacteria 20453
127 Ga0105239_10012322 3300010375 Bacteria 9522
128 Ga0105239_10056387 3300010375 Bacteria 4310
129 Ga0105239_10164435 3300010375 Bacteria 2481
130 Ga0105239_10920613 3300010375 Bacteria 1004
131 Ga0105239_11189895 3300010375 Bacteria 878
132 Ga0105246_10197602 3300011119 Bacteria 1561
133 Ga0157323_1011943 3300012495 Bacteria 708
134 Ga0157338_1030307 3300012515 Bacteria 686
135 Ga0157370_10000833 3300013104 Bacteria 39079
136 Ga0157370_10019830 3300013104 Bacteria 6729
137 Ga0157370_10085745 3300013104 Bacteria 2959
138 Ga0157370_11066677 3300013104 Bacteria 730
139 Ga0157369_10599963 3300013105 Bacteria 1137
140 Ga0157374_10026845 3300013296 Bacteria 5185
141 Ga0157374_10072227 3300013296 Bacteria 3255
142 Ga0163162_10000003 3300013306 Bacteria 698280
143 Ga0163162_10087959 3300013306 Bacteria 3186
144 Ga0163162_10367361 3300013306 Bacteria 1572
145 Ga0163162_10749040 3300013306 Bacteria 1096
146 Ga0157372_10135082 3300013307 Bacteria 2840
147 Ga0157372_10204314 3300013307 Bacteria 2289
148 Ga0157372_10404343 3300013307 Bacteria 1591
149 Ga0157372_13475668 3300013307 Bacteria 501
150 Ga0157375_11839513 3300013308 Bacteria 718
151 Ga0157380_11419876 3300014326 Bacteria 745
152 Ga0157380_12204079 3300014326 Bacteria 615
153 Ga0182008_10002793 3300014497 Bacteria 10808
154 Ga0157377_10244347 3300014745 Bacteria 1160
155 Ga0157379_10010905 3300014968 Bacteria 7922
156 Ga0157379_10269906 3300014968 Bacteria 1547
157 Ga0157376_10186051 3300014969 Bacteria 1902
158 Ga0157376_11213507 3300014969 Bacteria 783
159 Ga0182006_1002930 3300015261 Bacteria 9043
160 Ga0182007_10019620 3300015262 Bacteria 2428
161 Ga0182005_1001545 3300015265 Bacteria 9124
162 Ga0163161_10692683 3300017792 Bacteria 848
163 Ga0154015_1554328 3300020610 Bacteria 717
164 Ga0213873_10000221 3300021358 Bacteria 10047
165 Ga0213875_10000630 3300021388 Bacteria 28113
166 Ga0213875_10015402 3300021388 Bacteria 3721
167 Ga0224712_10161411 3300022467 Bacteria 1000
168 Ga0209674_102061 3300025226 Bacteria 4603
169 Ga0207427_100117 3300025231 Bacteria 102251
170 Ga0207427_100178 3300025231 Bacteria 67956
171 Ga0209437_100240 3300025233 Bacteria 89740
172 Ga0209437_100304 3300025233 Bacteria 67955
173 Ga0209026_1000093 3300025250 Bacteria 170393
174 Ga0209026_1012870 3300025250 Bacteria 1443
175 Ga0209759_1026829 3300025256 Bacteria 1200
176 Ga0209233_1000083 3300025261 Bacteria 336016
177 Ga0209233_1000287 3300025261 Bacteria 67956
178 Ga0209233_1000593 3300025261 Bacteria 18942
179 Ga0209233_1000927 3300025261 Bacteria 12799
180 Ga0207680_10005720 3300025903 Bacteria 5957
181 Ga0207647_10000157 3300025904 Bacteria 53737
182 Ga0207647_10002987 3300025904 Bacteria 12727
183 Ga0207643_10395160 3300025908 Bacteria 873
184 Ga0207705_10261362 3300025909 Bacteria 1322
185 Ga0207684_10002473 3300025910 Bacteria 18611
186 Ga0207654_10005697 3300025911 Bacteria 6292
187 Ga0207654_10573475 3300025911 Bacteria 803
188 Ga0207695_10000007 3300025913 Bacteria 1092551
189 Ga0207695_10003485 3300025913 Bacteria 22125
190 Ga0207695_10005721 3300025913 Bacteria 16382
191 Ga0207695_10014657 3300025913 Bacteria 9272
192 Ga0207695_10633803 3300025913 Bacteria 950
193 Ga0207671_10000539 3300025914 Bacteria 51153
194 Ga0207671_10016903 3300025914 Bacteria 5649
195 Ga0207671_10050714 3300025914 Bacteria 3073
196 Ga0207671_10102396 3300025914 Bacteria 2170
197 Ga0207671_10111170 3300025914 Bacteria 2084
198 Ga0207671_10326839 3300025914 Bacteria 1214
199 Ga0207671_10820859 3300025914 Bacteria 737
200 Ga0207693_10109375 3300025915 Bacteria 2168
201 Ga0207649_10193389 3300025920 Bacteria 1432
202 Ga0207681_11509660 3300025923 Bacteria 563
203 Ga0207694_10002272 3300025924 Bacteria 15720
204 Ga0207694_10002780 3300025924 Bacteria 14128
205 Ga0207694_10029016 3300025924 Bacteria 4219
206 Ga0207694_10150568 3300025924 Bacteria 1874
207 Ga0207694_10432454 3300025924 Bacteria 1097
208 Ga0207650_10076566 3300025925 Bacteria 2528
209 Ga0207659_10484440 3300025926 Bacteria 1045
210 Ga0207700_10001482 3300025928 Bacteria 13282
211 Ga0207700_10170994 3300025928 Bacteria 1813
212 Ga0207644_10137170 3300025931 Bacteria 1880
213 Ga0207706_10002669 3300025933 Bacteria 17376
214 Ga0207706_10183932 3300025933 Bacteria 1835
215 Ga0207709_10149022 3300025935 Bacteria 1618
216 Ga0207709_10524758 3300025935 Bacteria 927
217 Ga0207709_10857648 3300025935 Bacteria 736
218 Ga0207704_10411833 3300025938 Bacteria 1069
219 Ga0207691_10160492 3300025940 Bacteria 1972
220 Ga0207711_10064085 3300025941 Bacteria 3173
221 Ga0207661_10679342 3300025944 Bacteria 947
222 Ga0207667_10020549 3300025949 Bacteria 7339
223 Ga0207667_10186422 3300025949 Bacteria 2130
224 Ga0207667_11716818 3300025949 Bacteria 594
225 Ga0207712_10000197 3300025961 Bacteria 61066
226 Ga0207640_10029107 3300025981 Bacteria 3385
227 Ga0207640_10056573 3300025981 Bacteria 2576
