F470546

General Info

Members Datasets Scaffolds Average Seq Length
627 309 1254 182

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100026491|Ga0075428_1000264912
Length 211
Sequence MGPDHSRLAIRHSPMVVAAKVLCYVAGDLDAEATAVQDLKSLIRTIPDYPKPGIMFRDVTTLLGNAAGFRAAVQQMAAPFAGAAVQAVAGIEARGFILGGAIADKLGCGFVPLRKKGKLPWKTIGQEYTLEYGVDVIEMHEDAIQRGERILIVDDLIATGGTAEAGVKLVRRSGGEVVGATFIIDLPELGGMAKLADLGVSCHALMAFAGH

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
138 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
141 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
156 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
157 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
167 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
168 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
169 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
172 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
173 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
174 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
183 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
184 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
185 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
186 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
204 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
205 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
206 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
235 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
280 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
281 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
285 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
286 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
287 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
288 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
289 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
290 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
291 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
292 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
293 2847085930 Erwinia persicina B64 Isolate Bulb
294 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
295 2865014394 Pantoea sp. R-71966 Isolate Unclassified
296 2876601092 Pantoea endophytica 596 Isolate Unclassified
297 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
298 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
299 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
300 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
301 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
302 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
303 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
304 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
305 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
306 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
307 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
308 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
309 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.01
Metatranscriptomes 0
Isolates 3.99

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0.16
Endosphere 4.47
Nodule 0
Rhizoplane 10.05
Rhizosphere 77.67
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100026491 3300006844 Bacteria 6418
2 SwRhRL2b_contig_3116631 2162886007 Bacteria 1134
3 SwRhRL2b_contig_3867896 2162886007 Bacteria 49407
4 JGI24739J22299_10000806 3300001989 Bacteria 11467
5 Ga0058692_1001067 3300003856 Bacteria 10709
6 Ga0058692_1003107 3300003856 Bacteria 5273
7 Ga0058692_1004127 3300003856 Bacteria 4354
8 Ga0058692_1014690 3300003856 Bacteria 1787
9 Ga0058692_1041154 3300003856 Bacteria 810
10 Ga0058692_1049164 3300003856 Bacteria 705
11 Ga0065704_10016929 3300005289 Bacteria 2332
12 Ga0065704_10070200 3300005289 Bacteria 89591
13 Ga0070690_100313911 3300005330 Bacteria 1127
14 Ga0070690_100447641 3300005330 Bacteria 957
15 Ga0070670_100340560 3300005331 Bacteria 1316
16 Ga0070680_100004299 3300005336 Bacteria 10709
17 Ga0070680_100034008 3300005336 Bacteria 4111
18 Ga0070682_100005969 3300005337 Bacteria 6819
19 Ga0070660_100032813 3300005339 Bacteria 3911
20 Ga0070660_101151742 3300005339 Bacteria 657
21 Ga0070691_10045080 3300005341 Bacteria 2092
22 Ga0070691_10093991 3300005341 Bacteria 1481
23 Ga0070692_10231276 3300005345 Bacteria 1098
24 Ga0070668_100001974 3300005347 Bacteria 14981
25 Ga0070668_100340506 3300005347 Bacteria 1267
26 Ga0070668_100467755 3300005347 Bacteria 1087
27 Ga0070668_100616196 3300005347 Bacteria 951
28 Ga0070668_101002585 3300005347 Bacteria 751
29 Ga0070674_100210412 3300005356 Bacteria 1507
30 Ga0070674_100588469 3300005356 Bacteria 938
31 Ga0070673_100073112 3300005364 Bacteria 2759
32 Ga0070688_100403149 3300005365 Bacteria 1013
33 Ga0070659_100122288 3300005366 Bacteria 2109
34 Ga0070659_100130882 3300005366 Bacteria 2038
35 Ga0070659_100348445 3300005366 Bacteria 1242
36 Ga0070667_100395691 3300005367 Bacteria 1257
37 Ga0070703_10113940 3300005406 Bacteria 971
38 Ga0070709_10359229 3300005434 Bacteria 1078
39 Ga0070714_101559841 3300005435 Bacteria 645
40 Ga0070701_10015805 3300005438 Bacteria 3495
41 Ga0070701_10431353 3300005438 Bacteria 842
42 Ga0070705_100002285 3300005440 Bacteria 9689
43 Ga0070705_100657902 3300005440 Bacteria 818
44 Ga0070700_100009711 3300005441 Bacteria 5288
45 Ga0070694_100000359 3300005444 Bacteria 24496
46 Ga0070694_100010257 3300005444 Bacteria 5771
47 Ga0070694_100114989 3300005444 Bacteria 1922
48 Ga0070694_100857639 3300005444 Bacteria 748
49 Ga0070708_100083770 3300005445 Bacteria 2892
50 Ga0070663_100076150 3300005455 Bacteria 2453
51 Ga0070663_100147913 3300005455 Bacteria 1799
52 Ga0070663_100813352 3300005455 Bacteria 802
53 Ga0070662_100006477 3300005457 Bacteria 7552
54 Ga0070662_100141995 3300005457 Bacteria 1862
55 Ga0070662_100759537 3300005457 Bacteria 823
56 Ga0070662_100916427 3300005457 Bacteria 748
57 Ga0070681_10038894 3300005458 Bacteria 4769
58 Ga0070681_10090194 3300005458 Bacteria 3016
59 Ga0070681_10225255 3300005458 Bacteria 1790
60 Ga0070681_10778316 3300005458 Bacteria 874
61 Ga0068867_100105220 3300005459 Bacteria 2161
62 Ga0068867_100657308 3300005459 Bacteria 920
