F470613

General Info

Members Datasets Scaffolds Average Seq Length
628 307 1256 343

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10186422|rootH1_101864222
Length 378
Sequence MHLWRKLTAVKGIFSVLSRLKLKHQQNLMPKTRIAGVGMYVPKNVITNADLMKHMDTTDEWIQQRTGIKERRYANREGETTTTMGVEAAKQAIENAGITKDDVDFIVFATLCPDYYFPGCGVLLQRAMQMKTIGALDIRNQCTGFIYALSVADQFIKTGMYKNILVVGSEKHSFALDFSTRGRTVSVMFGDGAGAVILQPTENEGEGILSTHLHADGNGAEALACYNPGSHANHWVKEKIAEYDDTDFYGQQFVSHSMIDNAQIFPSMDGNAVMKRAISFLPEVIGEALTQNNYTIDDLNMLILNQSNARIAEYVQQKLGLTDDEIYINIYRYGNTTAASIPIAMFEAMRDGKLKRGDLLCLAAYGSGFTWASALIRF

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
152 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
153 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
170 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
171 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
175 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
176 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
177 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
178 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
179 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
180 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
181 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
188 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
202 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
249 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
257 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
258 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
259 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
260 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
263 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
264 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
265 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
266 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
267 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
268 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
269 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
270 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
271 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
272 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
273 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
274 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
275 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
276 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
277 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
278 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
279 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
280 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
281 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
282 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
283 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
284 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
285 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
286 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
287 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
288 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
289 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
290 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
291 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
292 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
293 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
294 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
295 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
296 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
297 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
298 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
299 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
300 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
301 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
302 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
303 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
304 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
305 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
306 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
307 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.68