228 Ga0207640_10066221 3300025981 Bacteria 2413
229 Ga0207640_10113070 3300025981 Bacteria 1929
230 Ga0207658_10016910 3300025986 Bacteria 5020
231 Ga0207658_10132107 3300025986 Bacteria 2007
232 Ga0207677_10052058 3300026023 Bacteria 2779
233 Ga0207677_10854520 3300026023 Bacteria 818
234 Ga0207703_10000010 3300026035 Bacteria 343466
235 Ga0207703_10022066 3300026035 Bacteria 4989
236 Ga0207703_10515849 3300026035 Bacteria 1124
237 Ga0207703_11765355 3300026035 Bacteria 595
238 Ga0207703_12127770 3300026035 Bacteria 537
239 Ga0207639_10000446 3300026041 Bacteria 28443
240 Ga0207639_10067673 3300026041 Bacteria 2780
241 Ga0207678_10004726 3300026067 Bacteria 12229
242 Ga0207678_10041380 3300026067 Bacteria 3996
243 Ga0207678_10068243 3300026067 Bacteria 3051
244 Ga0207702_10093721 3300026078 Bacteria 2634
245 Ga0207702_10363466 3300026078 Bacteria 1388
246 Ga0207641_10146810 3300026088 Bacteria 2133
247 Ga0207648_11529848 3300026089 Bacteria 627
248 Ga0207676_10050040 3300026095 Bacteria 3255
249 Ga0207674_10038945 3300026116 Bacteria 4930
250 Ga0207675_100030918 3300026118 Bacteria 4987
251 Ga0207675_100041906 3300026118 Bacteria 4275
252 Ga0207683_10581749 3300026121 Bacteria 1036
253 Ga0207683_11389938 3300026121 Bacteria 649
254 Ga0207698_10144001 3300026142 Bacteria 2058
255 Ga0207698_10256648 3300026142 Bacteria 1603
256 Ga0209813_10104337 3300027866 Bacteria 969
257 Ga0268266_10000006 3300028379 Bacteria 1410021
258 Ga0268266_10128370 3300028379 Bacteria 2265
259 Ga0268266_10312060 3300028379 Bacteria 1470
260 Ga0268264_10151890 3300028381 Bacteria 2077
261 Ga0307517_10390391 3300028786 Bacteria 740
262 Ga0307517_10486760 3300028786 Bacteria 631
263 Ga0307517_10595026 3300028786 Bacteria 545
264 Ga0307515_10052565 3300028794 Bacteria 6038
265 Ga0307513_10001290 3300031456 Bacteria 36243
266 Ga0307513_10445839 3300031456 Bacteria 1020
267 Ga0307408_100004915 3300031548 Bacteria 8998
268 Ga0307408_100188304 3300031548 Bacteria 1660
269 Ga0307408_100666964 3300031548 Bacteria 931
270 Ga0307508_10003645 3300031616 Bacteria 15439
271 Ga0307508_10269432 3300031616 Bacteria 1297
272 Ga0307508_10303174 3300031616 Bacteria 1190
273 Ga0307508_10518269 3300031616 Bacteria 788
274 Ga0307516_10021873 3300031730 Bacteria 6570
275 Ga0307516_10252851 3300031730 Bacteria 1456
276 Ga0307405_10005819 3300031731 Bacteria 6000
277 Ga0307405_10197818 3300031731 Bacteria 1457
278 Ga0307405_10210377 3300031731 Bacteria 1419
279 Ga0307413_10032463 3300031824 Bacteria 2960
280 Ga0307413_10232882 3300031824 Bacteria 1354
281 Ga0307413_10739047 3300031824 Bacteria 821
282 Ga0307413_11368669 3300031824 Bacteria 621
283 Ga0307410_10006021 3300031852 Bacteria 6501
284 Ga0307410_10433870 3300031852 Bacteria 1068
285 Ga0307406_10001367 3300031901 Bacteria 13632
286 Ga0307406_10289154 3300031901 Bacteria 1254
287 Ga0307406_10304155 3300031901 Bacteria 1226
288 Ga0307406_10335019 3300031901 Bacteria 1176
289 Ga0307406_11360738 3300031901 Bacteria 621
290 Ga0307407_10054803 3300031903 Bacteria 2301
291 Ga0307407_10198335 3300031903 Bacteria 1343
292 Ga0307407_10356192 3300031903 Bacteria 1038
293 Ga0307407_10564312 3300031903 Bacteria 843
294 Ga0307407_10676443 3300031903 Bacteria 775
295 Ga0307412_10028783 3300031911 Bacteria 3481
296 Ga0307412_10049513 3300031911 Bacteria 2769
297 Ga0307409_100000553 3300031995 Bacteria 16258
298 Ga0307409_100203693 3300031995 Bacteria 1772
299 Ga0307409_100294489 3300031995 Bacteria 1506
300 Ga0307409_100347622 3300031995 Bacteria 1398
301 Ga0307409_100414818 3300031995 Bacteria 1290
302 Ga0307409_100735637 3300031995 Bacteria 989
303 Ga0307409_101138411 3300031995 Bacteria 802
304 Ga0307416_100000862 3300032002 Bacteria 15945
305 Ga0307416_100211401 3300032002 Bacteria 1851
306 Ga0307416_100972084 3300032002 Bacteria 951
307 Ga0307414_10172837 3300032004 Bacteria 1729
308 Ga0307414_10347883 3300032004 Bacteria 1271
309 Ga0307411_10187684 3300032005 Bacteria 1575
310 Ga0307411_10931974 3300032005 Bacteria 773
311 Ga0307415_100045163 3300032126 Bacteria 2951
312 Ga0307415_100160692 3300032126 Bacteria 1741
313 Ga0307415_100181590 3300032126 Bacteria 1651
314 Ga0307415_100253546 3300032126 Bacteria 1431
315 Ga0307415_100394651 3300032126 Bacteria 1179
316 Ga0307415_100877690 3300032126 Bacteria 825
317 Ga0307507_10061838 3300033179 Bacteria 3483
318 Ga0307507_10173948 3300033179 Bacteria 1557
319 Ga0307507_10200640 3300033179 Bacteria 1381
320 Ga0373930_0111294 3300034816 Bacteria 659
321 Ga0373943_0027191 3300035170 Bacteria 2686
322 Ga0373943_0102474 3300035170 Bacteria 1499
323 Ga0373946_0254277 3300035171 Bacteria 858
324 Ga0373933_0708450 3300035724 Bacteria 662
325 Ga0373947_0625461 3300035725 Bacteria 734
326 Ga0373925_0090195 3300037068 Bacteria 2343
327 Ga0395899_0012559 3300037312 Bacteria 6493
328 Ga0395899_0028053 3300037312 Bacteria 4240
329 Ga0395899_0347707 3300037312 Bacteria 992