63 Ga0068867_101535269 3300005459 Bacteria 621
64 Ga0070699_100001423 3300005518 Bacteria 21997
65 Ga0070679_100006589 3300005530 Bacteria 10821
66 Ga0070679_100347937 3300005530 Bacteria 1430
67 Ga0070684_100709363 3300005535 Bacteria 938
68 Ga0070684_100925304 3300005535 Bacteria 817
69 Ga0070697_100096010 3300005536 Bacteria 2459
70 Ga0068853_100640640 3300005539 Bacteria 1011
71 Ga0068853_101002821 3300005539 Bacteria 804
72 Ga0070672_100772760 3300005543 Bacteria 844
73 Ga0070686_100172963 3300005544 Bacteria 1529
74 Ga0070686_100351290 3300005544 Bacteria 1108
75 Ga0070695_100003857 3300005545 Bacteria 8748
76 Ga0070695_100024217 3300005545 Bacteria 3737
77 Ga0070695_100040532 3300005545 Bacteria 2948
78 Ga0070696_100000216 3300005546 Bacteria 34636
79 Ga0070696_100130392 3300005546 Bacteria 1829
80 Ga0070704_100001519 3300005549 Bacteria 12511
81 Ga0070704_100230035 3300005549 Bacteria 1512
82 Ga0068855_100610845 3300005563 Bacteria 1175
83 Ga0070664_100036127 3300005564 Bacteria 4150
84 Ga0068857_100005576 3300005577 Bacteria 10746
85 Ga0068857_100039506 3300005577 Bacteria 4180
86 Ga0070702_100009520 3300005615 Bacteria 4759
87 Ga0068859_100001122 3300005617 Bacteria 27371
88 Ga0068866_10200907 3300005718 Bacteria 1191
89 Ga0068861_100170295 3300005719 Bacteria 1804
90 Ga0068861_100425021 3300005719 Bacteria 1185
91 Ga0068858_100155894 3300005842 Bacteria 2148
92 Ga0068860_100008517 3300005843 Bacteria 10217
93 Ga0068860_100222268 3300005843 Bacteria 1834
94 Ga0068860_100653242 3300005843 Bacteria 1060
95 Ga0068860_100727982 3300005843 Bacteria 1003
96 Ga0068862_100001456 3300005844 Bacteria 21793
97 Ga0068862_100070870 3300005844 Bacteria 3010
98 Ga0068862_100965937 3300005844 Bacteria 841
99 Ga0081539_10111867 3300005985 Bacteria 1372
100 Ga0070717_10234074 3300006028 Bacteria 1618
101 Ga0075365_10013419 3300006038 Bacteria 4900
102 Ga0075365_10395621 3300006038 Bacteria 975
103 Ga0075368_10003813 3300006042 Bacteria 5072
104 Ga0075368_10005742 3300006042 Bacteria 4290
105 Ga0075363_100072501 3300006048 Bacteria 1873
106 Ga0075364_10018133 3300006051 Bacteria 4404
107 Ga0075364_10096241 3300006051 Bacteria 1968
108 Ga0070715_10052229 3300006163 Bacteria 1762
109 Ga0070712_100155959 3300006175 Bacteria 1758
110 Ga0075367_10004288 3300006178 Bacteria 6929
111 Ga0075367_10093635 3300006178 Bacteria 1830
112 Ga0075366_10332838 3300006195 Bacteria 931
113 Ga0097621_100887861 3300006237 Bacteria 830
114 Ga0075370_10368397 3300006353 Bacteria 860
115 Ga0075428_100020036 3300006844 Bacteria 7408
116 Ga0075428_100290899 3300006844 Bacteria 1757
117 Ga0075428_100332088 3300006844 Bacteria 1633
118 Ga0075428_100655227 3300006844 Bacteria 1120
119 Ga0075430_100000731 3300006846 Bacteria 25197
120 Ga0075430_100246462 3300006846 Bacteria 1481
121 Ga0075430_100251181 3300006846 Bacteria 1465
122 Ga0075430_100350105 3300006846 Bacteria 1220
123 Ga0075431_100002018 3300006847 Bacteria 19385
124 Ga0075431_100039548 3300006847 Bacteria 4858
125 Ga0075431_100108431 3300006847 Bacteria 2866
126 Ga0075431_100329303 3300006847 Bacteria 1538
127 Ga0075433_10003351 3300006852 Bacteria 12384
128 Ga0075433_10793523 3300006852 Bacteria 827
129 Ga0075434_100001138 3300006871 Bacteria 21917
130 Ga0075434_100003424 3300006871 Bacteria 14191
131 Ga0075434_100876797 3300006871 Bacteria 913
132 Ga0075429_100041136 3300006880 Bacteria 4025
133 Ga0075429_100187104 3300006880 Bacteria 1814
134 Ga0068865_100203488 3300006881 Bacteria 1538
135 Ga0068865_100454043 3300006881 Bacteria 1060
136 Ga0068865_100490782 3300006881 Bacteria 1022
137 Ga0068865_100881426 3300006881 Bacteria 777
138 Ga0075436_100125087 3300006914 Bacteria 1801
139 Ga0097620_100001122 3300006931 Bacteria 27371
140 Ga0075435_100017318 3300007076 Bacteria 5452
141 Ga0075435_100048952 3300007076 Bacteria 3397
142 Ga0075435_100678981 3300007076 Bacteria 895
143 Ga0105251_10002616 3300009011 Bacteria 13924
144 Ga0105251_10170099 3300009011 Bacteria 982
145 Ga0105244_10000414 3300009036 Bacteria 39718
146 Ga0105244_10282059 3300009036 Bacteria 771
147 Ga0105244_10282063 3300009036 Bacteria 771
148 Ga0105250_10007944 3300009092 Bacteria 4532
149 Ga0105250_10192089 3300009092 Bacteria 860
150 Ga0111539_10022269 3300009094 Bacteria 7789
151 Ga0111539_10413264 3300009094 Bacteria 1571
152 Ga0111539_10675610 3300009094 Bacteria 1202
153 Ga0105247_10875870 3300009101 Bacteria 691
154 Ga0114129_10091929 3300009147 Bacteria 4203
155 Ga0114129_10401004 3300009147 Bacteria 1808
156 Ga0114129_10486415 3300009147 Bacteria 1614
157 Ga0105243_10122559 3300009148 Bacteria 2194
158 Ga0105243_10123590 3300009148 Bacteria 2186
159 Ga0105243_10683437 3300009148 Bacteria 998
160 Ga0105248_10686667 3300009177 Bacteria 1155
161 Ga0105248_11002713 3300009177 Bacteria 943
162 Ga0105237_10308511 3300009545 Bacteria 1585
163 Ga0105249_10001014 3300009553 Bacteria 24845
164 Ga0105249_10797904 3300009553 Bacteria 1008
165 Ga0105239_11647851 3300010375 Bacteria 742
166 Ga0105246_10002581 3300011119 Bacteria 10955
167 Ga0105246_10330183 3300011119 Bacteria 1243
168 Ga0157373_10000201 3300013100 Bacteria 49344
169 Ga0157373_10077018 3300013100 Bacteria 2353
170 Ga0157373_10565300 3300013100 Bacteria 826
171 Ga0157371_10000352 3300013102 Bacteria 58713
172 Ga0157371_10002463 3300013102 Bacteria 17634
173 Ga0157370_10000557 3300013104 Bacteria 46529
174 Ga0157370_10208284 3300013104 Bacteria 1813
175 Ga0157378_10105797 3300013297 Bacteria 2573
176 Ga0157378_11163544 3300013297 Bacteria 810
177 Ga0163162_10011006 3300013306 Bacteria 8810
178 Ga0163162_10262660 3300013306 Bacteria 1858
179 Ga0163162_10294919 3300013306 Bacteria 1753
180 Ga0157372_10015825 3300013307 Bacteria 8092
181 Ga0157372_10148224 3300013307 Bacteria 2706
182 Ga0157375_10202436 3300013308 Bacteria 2141
183 Ga0157375_10915012 3300013308 Bacteria 1020
184 Ga0163163_10505681 3300014325 Bacteria 1270
185 Ga0157380_10125933 3300014326 Bacteria 2178
186 Ga0157380_10255067 3300014326 Bacteria 1590
187 Ga0157380_10306354 3300014326 Bacteria 1466
188 Ga0157379_10257495 3300014968 Bacteria 1585
189 Ga0157379_10320229 3300014968 Bacteria 1416
190 Ga0157376_10657900 3300014969 Bacteria 1049