Metatranscriptomes 0
Isolates 7.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 1.91
Nodule 0.16
Rhizoplane 1.43
Rhizosphere 88.54
Stem 0
Stem Tuber 0
Unclassified 4.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10186422 3300003316 Bacteria 1507
2 JGI24741J21665_1004093 3300001915 Bacteria 3307
3 JGI24740J21852_10004256 3300001979 Bacteria 6167
4 JGI25406J46586_10003794 3300003203 Bacteria 7068
5 rootL2_10119958 3300003322 Bacteria 5696
6 rootL2_10193522 3300003322 Bacteria 3688
7 rootH1_10026469 3300003323 Bacteria 22797
8 JGI25160J50197_1000912 3300003354 Bacteria 15528
9 Ga0065714_10070919 3300005288 Bacteria 3728
10 Ga0065714_10104632 3300005288 Bacteria 1581
11 Ga0065704_10074654 3300005289 Bacteria 6109
12 Ga0065704_10089097 3300005289 Bacteria 2886
13 Ga0065712_10142849 3300005290 Bacteria 1434
14 Ga0065712_10161806 3300005290 Bacteria 1297
15 Ga0065715_10234060 3300005293 Unclassified 1223
16 Ga0065715_10249922 3300005293 Bacteria 1170
17 Ga0065707_10008827 3300005295 Unclassified 2828
18 Ga0070676_10005217 3300005328 Bacteria 6907
19 Ga0070676_10020770 3300005328 Bacteria 3671
20 Ga0070676_10105200 3300005328 Bacteria 1750
21 Ga0070683_100003599 3300005329 Bacteria 12623
22 Ga0070683_100125605 3300005329 Unclassified 2425
23 Ga0070683_100131378 3300005329 Bacteria 2369
24 Ga0070690_100097891 3300005330 Bacteria 1941
25 Ga0070690_100114118 3300005330 Bacteria 1806
26 Ga0070670_100012714 3300005331 Bacteria 7203
27 Ga0070670_100052599 3300005331 Bacteria 3497
28 Ga0070670_100071585 3300005331 Bacteria 2977
29 Ga0070670_100093511 3300005331 Bacteria 2586
30 Ga0070670_100103297 3300005331 Unclassified 2455
31 Ga0070670_100278242 3300005331 Bacteria 1461
32 Ga0068869_100004070 3300005334 Bacteria 9050
33 Ga0068869_100035028 3300005334 Bacteria 3556
34 Ga0068869_100053181 3300005334 Bacteria 2943
35 Ga0068869_100072689 3300005334 Bacteria 2548
36 Ga0068869_100082031 3300005334 Bacteria 2409
37 Ga0068869_100087617 3300005334 Bacteria 2336
38 Ga0068869_100092239 3300005334 Unclassified 2280
39 Ga0070666_10000064 3300005335 Bacteria 79823
40 Ga0070666_10025660 3300005335 Bacteria 3843
41 Ga0070666_10065042 3300005335 Bacteria 2474
42 Ga0070666_10319829 3300005335 Bacteria 1107
43 Ga0070682_100000041 3300005337 Bacteria 142152
44 Ga0070682_100000251 3300005337 Bacteria 38982
45 Ga0068868_100010337 3300005338 Bacteria 6749
46 Ga0068868_100011564 3300005338 Bacteria 6428
47 Ga0068868_100232903 3300005338 Bacteria 1545
48 Ga0070660_100359929 3300005339 Bacteria 1199
49 Ga0070689_100004075 3300005340 Bacteria 9839
50 Ga0070689_100013479 3300005340 Bacteria 5916
51 Ga0070689_100021838 3300005340 Bacteria 4771
52 Ga0070689_100310830 3300005340 Bacteria 1314
53 Ga0070661_100018669 3300005344 Bacteria 4934
54 Ga0070668_100029119 3300005347 Bacteria 4193
55 Ga0070668_100031692 3300005347 Bacteria 4022
56 Ga0070668_100335636 3300005347 Bacteria 1276
57 Ga0070669_100012514 3300005353 Bacteria 6019
58 Ga0070669_100114533 3300005353 Bacteria 2050
59 Ga0070675_100019691 3300005354 Bacteria 5380
60 Ga0070675_100029134 3300005354 Bacteria 4450
61 Ga0070675_100032856 3300005354 Unclassified 4201
62 Ga0070675_100220146 3300005354 Bacteria 1653
63 Ga0070675_100464775 3300005354 Bacteria 1136
64 Ga0070671_100039379 3300005355 Bacteria 3923
65 Ga0070671_100041838 3300005355 Bacteria 3808
66 Ga0070671_100113096 3300005355 Bacteria 2281
67 Ga0070671_100274956 3300005355 Bacteria 1432
68 Ga0070674_100020055 3300005356 Bacteria 4261
69 Ga0070674_100050388 3300005356 Bacteria 2866
70 Ga0070674_100054635 3300005356 Bacteria 2763
71 Ga0070674_100126299 3300005356 Bacteria 1900
72 Ga0070673_100059631 3300005364 Bacteria 3022
73 Ga0070659_100133308 3300005366 Bacteria 2019
74 Ga0070667_100007241 3300005367 Bacteria 9217
75 Ga0070667_100011918 3300005367 Bacteria 7194
76 Ga0070667_100020250 3300005367 Bacteria 5523
77 Ga0070667_100120411 3300005367 Bacteria 2282
78 Ga0070701_10021013 3300005438 Bacteria 3109
79 Ga0070705_100095925 3300005440 Bacteria 1861
80 Ga0070705_100298513 3300005440 Unclassified 1153
81 Ga0070700_100208317 3300005441 Bacteria 1378
82 Ga0070678_100033638 3300005456 Bacteria 3561
83 Ga0070662_100020905 3300005457 Bacteria 4464
84 Ga0070662_100025032 3300005457 Bacteria 4118