330 Ga0395900_0046692 3300037418 Bacteria 4460
331 Ga0395900_0201335 3300037418 Bacteria 2014
332 Ga0395898_0009792 3300037466 Bacteria 10045
333 Ga0395898_0502933 3300037466 Bacteria 1153
334 Ga0395905_0004423 3300037471 Bacteria 14604
335 Ga0395905_0009193 3300037471 Bacteria 9676
336 Ga0395905_1766309 3300037471 Bacteria 524
337 Ga0436364_0687857 3300037853 Bacteria 39085
338 Ga0436364_0996370 3300037853 Bacteria 69660
339 Ga0395901_0112114 3300038443 Bacteria 2864
340 Ga0395901_0199266 3300038443 Bacteria 2099
341 Ga0436362_1210029 3300039453 Bacteria 10312
342 Ga0439436_0000007 3300041404 Bacteria 120812
343 Ga0439436_0055192 3300041404 Bacteria 1117
344 Ga0439466_0208035 3300041411 Bacteria 595
345 Ga0439465_0119126 3300041413 Bacteria 924
346 Ga0451791_0374504 3300041451 Bacteria 1008
347 Ga0451793_0238004 3300041452 Bacteria 845
348 Ga0451793_0619921 3300041452 Bacteria 3070
349 Ga0451793_0752732 3300041452 Bacteria 517
350 Ga0451797_0655850 3300041453 Bacteria 515
351 Ga0451795_0433110 3300041456 Bacteria 632
352 Ga0451802_0088647 3300041460 Bacteria 517
353 Ga0451804_0062659 3300041463 Bacteria 541
354 Ga0451807_0915670 3300041486 Bacteria 840
355 Ga0451837_0147881 3300041494 Bacteria 2166
356 Ga0451837_0232832 3300041494 Bacteria 598
357 Ga0451839_0137982 3300041496 Bacteria 1163
358 Ga0451841_0070831 3300041498 Bacteria 614
359 Ga0451841_0175618 3300041498 Bacteria 2310
360 Ga0451849_0945722 3300041505 Bacteria 1178
361 Ga0451843_1347523 3300041509 Bacteria 1266
362 Ga0451853_0091234 3300041512 Bacteria 1722
363 Ga0451853_0684873 3300041512 Bacteria 706
364 Ga0451853_1250947 3300041512 Bacteria 3955
365 Ga0451853_2089754 3300041512 Bacteria 854
366 Ga0439448_0019790 3300042005 Bacteria 2077
367 Ga0439449_0376422 3300042007 Bacteria 538
368 Ga0439450_067353 3300042008 Bacteria 874
369 Ga0439454_018649 3300042011 Bacteria 1002
370 Ga0439463_013862 3300042016 Bacteria 1985
371 Ga0450923_070421 3300042125 Bacteria 775
372 Ga0450897_014235 3300042128 Bacteria 802
373 Ga0450894_017380 3300042131 Bacteria 958
374 Ga0450902_040147 3300042137 Bacteria 796
375 Ga0439464_0016990 3300042439 Bacteria 1970
376 Ga0450918_050040 3300042531 Bacteria 760
377 Ga0439440_0018978 3300042993 Bacteria 1529
378 Ga0466966_0182895 3300044684 Bacteria 1272
379 Ga0466961_0293325 3300044693 Bacteria 994
380 Ga0466971_0360007 3300044719 Bacteria 705
381 Ga0466970_0244040 3300044765 Bacteria 1005
382 Ga0466970_0502590 3300044765 Bacteria 698
383 Ga0466960_0413781 3300044901 Bacteria 778
384 Ga0466959_0232023 3300045049 Bacteria 1277
385 Ga0466958_0186692 3300045836 Bacteria 1317
386 Ga0466967_0071402 3300045976 Bacteria 3109
387 Ga0466967_0146452 3300045976 Bacteria 2203
388 Ga0466967_0253105 3300045976 Bacteria 1683
389 Ga0466967_0533618 3300045976 Bacteria 1154
390 Ga0495603_0084977 3300046455 Bacteria 1853
391 Ga0495629_0271203 3300046459 Bacteria 1165
392 Ga0495638_0024391 3300046460 Bacteria 3944
393 Ga0495638_0098199 3300046460 Bacteria 1755
394 Ga0495641_0136702 3300046461 Bacteria 1094
395 Ga0495651_0000668 3300046462 Bacteria 26648
396 Ga0495650_0063909 3300046471 Bacteria 1466
397 Ga0495580_0498819 3300046472 Bacteria 813
398 Ga0495582_0704641 3300046473 Bacteria 584
399 Ga0495639_0668705 3300046475 Bacteria 536
400 Ga0495662_0170374 3300046476 Bacteria 1073
401 Ga0495584_0211781 3300046491 Bacteria 985
402 Ga0495585_0229047 3300046492 Bacteria 935
403 Ga0495596_0089149 3300046500 Bacteria 1197
404 Ga0495608_0177987 3300046511 Bacteria 1346
405 Ga0495610_0000927 3300046512 Bacteria 27234
406 Ga0495628_0033900 3300046516 Bacteria 4110
407 Ga0495628_1111012 3300046516 Bacteria 540
408 Ga0495630_1111355 3300046517 Bacteria 599
409 Ga0495637_0210135 3300046520 Bacteria 712
410 Ga0495643_0005595 3300046522 Bacteria 8453
411 Ga0495648_0036590 3300046524 Bacteria 3164
412 Ga0495652_0007945 3300046529 Bacteria 9740
413 Ga0495652_0989390 3300046529 Bacteria 551
414 Ga0495665_0082163 3300046531 Bacteria 1694
415 Ga0495665_0315848 3300046531 Bacteria 798
416 Ga0495586_0670317 3300046535 Bacteria 599
417 Ga0495587_0145851 3300046536 Bacteria 1350
418 Ga0495598_0050381 3300046537 Bacteria 1251
419 Ga0495609_0112591 3300046538 Bacteria 1174
420 Ga0495609_0207304 3300046538 Bacteria 818
421 Ga0495621_0085020 3300046539 Bacteria 1185
422 Ga0495597_0015036 3300046542 Bacteria 3671
423 Ga0495622_0251510 3300046557 Bacteria 777
424 Ga0495656_0011583 3300046615 Bacteria 3239
425 Ga0495656_0103452 3300046615 Bacteria 1320
426 Ga0495668_0017761 3300046616 Bacteria 4121
427 Ga0495611_0414687 3300046648 Bacteria 615
428 Ga0495625_0146199 3300046660 Bacteria 1591
429 Ga0495635_0210274 3300046663 Bacteria 1318
430 Ga0495588_0058125 3300046674 Bacteria 1999
431 Ga0495657_0903049 3300046675 Bacteria 502
432 Ga0495646_0211283 3300046680 Bacteria 1053
433 Ga0495658_0255647 3300046683 Bacteria 1102