191 Ga0182006_1004233 3300015261 Bacteria 7109
192 Ga0182007_10022637 3300015262 Bacteria 2216
193 Ga0163161_10057359 3300017792 Bacteria 2829
194 Ga0163161_10109934 3300017792 Bacteria 2060
195 Ga0209437_100235 3300025233 Bacteria 92210
196 Ga0207696_1000192 3300025711 Bacteria 94285
197 Ga0207696_1000655 3300025711 Bacteria 24794
198 Ga0207655_1000023 3300025728 Bacteria 467070
199 Ga0207655_1006562 3300025728 Bacteria 7684
200 Ga0207655_1025852 3300025728 Bacteria 2837
201 Ga0207655_1031245 3300025728 Bacteria 2458
202 Ga0207655_1035731 3300025728 Bacteria 2214
203 Ga0207655_1139638 3300025728 Bacteria 779
204 Ga0207655_1180835 3300025728 Bacteria 644
205 Ga0207713_1000001 3300025735 Bacteria 2295391
206 Ga0207713_1006682 3300025735 Bacteria 6976
207 Ga0207713_1023616 3300025735 Bacteria 2889
208 Ga0207642_10149157 3300025899 Bacteria 1242
209 Ga0207642_10400254 3300025899 Bacteria 821
210 Ga0207688_10649834 3300025901 Bacteria 666
211 Ga0207647_10091430 3300025904 Bacteria 1815
212 Ga0207699_10036317 3300025906 Bacteria 2808
213 Ga0207705_10153465 3300025909 Bacteria 1727
214 Ga0207705_10258355 3300025909 Bacteria 1330
215 Ga0207654_10063868 3300025911 Bacteria 2162
216 Ga0207707_10071058 3300025912 Bacteria 3033
217 Ga0207707_10120649 3300025912 Bacteria 2292
218 Ga0207707_10235775 3300025912 Bacteria 1592
219 Ga0207695_10054652 3300025913 Unclassified 4168
220 Ga0207671_10338657 3300025914 Bacteria 1192
221 Ga0207671_10354312 3300025914 Bacteria 1164
222 Ga0207660_10024316 3300025917 Bacteria 4101
223 Ga0207660_10129449 3300025917 Bacteria 1920
224 Ga0207662_10232878 3300025918 Bacteria 1204
225 Ga0207657_10044226 3300025919 Bacteria 3916
226 Ga0207657_10397474 3300025919 Bacteria 1084
227 Ga0207657_10811179 3300025919 Bacteria 723
228 Ga0207652_10003272 3300025921 Bacteria 13421
229 Ga0207652_10371145 3300025921 Bacteria 1291
230 Ga0207652_10512538 3300025921 Bacteria 1079
231 Ga0207694_10000458 3300025924 Bacteria 37929
232 Ga0207694_10039027 3300025924 Bacteria 3653
233 Ga0207687_10082623 3300025927 Bacteria 2324
234 Ga0207687_10496886 3300025927 Bacteria 1018
235 Ga0207690_10133512 3300025932 Bacteria 1820
236 Ga0207690_10199556 3300025932 Bacteria 1518
237 Ga0207690_10245294 3300025932 Bacteria 1381
238 Ga0207690_10687605 3300025932 Bacteria 840
239 Ga0207706_10065790 3300025933 Bacteria 3191
240 Ga0207706_10186847 3300025933 Bacteria 1820
241 Ga0207706_10232913 3300025933 Bacteria 1611
242 Ga0207706_10353203 3300025933 Bacteria 1278
243 Ga0207711_10665850 3300025941 Bacteria 971
244 Ga0207711_11206158 3300025941 Bacteria 698
245 Ga0207679_10240881 3300025945 Bacteria 1532
246 Ga0207667_10336663 3300025949 Bacteria 1540
247 Ga0207667_11216874 3300025949 Bacteria 732
248 Ga0207651_10492617 3300025960 Bacteria 1058
249 Ga0207712_10007672 3300025961 Bacteria 6823
250 Ga0207668_10003936 3300025972 Bacteria 8755
251 Ga0207668_10275036 3300025972 Bacteria 1378
252 Ga0207668_10832659 3300025972 Bacteria 818
253 Ga0207703_10044527 3300026035 Bacteria 3567
254 Ga0207678_10000647 3300026067 Bacteria 32061
255 Ga0207678_10034980 3300026067 Bacteria 4375
256 Ga0207678_10049827 3300026067 Bacteria 3619
257 Ga0207708_10020934 3300026075 Bacteria 4934
258 Ga0207708_10146103 3300026075 Bacteria 1858
259 Ga0207648_10127745 3300026089 Bacteria 2236
260 Ga0207648_10183983 3300026089 Bacteria 1850
261 Ga0207648_10967770 3300026089 Bacteria 796
262 Ga0207674_10023232 3300026116 Bacteria 6643
263 Ga0207674_10079747 3300026116 Bacteria 3277
264 Ga0207675_100178873 3300026118 Bacteria 2030
265 Ga0207675_100245069 3300026118 Bacteria 1733
266 Ga0207675_100401703 3300026118 Bacteria 1350
267 Ga0209371_1000010 3300027312 Bacteria 922021
268 Ga0209371_1000146 3300027312 Bacteria 115378
269 Ga0209371_1000220 3300027312 Bacteria 76323
270 Ga0209371_1001330 3300027312 Bacteria 17224
271 Ga0209371_1002424 3300027312 Bacteria 10461
272 Ga0209371_1010831 3300027312 Bacteria 2764
273 Ga0209371_1011047 3300027312 Bacteria 2713
274 Ga0209998_10060225 3300027717 Bacteria 893
275 Ga0209813_10006875 3300027866 Bacteria 2821
276 Ga0207428_10039330 3300027907 Bacteria 3841
277 Ga0207428_10081585 3300027907 Bacteria 2525
278 Ga0268265_10010080 3300028380 Bacteria 6378
279 Ga0268265_10164078 3300028380 Bacteria 1891
280 Ga0268264_10006568 3300028381 Bacteria 9791
281 Ga0268264_10166009 3300028381 Bacteria 1993
282 Ga0268264_10657888 3300028381 Bacteria 1037
283 Ga0268264_10684204 3300028381 Bacteria 1018
284 Ga0265322_10001281 3300028654 Bacteria 8447
285 Ga0268256_1000022 3300030500 Bacteria 531115
286 Ga0268256_1000117 3300030500 Bacteria 115176
287 Ga0268256_1000508 3300030500 Bacteria 32757
288 Ga0268256_1001432 3300030500 Bacteria 14385
289 Ga0268256_1011940 3300030500 Bacteria 2713
290 Ga0268256_1015525 3300030500 Bacteria 2218
291 Ga0268256_1024743 3300030500 Bacteria 1535
292 Ga0265330_10024225 3300031235 Bacteria 2753
293 Ga0265332_10089777 3300031238 Bacteria 1300
294 Ga0265329_10000026 3300031242 Bacteria 61009
295 Ga0265339_10077513 3300031249 Bacteria 1762
296 Ga0265316_10000041 3300031344 Bacteria 137206
297 Ga0307408_100554157 3300031548 Bacteria 1015
298 Ga0265314_10026540 3300031711 Bacteria 4351
299 Ga0265314_10062518 3300031711 Bacteria 2530
300 Ga0265342_10000053 3300031712 Bacteria 121955
301 Ga0307406_10746017 3300031901 Bacteria 821
302 Ga0307407_10055428 3300031903 Bacteria 2291
303 Ga0307416_100496348 3300032002 Bacteria 1284
304 Ga0307416_101297842 3300032002 Bacteria 834
305 Ga0307416_101609718 3300032002 Bacteria 755
306 Ga0307411_10220592 3300032005 Bacteria 1471
307 Ga0373959_0000274 3300034820 Bacteria 11027
308 Ga0373959_0076517 3300034820 Bacteria 764
309 Ga0373951_0012174 3300035091 Bacteria 1935
310 Ga0373939_0023892 3300035114 Bacteria 1697
311 Ga0373941_0022622 3300035115 Bacteria 1786
312 Ga0373960_0063167 3300035121 Bacteria 1128
313 Ga0373961_0047737 3300035241 Bacteria 1259
314 Ga0373962_0068708 3300035242 Bacteria 1054
315 Ga0316574_0226352 3300035398 Bacteria 1197
316 Ga0373931_0003956 3300035691 Bacteria 6708
317 Ga0373927_0166065 3300035695 Bacteria 1447
318 Ga0395900_0041143 3300037418 Bacteria 4765
319 Ga0395898_0277290 3300037466 Bacteria 1599