434 Ga0495670_0001902 3300046691 Bacteria 10295
435 Ga0495649_0012790 3300046694 Bacteria 4866
436 Ga0495589_0319480 3300046794 Bacteria 718
437 Ga0495600_0013069 3300046809 Bacteria 5209
438 Ga0495600_0085957 3300046809 Bacteria 2052
439 Ga0495600_0111445 3300046809 Bacteria 1782
440 Ga0495660_0081415 3300046810 Bacteria 1697
441 Ga0495581_0056902 3300047315 Bacteria 2257
442 Ga0495581_0384936 3300047315 Bacteria 818
443 Ga0495581_0591213 3300047315 Bacteria 643
444 Ga0495604_0043259 3300047317 Bacteria 3527
445 Ga0495636_0246711 3300047318 Bacteria 825
446 Ga0495674_0213572 3300047319 Bacteria 1597
447 Ga0495676_0490917 3300047321 Bacteria 807
448 Ga0495676_0863322 3300047321 Bacteria 581
449 Ga0495680_1019075 3300047322 Bacteria 528
450 Ga0495687_002640 3300047443 Bacteria 14021
451 Ga0495677_0256118 3300047445 Bacteria 685
452 Ga0495593_0489016 3300047673 Bacteria 617
453 Ga0495614_0315252 3300048089 Bacteria 725
454 Ga0496101_0196558 3300048904 Bacteria 1558
455 Ga0496102_0000512 3300048905 Bacteria 42324
456 Ga0496102_0054734 3300048905 Bacteria 3639
457 Ga0496102_0303387 3300048905 Bacteria 1505
458 Ga0496102_0853923 3300048905 Bacteria 832
459 Ga0496102_0951643 3300048905 Bacteria 780
460 Ga0496103_0004590 3300048906 Bacteria 8361
461 Ga0496104_0002424 3300048907 Bacteria 16066
462 Ga0496104_0064068 3300048907 Bacteria 3487
463 Ga0496104_1505117 3300048907 Bacteria 576
464 Ga0496105_0031981 3300048908 Bacteria 4315
465 Ga0496105_0261567 3300048908 Bacteria 1399
466 Ga0496108_0009511 3300048911 Bacteria 7873
467 Ga0496108_0011671 3300048911 Bacteria 7150
468 Ga0496108_0015740 3300048911 Bacteria 6167
469 Ga0496108_0163285 3300048911 Bacteria 1926
470 Ga0496109_0004867 3300048912 Bacteria 11210
471 Ga0496109_0231891 3300048912 Bacteria 1737
472 Ga0496109_0529475 3300048912 Bacteria 1112
473 Ga0496110_0009977 3300048913 Bacteria 7703
474 Ga0496110_0050091 3300048913 Bacteria 3667
475 Ga0496111_0000232 3300048914 Bacteria 26683
476 Ga0496111_0209793 3300048914 Bacteria 1447
477 Ga0496112_0138084 3300048915 Bacteria 2407
478 Ga0496112_1645487 3300048915 Bacteria 555
479 Ga0496113_0147544 3300048916 Bacteria 1854
480 Ga0496113_0389599 3300048916 Bacteria 1118
481 Ga0496114_0031010 3300048917 Bacteria 4398
482 Ga0496114_0119061 3300048917 Bacteria 2269
483 Ga0496114_0195116 3300048917 Bacteria 1772
484 Ga0496114_0241492 3300048917 Bacteria 1588
485 Ga0496114_0728448 3300048917 Bacteria 868
486 Ga0496114_0751610 3300048917 Bacteria 852
487 Ga0496114_1258982 3300048917 Bacteria 626
488 Ga0496117_0310060 3300048920 Bacteria 831
489 Ga0496118_0006535 3300048921 Bacteria 12755
490 Ga0496118_0110402 3300048921 Bacteria 1827
491 Ga0496119_0053645 3300048922 Bacteria 2461
492 Ga0496125_0020685 3300048928 Bacteria 6170
493 Ga0495682_0340668 3300049460 Bacteria 528
494 Ga0501292_081185 3300049515 Bacteria 617
495 Ga0501298_154573 3300049521 Bacteria 563
496 Ga0501032_0180009 3300049569 Bacteria 1384
497 Ga0501033_0473134 3300049570 Bacteria 869
498 Ga0501034_0134416 3300049571 Bacteria 2455
499 Ga0501034_0826249 3300049571 Bacteria 818
500 Ga0501038_0188966 3300049574 Bacteria 1658
501 Ga0501038_1035920 3300049574 Bacteria 601
502 Ga0501039_0086148 3300049575 Bacteria 2447
503 Ga0501039_0206497 3300049575 Bacteria 1544
504 Ga0501040_0191362 3300049576 Bacteria 1452
505 Ga0501041_0320562 3300049577 Bacteria 978
506 Ga0501042_0132025 3300049578 Bacteria 1800
507 Ga0501043_0025323 3300049579 Bacteria 4654
508 Ga0501047_0022258 3300049581 Bacteria 6088
509 Ga0501047_0073191 3300049581 Bacteria 3299
510 Ga0501048_0049934 3300049582 Bacteria 2980
511 Ga0501048_0217574 3300049582 Bacteria 1354
512 Ga0501067_0120357 3300049583 Bacteria 1460
513 Ga0501068_0359921 3300049584 Bacteria 936
514 Ga0501068_0540260 3300049584 Bacteria 757
515 Ga0501070_0014516 3300049586 Bacteria 6627
516 Ga0501070_0021507 3300049586 Bacteria 5412
517 Ga0501070_0326663 3300049586 Bacteria 1247
518 Ga0501071_0086730 3300049587 Bacteria 2296
519 Ga0501071_0347553 3300049587 Bacteria 1128
520 Ga0501071_0731145 3300049587 Bacteria 762
521 Ga0501072_0022694 3300049588 Bacteria 4869
522 Ga0501072_0660405 3300049588 Bacteria 823
523 Ga0501073_0001354 3300049589 Bacteria 18080
524 Ga0501074_0012051 3300049590 Bacteria 6281
525 Ga0501074_0023298 3300049590 Bacteria 4502
526 Ga0501074_0110032 3300049590 Bacteria 1971
527 Ga0501074_0207313 3300049590 Bacteria 1397
528 Ga0501075_0027315 3300049591 Bacteria 4206
529 Ga0501075_0222178 3300049591 Bacteria 1441
530 Ga0501076_0116751 3300049592 Bacteria 2160
531 Ga0501079_0095749 3300049741 Bacteria 2301
532 Ga0501079_0243534 3300049741 Bacteria 1405
533 Ga0501079_0947408 3300049741 Bacteria 678
534 Ga0501080_0018376 3300049742 Bacteria 6471
535 Ga0501080_0057132 3300049742 Bacteria 3633
536 Ga0501081_0210522 3300049743 Bacteria 1412
537 Ga0501279_071497 3300049775 Bacteria 585