320 Ga0395901_0092650 3300038443 Bacteria 3163
321 Ga0400486_06905 3300038742 Bacteria 1609
322 Ga0436363_0500052 3300039450 Bacteria 754
323 Ga0439438_016706 3300041405 Bacteria 2130
324 Ga0439438_038703 3300041405 Bacteria 1244
325 Ga0439447_000441 3300041407 Bacteria 15475
326 Ga0439447_018085 3300041407 Bacteria 1907
327 Ga0439466_0000012 3300041411 Bacteria 179902
328 Ga0439432_009793 3300042006 Bacteria 3334
329 Ga0439449_0109978 3300042007 Bacteria 1020
330 Ga0439452_000017 3300042010 Bacteria 324897
331 Ga0439463_004419 3300042016 Bacteria 3526
332 Ga0450907_000202 3300042146 Bacteria 21615
333 Ga0439464_0000654 3300042439 Bacteria 7405
334 Ga0451577_0320989 3300042876 Bacteria 1404
335 Ga0451577_0326520 3300042876 Bacteria 1391
336 Ga0451577_0627544 3300042876 Bacteria 975
337 Ga0453684_0057793 3300044712 Bacteria 5015
338 Ga0453684_0103349 3300044712 Bacteria 3482
339 Ga0451576_0109005 3300045051 Bacteria 2881
340 Ga0451576_0436331 3300045051 Bacteria 1374
341 Ga0495591_000301 3300046458 Bacteria 45136
342 Ga0495591_034485 3300046458 Bacteria 1489
343 Ga0495629_0383026 3300046459 Bacteria 957
344 Ga0495638_0093226 3300046460 Bacteria 1811
345 Ga0495650_0000033 3300046471 Bacteria 412188
346 Ga0495605_0285051 3300046474 Bacteria 701
347 Ga0495584_0019356 3300046491 Bacteria 3457
348 Ga0495585_0016225 3300046492 Bacteria 4315
349 Ga0495596_0005618 3300046500 Bacteria 5894
350 Ga0495607_0011840 3300046501 Bacteria 5783
351 Ga0495606_0000627 3300046507 Bacteria 55643
352 Ga0495631_0043277 3300046518 Bacteria 1987
353 Ga0495637_0164241 3300046520 Bacteria 831
354 Ga0495643_0009449 3300046522 Bacteria 6062
355 Ga0495644_0000325 3300046523 Bacteria 21805
356 Ga0495648_0002784 3300046524 Bacteria 15767
357 Ga0495648_0003080 3300046524 Bacteria 14894
358 Ga0495654_0000020 3300046530 Bacteria 284814
359 Ga0495654_0000032 3300046530 Bacteria 205780
360 Ga0495654_0110043 3300046530 Bacteria 1258
361 Ga0495668_0033304 3300046616 Bacteria 2896
362 Ga0495668_0368124 3300046616 Bacteria 789
363 Ga0495625_0593069 3300046660 Bacteria 666
364 Ga0495670_0308930 3300046691 Bacteria 848
365 Ga0495671_0006452 3300046692 Bacteria 6774
366 Ga0495649_0002568 3300046694 Bacteria 12719
367 Ga0495649_0426606 3300046694 Bacteria 664
368 Ga0495589_0144335 3300046794 Bacteria 1138
369 Ga0495660_0000011 3300046810 Bacteria 361397
370 Ga0495660_0004506 3300046810 Bacteria 8424
371 Ga0495672_0000004 3300047320 Bacteria 631810
372 Ga0495672_0000061 3300047320 Bacteria 212024
373 Ga0495676_0411374 3300047321 Bacteria 896
374 Ga0495683_0003509 3300047323 Bacteria 9128
375 Ga0495677_0239799 3300047445 Bacteria 708
376 Ga0495679_037514 3300047446 Bacteria 1523
377 Ga0495673_0000023 3300047469 Bacteria 539904
378 Ga0496100_0003895 3300048903 Bacteria 7837
379 Ga0496100_0102340 3300048903 Bacteria 1976
380 Ga0496101_0000029 3300048904 Bacteria 198515
381 Ga0496101_0085843 3300048904 Bacteria 2333
382 Ga0496101_0120853 3300048904 Bacteria 1980
383 Ga0496101_0506996 3300048904 Bacteria 953
384 Ga0496102_0001489 3300048905 Bacteria 20686
385 Ga0496102_0009820 3300048905 Bacteria 8228
386 Ga0496102_0207611 3300048905 Bacteria 1847
387 Ga0496102_0210900 3300048905 Bacteria 1831
388 Ga0496102_0249642 3300048905 Bacteria 1673
389 Ga0496102_0563791 3300048905 Bacteria 1061
390 Ga0496102_0911224 3300048905 Bacteria 801
391 Ga0496103_0272802 3300048906 Bacteria 1088
392 Ga0496103_0452243 3300048906 Bacteria 824
393 Ga0496104_0012567 3300048907 Bacteria 7620
394 Ga0496104_0163343 3300048907 Bacteria 2136
395 Ga0496104_0274604 3300048907 Bacteria 1598
396 Ga0496104_0368284 3300048907 Bacteria 1349
397 Ga0496104_0507290 3300048907 Bacteria 1117
398 Ga0496104_0594541 3300048907 Bacteria 1017
399 Ga0496105_0009365 3300048908 Bacteria 7658
400 Ga0496105_0042330 3300048908 Bacteria 3754
401 Ga0496106_0010731 3300048909 Bacteria 6770
402 Ga0496106_0104121 3300048909 Bacteria 2204
403 Ga0496106_0198976 3300048909 Bacteria 1594
404 Ga0496106_0284493 3300048909 Bacteria 1325
405 Ga0496107_0029719 3300048910 Bacteria 3890
406 Ga0496107_0036066 3300048910 Bacteria 3547
407 Ga0496107_0160482 3300048910 Bacteria 1666
408 Ga0496107_0296906 3300048910 Bacteria 1202
409 Ga0496108_0007780 3300048911 Bacteria 8682
410 Ga0496108_0024985 3300048911 Bacteria 4921
411 Ga0496108_0159173 3300048911 Bacteria 1951
412 Ga0496108_0505406 3300048911 Bacteria 1055
413 Ga0496108_0949055 3300048911 Bacteria 736
414 Ga0496109_0074201 3300048912 Bacteria 3127
415 Ga0496109_0077708 3300048912 Bacteria 3055
416 Ga0496109_0140964 3300048912 Bacteria 2254
417 Ga0496109_0159580 3300048912 Bacteria 2113
418 Ga0496109_0160490 3300048912 Bacteria 2106
419 Ga0496109_0234504 3300048912 Bacteria 1727
420 Ga0496109_0583621 3300048912 Bacteria 1053
421 Ga0496110_0009605 3300048913 Bacteria 7830
422 Ga0496110_0011839 3300048913 Bacteria 7164
423 Ga0496111_0023061 3300048914 Bacteria 4366
424 Ga0496111_0334417 3300048914 Bacteria 1121
425 Ga0496111_0377516 3300048914 Bacteria 1048
426 Ga0496112_0115065 3300048915 Bacteria 2660
427 Ga0496112_0506317 3300048915 Bacteria 1143
428 Ga0496112_0537668 3300048915 Bacteria 1103
429 Ga0496112_0566343 3300048915 Bacteria 1069
430 Ga0496112_1093977 3300048915 Bacteria 715
431 Ga0496113_0013315 3300048916 Bacteria 5567
432 Ga0496113_0170591 3300048916 Bacteria 1723
433 Ga0496114_0075014 3300048917 Bacteria 2848
434 Ga0496114_0081795 3300048917 Bacteria 2729
435 Ga0496114_0169204 3300048917 Bacteria 1904
436 Ga0496115_0131873 3300048918 Bacteria 2060
437 Ga0496115_0248799 3300048918 Bacteria 1464
438 Ga0496116_0000505 3300048919 Bacteria 53281
439 Ga0496116_0001225 3300048919 Bacteria 29890
440 Ga0496116_0004222 3300048919 Bacteria 13807
441 Ga0496116_0132179 3300048919 Bacteria 1420
442 Ga0496117_0000004 3300048920 Bacteria 877131
443 Ga0496117_0000212 3300048920 Bacteria 112241
444 Ga0496117_0000853 3300048920 Bacteria 47190
445 Ga0496118_0000024 3300048921 Bacteria 385236
446 Ga0496118_0001266 3300048921 Bacteria 38767
447 Ga0496118_0006001 3300048921 Bacteria 13546
448 Ga0496118_0068562 3300048921 Bacteria 2575
449 Ga0496119_0000043 3300048922 Bacteria 192373
450 Ga0496119_0002495 3300048922 Bacteria 20119
451 Ga0496119_0010644 3300048922 Bacteria 7710