538 Ga0501035_0005982 3300049822 Bacteria 11457
539 Ga0501035_0018649 3300049822 Bacteria 6390
540 Ga0501035_0077441 3300049822 Bacteria 2938
541 Ga0501035_0273299 3300049822 Bacteria 1430
542 Ga0501044_0039950 3300049823 Bacteria 4892
543 Ga0501044_0054028 3300049823 Bacteria 4130
544 Ga0501044_0165448 3300049823 Bacteria 2186
545 nmdc:mga03683_4898_c1 3300050489 Bacteria 4474
546 nmdc:mga03n38_375228_c1 3300050490 Bacteria 778
547 nmdc:mga03n38_78470_c1 3300050490 Bacteria 1546
548 nmdc:mga0yw44_971576_c1 3300050492 Bacteria 575
549 nmdc:mga0k408_57203_c1 3300050493 Bacteria 2264
550 nmdc:mga0k408_68686_c1 3300050493 Bacteria 1496
551 nmdc:mga06z11_169479_c1 3300050494 Bacteria 1253
552 nmdc:mga06z11_600932_c1 3300050494 Bacteria 669
553 nmdc:mga04h51_64417_c1 3300050495 Bacteria 1264
554 nmdc:mga07m45_241639_c1 3300050496 Bacteria 1051
555 nmdc:mga07m45_26048_c1 3300050496 Bacteria 3212
556 nmdc:mga07m45_275898_c1 3300050496 Bacteria 978
557 nmdc:mga07m45_331124_c1 3300050496 Bacteria 885
558 nmdc:mga07m45_37523_c2 3300050496 Bacteria 2362
559 nmdc:mga07m45_37909_c1 3300050496 Bacteria 2689
560 nmdc:mga05p37_1469026_c1 3300050507 Bacteria 681
561 nmdc:mga0qj67_3250_c1 3300050509 Bacteria 11704
562 nmdc:mga08y16_945453_c1 3300050511 Bacteria 845
563 nmdc:mga0sz30_71096_c1 3300050516 Bacteria 1498
564 Ga0495655_0107077 3300053083 Bacteria 835
565 Ga0495595_0260567 3300053084 Bacteria 869
566 Ga0495619_0460901 3300053085 Bacteria 876
567 Ga0500643_000082 3300053087 Bacteria 101189
568 Ga0500651_0132317 3300053093 Bacteria 1508
569 Ga0500556_0000001 3300053104 Bacteria 1135060
570 Ga0500568_0000016 3300053139 Bacteria 217194
571 Ga0500568_0008001 3300053139 Bacteria 5134
572 Ga0500616_0040500 3300053153 Bacteria 2505
573 Ga0500645_000044 3300053730 Bacteria 109705
574 Ga0500645_002917 3300053730 Bacteria 7291
575 Ga0501084_0364449 3300054114 Bacteria 1221
576 Ga0501084_0827070 3300054114 Bacteria 780
577 Ga0590075_134252 3300059424 Bacteria 650
578 Ga0501082_0284689 3300060353 Bacteria 1439
579 Ga0501082_1170666 3300060353 Bacteria 672
580 2506867298 2506783011 Bacteria 5323186
581 2515495840 2515154088 Bacteria 5526283
582 2515755655 2515154137 Bacteria 5711575
583 2516088100 2515154203 Bacteria 5458536
584 2566994365 2565956761 Bacteria 6601618
585 2579855958 2579778521 Bacteria 7624758
586 2619855112 2619618881 Bacteria 7521104
587 2620352024 2619619003 Bacteria 7619552
588 2623589280 2622736626 Bacteria 7181580
589 2643761745 2643221548 Bacteria 8053412
590 2643849913 2643221567 Bacteria 4163945
591 2643878453 2643221573 Bacteria 4784121
592 2643936845 2643221585 Bacteria 5812563
593 2644110943 2643221619 Bacteria 4158469
594 2644135915 2643221624 Bacteria 4384879
595 2644221679 2643221639 Bacteria 6649903
596 2644257556 2643221646 Bacteria 6433402
597 2644318746 2643221656 Bacteria 5809961
598 2644460827 2643221682 Bacteria 6743283
599 2644503888 2643221690 Bacteria 4654705
600 2644516087 2643221692 Bacteria 7282860
601 2644659758 2643221720 Bacteria 4694283
602 2644700498 2643221728 Bacteria 4797149
603 2686537511 2684623035 Bacteria 8032739
604 2738892196 2738541308 Bacteria 7020677
605 2739058542 2738541337 Bacteria 6183410
606 2739365902 2738543034 Bacteria 6084756
607 2772643209 2772190715 Bacteria 6959372
608 2774903471 2773857933 Bacteria 5818019
609 2808884253 2808606368 Bacteria 3174172
610 2842920615 2842918807 Bacteria 4289178
611 2867318517 2867312974 Bacteria 7058875
612 2867320501 2867319477 Bacteria 7069771
613 2895396827 2895395659 Bacteria 3983269
614 2895433198 2895427314 Bacteria 13147766
615 2895890908 2895880812 Bacteria 11255272
616 2904537491 2904535858 Bacteria 6308016
617 2912721616 2912715099 Bacteria 9460473
618 2922558876 2922554459 Bacteria 6683962
619 2996224137 2996221748 Bacteria 6799777
620 8002872302 8002869464 Bacteria 3588529
621 8047714899 8047710418 Bacteria 11023148
622 8048134192 8048127548 Bacteria 11053136
623 8054708334 8054704163 Bacteria 7247792
624 8054914732 8054913762 Bacteria 7713009
625 8054922886 8054920844 Bacteria 7068637
626 8057572122 8057568493 Bacteria 7221719
627 Ga0307406_10990227
628 JGI24740J21852_10066317
629 JGI24738J21930_10000975
630 JGI25162J39368_1001162
631 JGI25162J39368_1001224
632 JGI25157J39369_1001910
633 JGI25164J39214_1000305
634 JGI25164J39214_1001741
635 JGI25165J46597_1001395
636 rootH1_10069402
637 JGI25407J50210_10017627
638 Ga0006562J51391_1028218
639 Ga0065704_10206930
640 Ga0070658_10445086
641 Ga0070658_10463664
642 Ga0070676_10964486
643 Ga0070670_100101297
644 Ga0068869_101392103
645 Ga0070666_10002684
646 Ga0070682_100075656
647 Ga0068868_100010258
648 Ga0068868_101575178
649 Ga0070687_100645466
650 Ga0070661_100059362
651 Ga0070668_101725721
652 Ga0070675_101259527
653 Ga0070671_100143997
654 Ga0070674_100257169
655 Ga0070688_100372308
656 Ga0070667_100173522
657 Ga0070667_100302425
658 Ga0070667_100358177