452 Ga0496119_0025982 3300048922 Bacteria 4074
453 Ga0496119_0028934 3300048922 Bacteria 3769
454 Ga0496120_0000009 3300048923 Bacteria 386727
455 Ga0496120_0000429 3300048923 Bacteria 66724
456 Ga0496120_0000703 3300048923 Bacteria 49030
457 Ga0496120_0000985 3300048923 Bacteria 38684
458 Ga0496120_0008048 3300048923 Bacteria 7752
459 Ga0496121_0000131 3300048924 Bacteria 167955
460 Ga0496122_0009940 3300048925 Bacteria 9909
461 Ga0496122_0012371 3300048925 Bacteria 8510
462 Ga0496122_0017202 3300048925 Bacteria 6776
463 Ga0496123_0000651 3300048926 Bacteria 57756
464 Ga0496123_0002672 3300048926 Bacteria 21476
465 Ga0496123_0058563 3300048926 Bacteria 2497
466 Ga0496124_0000156 3300048927 Bacteria 137990
467 Ga0496124_0002368 3300048927 Bacteria 24848
468 Ga0496124_0003823 3300048927 Bacteria 18055
469 Ga0496124_0024262 3300048927 Bacteria 5519
470 Ga0496124_0059370 3300048927 Bacteria 3214
471 Ga0496124_0397621 3300048927 Bacteria 957
472 Ga0496125_0006757 3300048928 Bacteria 12324
473 Ga0496126_0082390 3300048929 Bacteria 2842
474 Ga0495678_000388 3300049459 Bacteria 44393
475 Ga0495682_0000004 3300049460 Bacteria 378337
476 Ga0501032_0258834 3300049569 Bacteria 1129
477 Ga0501034_0000031 3300049571 Bacteria 244022
478 Ga0501034_0704490 3300049571 Bacteria 908
479 Ga0501036_0139413 3300049572 Bacteria 2047
480 Ga0501036_0213940 3300049572 Bacteria 1619
481 Ga0501036_0498112 3300049572 Bacteria 1014
482 Ga0501036_0865289 3300049572 Bacteria 743
483 Ga0501037_0031595 3300049573 Bacteria 3910
484 Ga0501038_0033998 3300049574 Bacteria 4485
485 Ga0501038_0644632 3300049574 Bacteria 798
486 Ga0501038_1081117 3300049574 Bacteria 586
487 Ga0501039_0051212 3300049575 Bacteria 3196
488 Ga0501039_0322596 3300049575 Bacteria 1214
489 Ga0501040_0159906 3300049576 Bacteria 1592
490 Ga0501040_0327378 3300049576 Bacteria 1096
491 Ga0501040_0407903 3300049576 Bacteria 976
492 Ga0501040_0416620 3300049576 Bacteria 965
493 Ga0501041_0006685 3300049577 Bacteria 6756
494 Ga0501043_0047838 3300049579 Bacteria 3363
495 Ga0501046_0000011 3300049580 Bacteria 326457
496 Ga0501046_0002427 3300049580 Bacteria 17479
497 Ga0501046_0017213 3300049580 Bacteria 6039
498 Ga0501046_0326511 3300049580 Bacteria 1117
499 Ga0501046_0506011 3300049580 Bacteria 865
500 Ga0501047_0001332 3300049581 Bacteria 24241
501 Ga0501047_0022040 3300049581 Bacteria 6119
502 Ga0501047_0169730 3300049581 Bacteria 2051
503 Ga0501047_0260461 3300049581 Bacteria 1582
504 Ga0501047_0291975 3300049581 Bacteria 1474
505 Ga0501048_0000043 3300049582 Bacteria 61640
506 Ga0501048_0015726 3300049582 Bacteria 5583
507 Ga0501048_0095914 3300049582 Bacteria 2092
508 Ga0501067_0002583 3300049583 Bacteria 10003
509 Ga0501067_0038385 3300049583 Bacteria 2659
510 Ga0501067_0357749 3300049583 Bacteria 814
511 Ga0501070_0048296 3300049586 Bacteria 3536
512 Ga0501070_0112519 3300049586 Bacteria 2250
513 Ga0501070_0379171 3300049586 Bacteria 1146
514 Ga0501072_0299175 3300049588 Bacteria 1279
515 Ga0501072_0837049 3300049588 Bacteria 720
516 Ga0501072_0851901 3300049588 Bacteria 713
517 Ga0501073_0105372 3300049589 Bacteria 1957
518 Ga0501074_0008052 3300049590 Bacteria 7634
519 Ga0501074_0463487 3300049590 Bacteria 898
520 Ga0501074_0749376 3300049590 Bacteria 689
521 Ga0501075_0524195 3300049591 Bacteria 904
522 Ga0501075_0772951 3300049591 Bacteria 731
523 Ga0501076_0269252 3300049592 Bacteria 1395
524 Ga0501076_0317284 3300049592 Bacteria 1278
525 Ga0501076_0364439 3300049592 Bacteria 1187
526 Ga0501077_0099053 3300049593 Bacteria 1847
527 Ga0501079_0006736 3300049741 Bacteria 8644
528 Ga0501079_0032756 3300049741 Bacteria 3997
529 Ga0501079_0100741 3300049741 Bacteria 2240
530 Ga0501079_0123925 3300049741 Bacteria 2010
531 Ga0501080_0000483 3300049742 Bacteria 30977
532 Ga0501080_0241131 3300049742 Bacteria 1650
533 Ga0501080_0320596 3300049742 Bacteria 1403
534 Ga0501081_0031849 3300049743 Bacteria 3574
535 Ga0501081_0424472 3300049743 Bacteria 986
536 Ga0501081_0540526 3300049743 Bacteria 870
537 Ga0501083_0119422 3300049744 Bacteria 1730
538 Ga0501083_0228418 3300049744 Bacteria 1212
539 Ga0501083_0465373 3300049744 Bacteria 823
540 Ga0501035_0001140 3300049822 Bacteria 27786
541 Ga0501044_0000013 3300049823 Bacteria 248795
542 Ga0501044_0038173 3300049823 Bacteria 5017
543 Ga0501045_0018006 3300049824 Bacteria 5016
544 Ga0501045_0075730 3300049824 Bacteria 2479
545 Ga0501045_0085780 3300049824 Bacteria 2324
546 Ga0501045_0487247 3300049824 Bacteria 916
547 Ga0501045_0801716 3300049824 Bacteria 693
548 nmdc:mga00v17_26552_c2 3300050491 Bacteria 2103
549 nmdc:mga00v17_276087_c1 3300050491 Bacteria 1091
550 nmdc:mga0yw44_151478_c1 3300050492 Bacteria 1513
551 nmdc:mga0yw44_379663_c1 3300050492 Bacteria 954
552 nmdc:mga0k408_149556_c1 3300050493 Bacteria 1390
553 nmdc:mga06z11_166589_c1 3300050494 Bacteria 1263
554 nmdc:mga06z11_205813_c1 3300050494 Bacteria 1145
555 nmdc:mga06z11_3745_c1 3300050494 Bacteria 5910
556 nmdc:mga06z11_822_c1 3300050494 Bacteria 11360
557 nmdc:mga04h51_27094_c1 3300050495 Bacteria 1778
558 nmdc:mga07m45_102512_c1 3300050496 Bacteria 1644
559 nmdc:mga05p37_143745_c1 3300050507 Bacteria 2922
560 nmdc:mga05p37_1451430_c1 3300050507 Bacteria 687
561 nmdc:mga05p37_406567_c1 3300050507 Bacteria 1588
562 nmdc:mga05p37_575767_c1 3300050507 Bacteria 1276
563 nmdc:mga05p37_665137_c1 3300050507 Bacteria 1163
564 nmdc:mga0qj67_11115_c1 3300050509 Bacteria 6743
565 nmdc:mga0qj67_308746_c1 3300050509 Bacteria 1281
566 nmdc:mga06r32_128874_c1 3300050510 Bacteria 2500
567 nmdc:mga06r32_21542_c1 3300050510 Bacteria 5950
568 nmdc:mga06r32_250143_c1 3300050510 Bacteria 1760
569 nmdc:mga06r32_340973_c1 3300050510 Bacteria 1483
570 nmdc:mga06r32_35095_c1 3300050510 Bacteria 4732
571 nmdc:mga06r32_35458_c1 3300050510 Bacteria 4708
572 nmdc:mga06r32_4262_c1 3300050510 Bacteria 12804
573 nmdc:mga06r32_49234_c1 3300050510 Bacteria 4029
574 nmdc:mga08y16_117740_c1 3300050511 Bacteria 2765
575 nmdc:mga08y16_259241_c1 3300050511 Bacteria 1796
576 nmdc:mga08y16_374842_c1 3300050511 Bacteria 1459
577 nmdc:mga08y16_63275_c1 3300050511 Bacteria 3863
578 nmdc:mga0n895_3199_c1 3300050512 Bacteria 13100
579 nmdc:mga0n895_4319_c1 3300050512 Bacteria 11646
580 nmdc:mga0n895_807155_c1 3300050512 Bacteria 928
581 nmdc:mga0rr50_43493_c1 3300050513 Bacteria 3288
582 nmdc:mga0rr50_45494_c1 3300050513 Bacteria 3226
583 nmdc:mga0rr50_465925_c1 3300050513 Bacteria 1072
584 nmdc:mga08x19_322373_c1 3300050514 Bacteria 1075
585 nmdc:mga0a205_194466_c1 3300050515 Bacteria 1919
586 nmdc:mga0a205_382134_c1 3300050515 Bacteria 1273
587 nmdc:mga0a205_88273_c1 3300050515 Bacteria 2997
588 Ga0495655_0000667 3300053083 Bacteria 5515
589 Ga0495619_0377573 3300053085 Bacteria 980
590 Ga0500562_031591 3300053108 Bacteria 1397
591 Ga0500621_000001 3300053126 Bacteria 1049698
592 Ga0500616_0030262 3300053153 Bacteria 2974
593 Ga0500616_0074472 3300053153 Bacteria 1721
594 Ga0501084_0004253 3300054114 Bacteria 11647
595 Ga0501084_0008080 3300054114 Bacteria 8666
596 Ga0501084_0116231 3300054114 Bacteria 2249
597 Ga0501084_0250925 3300054114 Bacteria 1494
598 Ga0501082_0044436 3300060353 Bacteria 3832
599 Ga0501082_0086367 3300060353 Bacteria 2706
600 Ga0501082_0332555 3300060353 Bacteria 1324
601 Ga0501082_0809568 3300060353 Bacteria 819
602 Ga0530510_0262907 3300061734 Bacteria 1287
603 2511379391 2511231025 Bacteria 5324661
604 2511433846 2511231035 Bacteria 5341610
605 2599927109 2599185299 Bacteria 4854625
606 2608668540 2608642108 Bacteria 4104624
607 2650895545 2648501693 Bacteria 5069560
608 2686355759 2684622997 Bacteria 4624240
609 2809124658 2808606414 Bacteria 4917181
610 2844532023 2844528606 Bacteria 4733806
611 2847088719 2847085930 Bacteria 5070450
612 2847800874 2847797336 Bacteria 5176640
613 2865017600 2865014394 Bacteria 4764573
614 2876601260 2876601092 Bacteria 5114497
615 2881612228 2881609920 Bacteria 4405319
616 2896186061 2896184354 Bacteria 3258548
617 2908671255 2908669403 Bacteria 5740494
618 2919495749 2919493220 Bacteria 4598500
619 2919543388 2919543075 Bacteria 4728703
620 2923528456 2923525760 Bacteria 4472324
621 2939603020 2939602548 Bacteria 4950493
622 2945953959 2945951305 Bacteria 4918162
623 2978976443 2978975091 Bacteria 4704313
624 2984495627 2984494565 Bacteria 5000175
625 2990264322 2990261002 Bacteria 4919493
626 8016736880 8016733728 Bacteria 5274317
627 8019502089 8019499862 Bacteria 5169538
628 Ga0075428_100026491
629 SwRhRL2b_contig_3116631
630 SwRhRL2b_contig_3867896
631 JGI24739J22299_10000806
632 Ga0058692_1001067
633 Ga0058692_1003107
634 Ga0058692_1004127
635 Ga0058692_1014690
636 Ga0058692_1041154
637 Ga0058692_1049164
638 Ga0065704_10016929
639 Ga0065704_10070200
640 Ga0070690_100313911
641 Ga0070690_100447641
642 Ga0070670_100340560
643 Ga0070680_100004299
644 Ga0070680_100034008
645 Ga0070682_100005969
646 Ga0070660_100032813
647 Ga0070660_101151742
648 Ga0070691_10045080
649 Ga0070691_10093991
650 Ga0070692_10231276
651 Ga0070668_100001974
652 Ga0070668_100340506
653 Ga0070668_100467755
654 Ga0070668_100616196
655 Ga0070668_101002585
656 Ga0070674_100210412
657 Ga0070674_100588469
658 Ga0070673_100073112
659 Ga0070688_100403149
660 Ga0070659_100122288
661 Ga0070659_100130882
662 Ga0070659_100348445
663 Ga0070667_100395691
664 Ga0070703_10113940
665 Ga0070709_10359229
666 Ga0070714_101559841
667 Ga0070701_10015805
668 Ga0070701_10431353
669 Ga0070705_100002285
670 Ga0070705_100657902
671 Ga0070700_100009711
672 Ga0070694_100000359
673 Ga0070694_100010257
674 Ga0070694_100114989
675 Ga0070694_100857639
676 Ga0070708_100083770
677 Ga0070663_100076150
678 Ga0070663_100147913
679 Ga0070663_100813352
680 Ga0070662_100006477
681 Ga0070662_100141995
682 Ga0070662_100759537
683 Ga0070662_100916427
684 Ga0070681_10038894
685 Ga0070681_10090194
686 Ga0070681_10225255
687 Ga0070681_10778316
688 Ga0068867_100105220
689 Ga0068867_100657308
690 Ga0068867_101535269
691 Ga0070699_100001423
692 Ga0070679_100006589
693 Ga0070679_100347937
694 Ga0070684_100709363
695 Ga0070684_100925304
696 Ga0070697_100096010
697 Ga0068853_100640640
698 Ga0068853_101002821
699 Ga0070672_100772760
700 Ga0070686_100172963
701 Ga0070686_100351290
702 Ga0070695_100003857
703 Ga0070695_100024217
704 Ga0070695_100040532
705 Ga0070696_100000216
706 Ga0070696_100130392
707 Ga0070704_100001519
708 Ga0070704_100230035
709 Ga0068855_100610845
710 Ga0070664_100036127
711 Ga0068857_100005576
712 Ga0068857_100039506
713 Ga0070702_100009520
714 Ga0068859_100001122
715 Ga0068866_10200907
716 Ga0068861_100170295
717 Ga0068861_100425021
718 Ga0068858_100155894
719 Ga0068860_100008517
720 Ga0068860_100222268
721 Ga0068860_100653242
722 Ga0068860_100727982
723 Ga0068862_100001456
724 Ga0068862_100070870
725 Ga0068862_100965937
726 Ga0081539_10111867
727 Ga0070717_10234074
728 Ga0075365_10013419
729 Ga0075365_10395621
730 Ga0075368_10003813
731 Ga0075368_10005742
732 Ga0075363_100072501
733 Ga0075364_10018133
734 Ga0075364_10096241
735 Ga0070715_10052229
736 Ga0070712_100155959
737 Ga0075367_10004288
738 Ga0075367_10093635
739 Ga0075366_10332838
740 Ga0097621_100887861
741 Ga0075370_10368397
742 Ga0075428_100020036
743 Ga0075428_100290899
744 Ga0075428_100332088
745 Ga0075428_100655227
746 Ga0075430_100000731
747 Ga0075430_100246462
748 Ga0075430_100251181
749 Ga0075430_100350105
750 Ga0075431_100002018
751 Ga0075431_100039548
752 Ga0075431_100108431
753 Ga0075431_100329303
754 Ga0075433_10003351
755 Ga0075433_10793523
756 Ga0075434_100001138
757 Ga0075434_100003424
758 Ga0075434_100876797
759 Ga0075429_100041136
760 Ga0075429_100187104
761 Ga0068865_100203488
762 Ga0068865_100454043
763 Ga0068865_100490782
764 Ga0068865_100881426
765 Ga0075436_100125087
766 Ga0097620_100001122
767 Ga0075435_100017318
768 Ga0075435_100048952
769 Ga0075435_100678981
770 Ga0105251_10002616
771 Ga0105251_10170099
772 Ga0105244_10000414
773 Ga0105244_10282059
774 Ga0105244_10282063
775 Ga0105250_10007944
776 Ga0105250_10192089
777 Ga0111539_10022269
778 Ga0111539_10413264
779 Ga0111539_10675610
780 Ga0105247_10875870
781 Ga0114129_10091929
782 Ga0114129_10401004
783 Ga0114129_10486415
784 Ga0105243_10122559
785 Ga0105243_10123590
786 Ga0105243_10683437
787 Ga0105248_10686667
788 Ga0105248_11002713
789 Ga0105237_10308511
790 Ga0105249_10001014
791 Ga0105249_10797904
792 Ga0105239_11647851
793 Ga0105246_10002581
794 Ga0105246_10330183