659 Ga0070714_100014026
660 Ga0070713_100010075
661 Ga0070694_100307267
662 Ga0070708_100544765
663 Ga0070663_100003372
664 Ga0070663_100009229
665 Ga0070678_101357087
666 Ga0070662_100041013
667 Ga0070681_10895539
668 Ga0070685_10006926
669 Ga0070706_100002053
670 Ga0070707_100302746
671 Ga0070698_100509312
672 Ga0068853_100064483
673 Ga0068853_100067686
674 Ga0070665_100001450
675 Ga0070665_100107985
676 Ga0070665_100235179
677 Ga0068855_100000566
678 Ga0068855_100071644
679 Ga0070664_101066742
680 Ga0068857_100426132
681 Ga0068857_100643291
682 Ga0068854_100002265
683 Ga0068854_100017076
684 Ga0068854_100062575
685 Ga0068856_100115940
686 Ga0068852_100307026
687 Ga0068852_101028373
688 Ga0068870_10170373
689 Ga0068863_100115687
690 Ga0068863_100514407
691 Ga0068858_100007154
692 Ga0068860_100756421
693 Ga0068860_101357513
694 Ga0068862_101291164
695 Ga0081538_10006617
696 Ga0081538_10025735
697 Ga0081539_10000983
698 Ga0081539_10097486
699 Ga0081539_10154899
700 Ga0070717_10496641
701 Ga0075368_10023747
702 Ga0075368_10036884
703 Ga0075363_100037649
704 Ga0075363_100041705
705 Ga0075363_100144504
706 Ga0075364_10058425
707 Ga0075362_10443749
708 Ga0075367_10007041
709 Ga0075369_10110432
710 Ga0075366_10030379
711 Ga0075366_10056813
712 Ga0075366_10151737
713 Ga0075366_10993536
714 Ga0097621_101327422
715 Ga0075370_10007001
716 Ga0075370_10018136
717 Ga0075370_10126624
718 Ga0075370_10143350
719 Ga0068871_100134995
720 Ga0075428_100157661
721 Ga0075428_101491688
722 Ga0075430_100023763
723 Ga0068865_100169562
724 Ga0105251_10037865
725 Ga0105244_10118424
726 Ga0105240_10001066
727 Ga0105240_10004727
728 Ga0105240_10103594
729 Ga0105240_11051844
730 Ga0105245_10932144
731 Ga0114129_10513259
732 Ga0105243_10312156
733 Ga0105243_10577346
734 Ga0105243_10616530
735 Ga0105241_10000791
736 Ga0105241_10041011
737 Ga0105241_10134992
738 Ga0105241_11119772
739 Ga0105237_10008676
740 Ga0105237_10016168
741 Ga0105237_10055095
742 Ga0105237_10083747
743 Ga0105237_10424534
744 Ga0105238_10009688
745 Ga0105238_10010854
746 Ga0105238_10016769
747 Ga0105238_10026037
748 Ga0105238_10731729
749 Ga0105238_11175853
750 Ga0105238_11394892
751 Ga0105249_10008046
752 Ga0105239_10003150
753 Ga0105239_10012322
754 Ga0105239_10056387
755 Ga0105239_10164435
756 Ga0105239_10920613
757 Ga0105239_11189895
758 Ga0105246_10197602
759 Ga0157323_1011943
760 Ga0157338_1030307
761 Ga0157370_10000833
762 Ga0157370_10019830
763 Ga0157370_10085745
764 Ga0157370_11066677
765 Ga0157369_10599963
766 Ga0157374_10026845
767 Ga0157374_10072227
768 Ga0163162_10000003
769 Ga0163162_10087959
770 Ga0163162_10367361
771 Ga0163162_10749040
772 Ga0157372_10135082
773 Ga0157372_10204314
774 Ga0157372_10404343
775 Ga0157372_13475668
776 Ga0157375_11839513
777 Ga0157380_11419876
778 Ga0157380_12204079
779 Ga0182008_10002793
780 Ga0157377_10244347
781 Ga0157379_10010905
782 Ga0157379_10269906
783 Ga0157376_10186051
784 Ga0157376_11213507
785 Ga0182006_1002930
786 Ga0182007_10019620
787 Ga0182005_1001545
788 Ga0163161_10692683
789 Ga0154015_1554328
790 Ga0213873_10000221
791 Ga0213875_10000630
792 Ga0213875_10015402
793 Ga0224712_10161411
794 Ga0209674_102061
795 Ga0207427_100117
796 Ga0207427_100178
797 Ga0209437_100240
798 Ga0209437_100304
799 Ga0209026_1000093
800 Ga0209026_1012870
801 Ga0209759_1026829
802 Ga0209233_1000083
803 Ga0209233_1000287
804 Ga0209233_1000593
805 Ga0209233_1000927
806 Ga0207680_10005720
807 Ga0207647_10000157
808 Ga0207647_10002987
809 Ga0207643_10395160
810 Ga0207705_10261362
811 Ga0207684_10002473
812 Ga0207654_10005697
813 Ga0207654_10573475
814 Ga0207695_10000007
815 Ga0207695_10003485
816 Ga0207695_10005721
817 Ga0207695_10014657
818 Ga0207695_10633803
819 Ga0207671_10000539
820 Ga0207671_10016903
821 Ga0207671_10050714
822 Ga0207671_10102396
823 Ga0207671_10111170
824 Ga0207671_10326839
825 Ga0207671_10820859
826 Ga0207693_10109375
827 Ga0207649_10193389
828 Ga0207681_11509660
829 Ga0207694_10002272
830 Ga0207694_10002780
831 Ga0207694_10029016
832 Ga0207694_10150568
833 Ga0207694_10432454
834 Ga0207650_10076566
835 Ga0207659_10484440
836 Ga0207700_10001482
837 Ga0207700_10170994
838 Ga0207644_10137170
839 Ga0207706_10002669
840 Ga0207706_10183932
841 Ga0207709_10149022
842 Ga0207709_10524758
843 Ga0207709_10857648
844 Ga0207704_10411833
845 Ga0207691_10160492
846 Ga0207711_10064085
847 Ga0207661_10679342
848 Ga0207667_10020549
849 Ga0207667_10186422
850 Ga0207667_11716818
851 Ga0207712_10000197
852 Ga0207640_10029107
853 Ga0207640_10056573
854 Ga0207640_10066221
855 Ga0207640_10113070
856 Ga0207658_10016910
857 Ga0207658_10132107
858 Ga0207677_10052058
859 Ga0207677_10854520
860 Ga0207703_10000010
861 Ga0207703_10022066
862 Ga0207703_10515849
863 Ga0207703_11765355
864 Ga0207703_12127770
865 Ga0207639_10000446
866 Ga0207639_10067673
867 Ga0207678_10004726
868 Ga0207678_10041380
869 Ga0207678_10068243