795 Ga0157373_10000201
796 Ga0157373_10077018
797 Ga0157373_10565300
798 Ga0157371_10000352
799 Ga0157371_10002463
800 Ga0157370_10000557
801 Ga0157370_10208284
802 Ga0157378_10105797
803 Ga0157378_11163544
804 Ga0163162_10011006
805 Ga0163162_10262660
806 Ga0163162_10294919
807 Ga0157372_10015825
808 Ga0157372_10148224
809 Ga0157375_10202436
810 Ga0157375_10915012
811 Ga0163163_10505681
812 Ga0157380_10125933
813 Ga0157380_10255067
814 Ga0157380_10306354
815 Ga0157379_10257495
816 Ga0157379_10320229
817 Ga0157376_10657900
818 Ga0182006_1004233
819 Ga0182007_10022637
820 Ga0163161_10057359
821 Ga0163161_10109934
822 Ga0209437_100235
823 Ga0207696_1000192
824 Ga0207696_1000655
825 Ga0207655_1000023
826 Ga0207655_1006562
827 Ga0207655_1025852
828 Ga0207655_1031245
829 Ga0207655_1035731
830 Ga0207655_1139638
831 Ga0207655_1180835
832 Ga0207713_1000001
833 Ga0207713_1006682
834 Ga0207713_1023616
835 Ga0207642_10149157
836 Ga0207642_10400254
837 Ga0207688_10649834
838 Ga0207647_10091430
839 Ga0207699_10036317
840 Ga0207705_10153465
841 Ga0207705_10258355
842 Ga0207654_10063868
843 Ga0207707_10071058
844 Ga0207707_10120649
845 Ga0207707_10235775
846 Ga0207695_10054652
847 Ga0207671_10338657
848 Ga0207671_10354312
849 Ga0207660_10024316
850 Ga0207660_10129449
851 Ga0207662_10232878
852 Ga0207657_10044226
853 Ga0207657_10397474
854 Ga0207657_10811179
855 Ga0207652_10003272
856 Ga0207652_10371145
857 Ga0207652_10512538
858 Ga0207694_10000458
859 Ga0207694_10039027
860 Ga0207687_10082623
861 Ga0207687_10496886
862 Ga0207690_10133512
863 Ga0207690_10199556
864 Ga0207690_10245294
865 Ga0207690_10687605
866 Ga0207706_10065790
867 Ga0207706_10186847
868 Ga0207706_10232913
869 Ga0207706_10353203
870 Ga0207711_10665850
871 Ga0207711_11206158
872 Ga0207679_10240881
873 Ga0207667_10336663
874 Ga0207667_11216874
875 Ga0207651_10492617
876 Ga0207712_10007672
877 Ga0207668_10003936
878 Ga0207668_10275036
879 Ga0207668_10832659
880 Ga0207703_10044527
881 Ga0207678_10000647
882 Ga0207678_10034980
883 Ga0207678_10049827
884 Ga0207708_10020934
885 Ga0207708_10146103
886 Ga0207648_10127745
887 Ga0207648_10183983
888 Ga0207648_10967770
889 Ga0207674_10023232
890 Ga0207674_10079747
891 Ga0207675_100178873
892 Ga0207675_100245069
893 Ga0207675_100401703
894 Ga0209371_1000010
895 Ga0209371_1000146
896 Ga0209371_1000220
897 Ga0209371_1001330
898 Ga0209371_1002424
899 Ga0209371_1010831
900 Ga0209371_1011047
901 Ga0209998_10060225
902 Ga0209813_10006875
903 Ga0207428_10039330
904 Ga0207428_10081585
905 Ga0268265_10010080
906 Ga0268265_10164078
907 Ga0268264_10006568
908 Ga0268264_10166009
909 Ga0268264_10657888
910 Ga0268264_10684204
911 Ga0265322_10001281
912 Ga0268256_1000022
913 Ga0268256_1000117
914 Ga0268256_1000508
915 Ga0268256_1001432
916 Ga0268256_1011940
917 Ga0268256_1015525
918 Ga0268256_1024743
919 Ga0265330_10024225
920 Ga0265332_10089777
921 Ga0265329_10000026
922 Ga0265339_10077513
923 Ga0265316_10000041
924 Ga0307408_100554157
925 Ga0265314_10026540
926 Ga0265314_10062518
927 Ga0265342_10000053
928 Ga0307406_10746017
929 Ga0307407_10055428
930 Ga0307416_100496348
931 Ga0307416_101297842
932 Ga0307416_101609718
933 Ga0307411_10220592
934 Ga0373959_0000274
935 Ga0373959_0076517
936 Ga0373951_0012174
937 Ga0373939_0023892
938 Ga0373941_0022622
939 Ga0373960_0063167
940 Ga0373961_0047737
941 Ga0373962_0068708
942 Ga0316574_0226352
943 Ga0373931_0003956
944 Ga0373927_0166065
945 Ga0395900_0041143
946 Ga0395898_0277290
947 Ga0395901_0092650
948 Ga0400486_06905
949 Ga0436363_0500052
950 Ga0439438_016706
951 Ga0439438_038703
952 Ga0439447_000441
953 Ga0439447_018085
954 Ga0439466_0000012
955 Ga0439432_009793
956 Ga0439449_0109978
957 Ga0439452_000017
958 Ga0439463_004419
959 Ga0450907_000202
960 Ga0439464_0000654
961 Ga0451577_0320989
962 Ga0451577_0326520
963 Ga0451577_0627544
964 Ga0453684_0057793
965 Ga0453684_0103349
966 Ga0451576_0109005
967 Ga0451576_0436331
968 Ga0495591_000301
969 Ga0495591_034485
970 Ga0495629_0383026
971 Ga0495638_0093226
972 Ga0495650_0000033
973 Ga0495605_0285051
974 Ga0495584_0019356
975 Ga0495585_0016225
976 Ga0495596_0005618
977 Ga0495607_0011840
978 Ga0495606_0000627
979 Ga0495631_0043277
980 Ga0495637_0164241
981 Ga0495643_0009449
982 Ga0495644_0000325
983 Ga0495648_0002784
984 Ga0495648_0003080
985 Ga0495654_0000020
986 Ga0495654_0000032
987 Ga0495654_0110043
988 Ga0495668_0033304
989 Ga0495668_0368124
990 Ga0495625_0593069
991 Ga0495670_0308930
992 Ga0495671_0006452
993 Ga0495649_0002568
994 Ga0495649_0426606
995 Ga0495589_0144335
996 Ga0495660_0000011
997 Ga0495660_0004506
998 Ga0495672_0000004
999 Ga0495672_0000061
1000 Ga0495676_0411374
1001 Ga0495683_0003509
1002 Ga0495677_0239799
1003 Ga0495679_037514
1004 Ga0495673_0000023
1005 Ga0496100_0003895
1006 Ga0496100_0102340
1007 Ga0496101_0000029
1008 Ga0496101_0085843
1009 Ga0496101_0120853
1010 Ga0496101_0506996
1011 Ga0496102_0001489
1012 Ga0496102_0009820
1013 Ga0496102_0207611
1014 Ga0496102_0210900
1015 Ga0496102_0249642
1016 Ga0496102_0563791
1017 Ga0496102_0911224
1018 Ga0496103_0272802
1019 Ga0496103_0452243
1020 Ga0496104_0012567
1021 Ga0496104_0163343
1022 Ga0496104_0274604
1023 Ga0496104_0368284
1024 Ga0496104_0507290
1025 Ga0496104_0594541
1026 Ga0496105_0009365
1027 Ga0496105_0042330
1028 Ga0496106_0010731
1029 Ga0496106_0104121
1030 Ga0496106_0198976
1031 Ga0496106_0284493
1032 Ga0496107_0029719
1033 Ga0496107_0036066
1034 Ga0496107_0160482
1035 Ga0496107_0296906
1036 Ga0496108_0007780
1037 Ga0496108_0024985
1038 Ga0496108_0159173
1039 Ga0496108_0505406
1040 Ga0496108_0949055
1041 Ga0496109_0074201
1042 Ga0496109_0077708
1043 Ga0496109_0140964
1044 Ga0496109_0159580
1045 Ga0496109_0160490
1046 Ga0496109_0234504
1047 Ga0496109_0583621
1048 Ga0496110_0009605
1049 Ga0496110_0011839
1050 Ga0496111_0023061
1051 Ga0496111_0334417
1052 Ga0496111_0377516
1053 Ga0496112_0115065
1054 Ga0496112_0506317
1055 Ga0496112_0537668
1056 Ga0496112_0566343
1057 Ga0496112_1093977
1058 Ga0496113_0013315
1059 Ga0496113_0170591
1060 Ga0496114_0075014
1061 Ga0496114_0081795
1062 Ga0496114_0169204
1063 Ga0496115_0131873
1064 Ga0496115_0248799
1065 Ga0496116_0000505
1066 Ga0496116_0001225
1067 Ga0496116_0004222