870 Ga0207702_10093721
871 Ga0207702_10363466
872 Ga0207641_10146810
873 Ga0207648_11529848
874 Ga0207676_10050040
875 Ga0207674_10038945
876 Ga0207675_100030918
877 Ga0207675_100041906
878 Ga0207683_10581749
879 Ga0207683_11389938
880 Ga0207698_10144001
881 Ga0207698_10256648
882 Ga0209813_10104337
883 Ga0268266_10000006
884 Ga0268266_10128370
885 Ga0268266_10312060
886 Ga0268264_10151890
887 Ga0307517_10390391
888 Ga0307517_10486760
889 Ga0307517_10595026
890 Ga0307515_10052565
891 Ga0307513_10001290
892 Ga0307513_10445839
893 Ga0307408_100004915
894 Ga0307408_100188304
895 Ga0307408_100666964
896 Ga0307508_10003645
897 Ga0307508_10269432
898 Ga0307508_10303174
899 Ga0307508_10518269
900 Ga0307516_10021873
901 Ga0307516_10252851
902 Ga0307405_10005819
903 Ga0307405_10197818
904 Ga0307405_10210377
905 Ga0307413_10032463
906 Ga0307413_10232882
907 Ga0307413_10739047
908 Ga0307413_11368669
909 Ga0307410_10006021
910 Ga0307410_10433870
911 Ga0307406_10001367
912 Ga0307406_10289154
913 Ga0307406_10304155
914 Ga0307406_10335019
915 Ga0307406_11360738
916 Ga0307407_10054803
917 Ga0307407_10198335
918 Ga0307407_10356192
919 Ga0307407_10564312
920 Ga0307407_10676443
921 Ga0307412_10028783
922 Ga0307412_10049513
923 Ga0307409_100000553
924 Ga0307409_100203693
925 Ga0307409_100294489
926 Ga0307409_100347622
927 Ga0307409_100414818
928 Ga0307409_100735637
929 Ga0307409_101138411
930 Ga0307416_100000862
931 Ga0307416_100211401
932 Ga0307416_100972084
933 Ga0307414_10172837
934 Ga0307414_10347883
935 Ga0307411_10187684
936 Ga0307411_10931974
937 Ga0307415_100045163
938 Ga0307415_100160692
939 Ga0307415_100181590
940 Ga0307415_100253546
941 Ga0307415_100394651
942 Ga0307415_100877690
943 Ga0307507_10061838
944 Ga0307507_10173948
945 Ga0307507_10200640
946 Ga0373930_0111294
947 Ga0373943_0027191
948 Ga0373943_0102474
949 Ga0373946_0254277
950 Ga0373933_0708450
951 Ga0373947_0625461
952 Ga0373925_0090195
953 Ga0395899_0012559
954 Ga0395899_0028053
955 Ga0395899_0347707
956 Ga0395900_0046692
957 Ga0395900_0201335
958 Ga0395898_0009792
959 Ga0395898_0502933
960 Ga0395905_0004423
961 Ga0395905_0009193
962 Ga0395905_1766309
963 Ga0436364_0687857
964 Ga0436364_0996370
965 Ga0395901_0112114
966 Ga0395901_0199266
967 Ga0436362_1210029
968 Ga0439436_0000007
969 Ga0439436_0055192
970 Ga0439466_0208035
971 Ga0439465_0119126
972 Ga0451791_0374504
973 Ga0451793_0238004
974 Ga0451793_0619921
975 Ga0451793_0752732
976 Ga0451797_0655850
977 Ga0451795_0433110
978 Ga0451802_0088647
979 Ga0451804_0062659
980 Ga0451807_0915670
981 Ga0451837_0147881
982 Ga0451837_0232832
983 Ga0451839_0137982
984 Ga0451841_0070831
985 Ga0451841_0175618
986 Ga0451849_0945722
987 Ga0451843_1347523
988 Ga0451853_0091234
989 Ga0451853_0684873
990 Ga0451853_1250947
991 Ga0451853_2089754
992 Ga0439448_0019790
993 Ga0439449_0376422
994 Ga0439450_067353
995 Ga0439454_018649
996 Ga0439463_013862
997 Ga0450923_070421
998 Ga0450897_014235
999 Ga0450894_017380
1000 Ga0450902_040147
1001 Ga0439464_0016990
1002 Ga0450918_050040
1003 Ga0439440_0018978
1004 Ga0466966_0182895
1005 Ga0466961_0293325
1006 Ga0466971_0360007
1007 Ga0466970_0244040
1008 Ga0466970_0502590
1009 Ga0466960_0413781
1010 Ga0466959_0232023
1011 Ga0466958_0186692
1012 Ga0466967_0071402
1013 Ga0466967_0146452
1014 Ga0466967_0253105
1015 Ga0466967_0533618
1016 Ga0495603_0084977
1017 Ga0495629_0271203
1018 Ga0495638_0024391
1019 Ga0495638_0098199
1020 Ga0495641_0136702
1021 Ga0495651_0000668
1022 Ga0495650_0063909
1023 Ga0495580_0498819
1024 Ga0495582_0704641
1025 Ga0495639_0668705
1026 Ga0495662_0170374
1027 Ga0495584_0211781
1028 Ga0495585_0229047
1029 Ga0495596_0089149
1030 Ga0495608_0177987
1031 Ga0495610_0000927
1032 Ga0495628_0033900
1033 Ga0495628_1111012
1034 Ga0495630_1111355
1035 Ga0495637_0210135
1036 Ga0495643_0005595
1037 Ga0495648_0036590
1038 Ga0495652_0007945
1039 Ga0495652_0989390
1040 Ga0495665_0082163
1041 Ga0495665_0315848
1042 Ga0495586_0670317
1043 Ga0495587_0145851
1044 Ga0495598_0050381
1045 Ga0495609_0112591
1046 Ga0495609_0207304
1047 Ga0495621_0085020
1048 Ga0495597_0015036
1049 Ga0495622_0251510
1050 Ga0495656_0011583
1051 Ga0495656_0103452
1052 Ga0495668_0017761
1053 Ga0495611_0414687
1054 Ga0495625_0146199
1055 Ga0495635_0210274
1056 Ga0495588_0058125
1057 Ga0495657_0903049
1058 Ga0495646_0211283
1059 Ga0495658_0255647
1060 Ga0495670_0001902
1061 Ga0495649_0012790
1062 Ga0495589_0319480
1063 Ga0495600_0013069
1064 Ga0495600_0085957
1065 Ga0495600_0111445
1066 Ga0495660_0081415
1067 Ga0495581_0056902
1068 Ga0495581_0384936
1069 Ga0495581_0591213
1070 Ga0495604_0043259
1071 Ga0495636_0246711
1072 Ga0495674_0213572
1073 Ga0495676_0490917
1074 Ga0495676_0863322
1075 Ga0495680_1019075
1076 Ga0495687_002640
1077 Ga0495677_0256118
1078 Ga0495593_0489016
1079 Ga0495614_0315252
1080 Ga0496101_0196558
1081 Ga0496102_0000512
1082 Ga0496102_0054734
1083 Ga0496102_0303387
1084 Ga0496102_0853923
1085 Ga0496102_0951643
1086 Ga0496103_0004590
1087 Ga0496104_0002424
1088 Ga0496104_0064068
1089 Ga0496104_1505117
1090 Ga0496105_0031981
1091 Ga0496105_0261567
1092 Ga0496108_0009511
1093 Ga0496108_0011671
1094 Ga0496108_0015740
1095 Ga0496108_0163285
1096 Ga0496109_0004867
1097 Ga0496109_0231891
1098 Ga0496109_0529475
1099 Ga0496110_0009977
1100 Ga0496110_0050091
1101 Ga0496111_0000232
1102 Ga0496111_0209793
1103 Ga0496112_0138084
1104 Ga0496112_1645487
1105 Ga0496113_0147544
1106 Ga0496113_0389599
1107 Ga0496114_0031010
1108 Ga0496114_0119061
1109 Ga0496114_0195116
1110 Ga0496114_0241492
1111 Ga0496114_0728448
1112 Ga0496114_0751610
1113 Ga0496114_1258982
1114 Ga0496117_0310060
1115 Ga0496118_0006535
1116 Ga0496118_0110402
1117 Ga0496119_0053645
1118 Ga0496125_0020685
1119 Ga0495682_0340668
1120 Ga0501292_081185
1121 Ga0501298_154573
1122 Ga0501032_0180009
1123 Ga0501033_0473134
1124 Ga0501034_0134416
1125 Ga0501034_0826249
1126 Ga0501038_0188966
1127 Ga0501038_1035920
1128 Ga0501039_0086148
1129 Ga0501039_0206497
1130 Ga0501040_0191362
1131 Ga0501041_0320562
1132 Ga0501042_0132025
1133 Ga0501043_0025323
1134 Ga0501047_0022258
1135 Ga0501047_0073191
1136 Ga0501048_0049934
1137 Ga0501048_0217574
1138 Ga0501067_0120357
1139 Ga0501068_0359921
1140 Ga0501068_0540260
1141 Ga0501070_0014516
1142 Ga0501070_0021507
1143 Ga0501070_0326663
1144 Ga0501071_0086730
1145 Ga0501071_0347553
1146 Ga0501071_0731145
1147 Ga0501072_0022694
1148 Ga0501072_0660405
1149 Ga0501073_0001354
1150 Ga0501074_0012051
1151 Ga0501074_0023298
1152 Ga0501074_0110032
1153 Ga0501074_0207313
1154 Ga0501075_0027315
1155 Ga0501075_0222178
1156 Ga0501076_0116751
1157 Ga0501079_0095749
1158 Ga0501079_0243534
1159 Ga0501079_0947408
1160 Ga0501080_0018376
1161 Ga0501080_0057132
1162 Ga0501081_0210522
1163 Ga0501279_071497
1164 Ga0501035_0005982
1165 Ga0501035_0018649
1166 Ga0501035_0077441
1167 Ga0501035_0273299
1168 Ga0501044_0039950
1169 Ga0501044_0054028
1170 Ga0501044_0165448
1171 nmdc:mga03683_4898_c1
1172 nmdc:mga03n38_375228_c1
1173 nmdc:mga03n38_78470_c1
1174 nmdc:mga0yw44_971576_c1
1175 nmdc:mga0k408_57203_c1
1176 nmdc:mga0k408_68686_c1
1177 nmdc:mga06z11_169479_c1
1178 nmdc:mga06z11_600932_c1
1179 nmdc:mga04h51_64417_c1
1180 nmdc:mga07m45_241639_c1
1181 nmdc:mga07m45_26048_c1
1182 nmdc:mga07m45_275898_c1
1183 nmdc:mga07m45_331124_c1
1184 nmdc:mga07m45_37523_c2
1185 nmdc:mga07m45_37909_c1
1186 nmdc:mga05p37_1469026_c1
1187 nmdc:mga0qj67_3250_c1
1188 nmdc:mga08y16_945453_c1
1189 nmdc:mga0sz30_71096_c1
1190 Ga0495655_0107077
1191 Ga0495595_0260567
1192 Ga0495619_0460901
1193 Ga0500643_000082
1194 Ga0500651_0132317
1195 Ga0500556_0000001
1196 Ga0500568_0000016
1197 Ga0500568_0008001
1198 Ga0500616_0040500
1199 Ga0500645_000044
1200 Ga0500645_002917
1201 Ga0501084_0364449
1202 Ga0501084_0827070
1203 Ga0590075_134252
1204 Ga0501082_0284689
1205 Ga0501082_1170666
1206 2506867298
1207 2515495840
1208 2515755655
1209 2516088100
1210 2566994365
1211 2579855958
1212 2619855112
1213 2620352024
1214 2623589280
1215 2643761745
1216 2643849913
1217 2643878453
1218 2643936845
1219 2644110943
1220 2644135915
1221 2644221679
1222 2644257556
1223 2644318746
1224 2644460827
1225 2644503888
1226 2644516087
1227 2644659758
1228 2644700498
1229 2686537511
1230 2738892196
1231 2739058542
1232 2739365902
1233 2772643209
1234 2774903471
1235 2808884253
1236 2842920615
1237 2867318517
1238 2867320501
1239 2895396827
1240 2895433198
1241 2895890908
1242 2904537491
1243 2912721616
1244 2922558876
1245 2996224137
1246 8002872302
1247 8047714899
1248 8048134192
1249 8054708334
1250 8054914732
1251 8054922886
1252 8057572122

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

7

134

0.8

PF18029

Glyoxalase_6

Glyoxalase-like domain

11

135

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8857 1 133
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8817 2 133
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8807 1 135
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8746 1 135
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8671 1 133
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9248 83 132 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9072 83 136 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8733 83 133 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.873 84 136 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8625 83 136 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A286CWU5-F1-model_v4 VOC domain-containing protein 0.9895 1 135
AF-A0A0S2E3F4-F1-model_v4 Glyoxalase/Bleomycin resistance /Dioxygenase superfamily protein 0.9878 1 136 GO:0051213
AF-A0A1V3P2C5-F1-model_v4 Glyoxalase 0.9875 1 136
AF-A0A1I4BXU9-F1-model_v4 Uncharacterized conserved protein PhnB, glyoxalase superfamily 0.9871 1 136
AF-A0A0Q7SLG1-F1-model_v4 Glyoxalase 0.9861 1 135

Map