1068 Ga0496116_0132179
1069 Ga0496117_0000004
1070 Ga0496117_0000212
1071 Ga0496117_0000853
1072 Ga0496118_0000024
1073 Ga0496118_0001266
1074 Ga0496118_0006001
1075 Ga0496118_0068562
1076 Ga0496119_0000043
1077 Ga0496119_0002495
1078 Ga0496119_0010644
1079 Ga0496119_0025982
1080 Ga0496119_0028934
1081 Ga0496120_0000009
1082 Ga0496120_0000429
1083 Ga0496120_0000703
1084 Ga0496120_0000985
1085 Ga0496120_0008048
1086 Ga0496121_0000131
1087 Ga0496122_0009940
1088 Ga0496122_0012371
1089 Ga0496122_0017202
1090 Ga0496123_0000651
1091 Ga0496123_0002672
1092 Ga0496123_0058563
1093 Ga0496124_0000156
1094 Ga0496124_0002368
1095 Ga0496124_0003823
1096 Ga0496124_0024262
1097 Ga0496124_0059370
1098 Ga0496124_0397621
1099 Ga0496125_0006757
1100 Ga0496126_0082390
1101 Ga0495678_000388
1102 Ga0495682_0000004
1103 Ga0501032_0258834
1104 Ga0501034_0000031
1105 Ga0501034_0704490
1106 Ga0501036_0139413
1107 Ga0501036_0213940
1108 Ga0501036_0498112
1109 Ga0501036_0865289
1110 Ga0501037_0031595
1111 Ga0501038_0033998
1112 Ga0501038_0644632
1113 Ga0501038_1081117
1114 Ga0501039_0051212
1115 Ga0501039_0322596
1116 Ga0501040_0159906
1117 Ga0501040_0327378
1118 Ga0501040_0407903
1119 Ga0501040_0416620
1120 Ga0501041_0006685
1121 Ga0501043_0047838
1122 Ga0501046_0000011
1123 Ga0501046_0002427
1124 Ga0501046_0017213
1125 Ga0501046_0326511
1126 Ga0501046_0506011
1127 Ga0501047_0001332
1128 Ga0501047_0022040
1129 Ga0501047_0169730
1130 Ga0501047_0260461
1131 Ga0501047_0291975
1132 Ga0501048_0000043
1133 Ga0501048_0015726
1134 Ga0501048_0095914
1135 Ga0501067_0002583
1136 Ga0501067_0038385
1137 Ga0501067_0357749
1138 Ga0501070_0048296
1139 Ga0501070_0112519
1140 Ga0501070_0379171
1141 Ga0501072_0299175
1142 Ga0501072_0837049
1143 Ga0501072_0851901
1144 Ga0501073_0105372
1145 Ga0501074_0008052
1146 Ga0501074_0463487
1147 Ga0501074_0749376
1148 Ga0501075_0524195
1149 Ga0501075_0772951
1150 Ga0501076_0269252
1151 Ga0501076_0317284
1152 Ga0501076_0364439
1153 Ga0501077_0099053
1154 Ga0501079_0006736
1155 Ga0501079_0032756
1156 Ga0501079_0100741
1157 Ga0501079_0123925
1158 Ga0501080_0000483
1159 Ga0501080_0241131
1160 Ga0501080_0320596
1161 Ga0501081_0031849
1162 Ga0501081_0424472
1163 Ga0501081_0540526
1164 Ga0501083_0119422
1165 Ga0501083_0228418
1166 Ga0501083_0465373
1167 Ga0501035_0001140
1168 Ga0501044_0000013
1169 Ga0501044_0038173
1170 Ga0501045_0018006
1171 Ga0501045_0075730
1172 Ga0501045_0085780
1173 Ga0501045_0487247
1174 Ga0501045_0801716
1175 nmdc:mga00v17_26552_c2
1176 nmdc:mga00v17_276087_c1
1177 nmdc:mga0yw44_151478_c1
1178 nmdc:mga0yw44_379663_c1
1179 nmdc:mga0k408_149556_c1
1180 nmdc:mga06z11_166589_c1
1181 nmdc:mga06z11_205813_c1
1182 nmdc:mga06z11_3745_c1
1183 nmdc:mga06z11_822_c1
1184 nmdc:mga04h51_27094_c1
1185 nmdc:mga07m45_102512_c1
1186 nmdc:mga05p37_143745_c1
1187 nmdc:mga05p37_1451430_c1
1188 nmdc:mga05p37_406567_c1
1189 nmdc:mga05p37_575767_c1
1190 nmdc:mga05p37_665137_c1
1191 nmdc:mga0qj67_11115_c1
1192 nmdc:mga0qj67_308746_c1
1193 nmdc:mga06r32_128874_c1
1194 nmdc:mga06r32_21542_c1
1195 nmdc:mga06r32_250143_c1
1196 nmdc:mga06r32_340973_c1
1197 nmdc:mga06r32_35095_c1
1198 nmdc:mga06r32_35458_c1
1199 nmdc:mga06r32_4262_c1
1200 nmdc:mga06r32_49234_c1
1201 nmdc:mga08y16_117740_c1
1202 nmdc:mga08y16_259241_c1
1203 nmdc:mga08y16_374842_c1
1204 nmdc:mga08y16_63275_c1
1205 nmdc:mga0n895_3199_c1
1206 nmdc:mga0n895_4319_c1
1207 nmdc:mga0n895_807155_c1
1208 nmdc:mga0rr50_43493_c1
1209 nmdc:mga0rr50_45494_c1
1210 nmdc:mga0rr50_465925_c1
1211 nmdc:mga08x19_322373_c1
1212 nmdc:mga0a205_194466_c1
1213 nmdc:mga0a205_382134_c1
1214 nmdc:mga0a205_88273_c1
1215 Ga0495655_0000667
1216 Ga0495619_0377573
1217 Ga0500562_031591
1218 Ga0500621_000001
1219 Ga0500616_0030262
1220 Ga0500616_0074472
1221 Ga0501084_0004253
1222 Ga0501084_0008080
1223 Ga0501084_0116231
1224 Ga0501084_0250925
1225 Ga0501082_0044436
1226 Ga0501082_0086367
1227 Ga0501082_0332555
1228 Ga0501082_0809568
1229 Ga0530510_0262907
1230 2511379391
1231 2511433846
1232 2599927109
1233 2608668540
1234 2650895545
1235 2686355759
1236 2809124658
1237 2844532023
1238 2847088719
1239 2847800874
1240 2865017600
1241 2876601260
1242 2881612228
1243 2896186061
1244 2908671255
1245 2919495749
1246 2919543388
1247 2923528456
1248 2939603020
1249 2945953959
1250 2978976443
1251 2984495627
1252 2990264322
1253 8016736880
1254 8019502089

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

64

200

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9031 2 167
4x45-assembly1.cif.gz_A crystal structure of f173g mutant of human aprt 0.8995 2 168
6fd6-assembly1.cif.gz_B crystal structure of human aprt-tyr105phe variant in complex with adenine, prpp and mg2+, 30 days post crystallization (with amp and ppi products fully generated) 0.8913 2 168
4m0k-assembly2.cif.gz_D crystal structure of adenine phosphoribosyltransferase from rhodothermus marinus dsm 4252, nysgrc target 029775. 0.8909 2 166
4x45-assembly1.cif.gz_A crystal structure of f173g mutant of human aprt 0.8895 2 168
ID Description Score Start End Superfamily
af_A0A1D6HD26_34_217_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8976 2 168 3.40.50.2020
af_A0A1D6HD26_34_217_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8877 2 168 3.40.50.2020
af_P9WQ07_33_212_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8848 4 166 3.40.50.2020
af_P12426_6_182_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8842 2 167 3.40.50.2020
af_P91455_5_184_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.883 2 167 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A1J4RLZ8-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9698 2 167 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-M4VZW3-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9642 3 167 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A2E7K0X0-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.9577 3 167 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A1J4RLZ8-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9529 2 167 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-M4VZW3-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9418 3 167 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209

Map