85 Ga0070662_100048568 3300005457 Unclassified 3057
86 Ga0070662_100384142 3300005457 Bacteria 1156
87 Ga0068867_100026168 3300005459 Bacteria 4188
88 Ga0068867_100036762 3300005459 Bacteria 3556
89 Ga0068867_100144633 3300005459 Bacteria 1862
90 Ga0068867_100365196 3300005459 Bacteria 1208
91 Ga0070685_10201849 3300005466 Bacteria 1293
92 Ga0070706_100067646 3300005467 Bacteria 3304
93 Ga0070684_100005000 3300005535 Bacteria 10126
94 Ga0070684_100011331 3300005535 Bacteria 7100
95 Ga0070684_100236707 3300005535 Bacteria 1668
96 Ga0070684_100319154 3300005535 Bacteria 1427
97 Ga0068853_100002818 3300005539 Bacteria 13167
98 Ga0068853_100009011 3300005539 Bacteria 8037
99 Ga0068853_100011823 3300005539 Bacteria 7097
100 Ga0068853_100180780 3300005539 Bacteria 1913
101 Ga0068853_100202069 3300005539 Bacteria 1809
102 Ga0070672_100089614 3300005543 Bacteria 2479
103 Ga0070672_100188953 3300005543 Bacteria 1719
104 Ga0070672_100236358 3300005543 Bacteria 1536
105 Ga0070672_100261775 3300005543 Bacteria 1459
106 Ga0070672_100323579 3300005543 Bacteria 1311
107 Ga0070686_100026141 3300005544 Bacteria 3520
108 Ga0070693_100121378 3300005547 Unclassified 1621
109 Ga0070665_100047753 3300005548 Bacteria 4296
110 Ga0070665_100077931 3300005548 Bacteria 3320
111 Ga0070665_100155308 3300005548 Unclassified 2290
112 Ga0070665_100188615 3300005548 Bacteria 2063
113 Ga0070664_100009001 3300005564 Bacteria 8098
114 Ga0070664_100098480 3300005564 Bacteria 2540
115 Ga0070664_100373746 3300005564 Bacteria 1300
116 Ga0068857_100019122 3300005577 Bacteria 6012
117 Ga0068857_100285067 3300005577 Bacteria 1520
118 Ga0070702_100148723 3300005615 Bacteria 1501
119 Ga0070702_100190394 3300005615 Bacteria 1349
120 Ga0068852_100080977 3300005616 Bacteria 2881
121 Ga0068852_100188185 3300005616 Bacteria 1946
122 Ga0068852_100196414 3300005616 Bacteria 1907
123 Ga0068859_100000003 3300005617 Bacteria 479218
124 Ga0068859_100000872 3300005617 Bacteria 30780
125 Ga0068859_100025447 3300005617 Bacteria 5936
126 Ga0068859_100031440 3300005617 Bacteria 5332
127 Ga0068859_100063757 3300005617 Bacteria 3716
128 Ga0068859_100076736 3300005617 Bacteria 3382
129 Ga0068859_100368761 3300005617 Unclassified 1531
130 Ga0068859_100634962 3300005617 Bacteria 1160
131 Ga0068864_100002531 3300005618 Bacteria 15099
132 Ga0068864_100007444 3300005618 Bacteria 9016
133 Ga0068864_100051658 3300005618 Unclassified 3542
134 Ga0068864_100084464 3300005618 Bacteria 2790
135 Ga0068864_100258057 3300005618 Bacteria 1620
136 Ga0068866_10020328 3300005718 Bacteria 3040
137 Ga0068866_10046772 3300005718 Bacteria 2178
138 Ga0068861_100005990 3300005719 Bacteria 8263
139 Ga0068861_100019977 3300005719 Bacteria 4790
140 Ga0068861_100102988 3300005719 Bacteria 2274
141 Ga0068851_10000117 3300005834 Bacteria 42529
142 Ga0068851_10009566 3300005834 Bacteria 4512
143 Ga0068851_10072811 3300005834 Bacteria 1781
144 Ga0068870_10046317 3300005840 Bacteria 2280
145 Ga0068863_100005585 3300005841 Bacteria 12361
146 Ga0068863_100014768 3300005841 Bacteria 7512
147 Ga0068863_100255115 3300005841 Bacteria 1695
148 Ga0068858_100020164 3300005842 Bacteria 6234
149 Ga0068858_100086152 3300005842 Bacteria 2922
150 Ga0068858_100305125 3300005842 Bacteria 1519
151 Ga0068858_100398721 3300005842 Bacteria 1322
152 Ga0068860_100001759 3300005843 Bacteria 23117
153 Ga0068860_100003400 3300005843 Bacteria 16366
154 Ga0068860_100013798 3300005843 Bacteria 7922
155 Ga0068860_100054400 3300005843 Bacteria 3805
156 Ga0068860_100312149 3300005843 Bacteria 1542
157 Ga0068862_100164046 3300005844 Bacteria 1985
158 Ga0068862_100168728 3300005844 Bacteria 1958
159 Ga0068862_100230173 3300005844 Bacteria 1681
160 Ga0068862_100550710 3300005844 Unclassified 1101
161 Ga0081539_10000382 3300005985 Bacteria 96235
162 Ga0075366_10013250 3300006195 Bacteria 4689
163 Ga0075366_10033313 3300006195 Bacteria 3034
164 Ga0097621_100000109 3300006237 Bacteria 46477
165 Ga0097621_100031989 3300006237 Bacteria 4179
166 Ga0097621_100041789 3300006237 Bacteria 3692
167 Ga0097621_100062609 3300006237 Bacteria 3055
168 Ga0068871_100001161 3300006358 Bacteria 17698
169 Ga0068871_100029457 3300006358 Bacteria 4312
170 Ga0068871_100085698 3300006358 Bacteria 2617
171 Ga0068871_100089275 3300006358 Bacteria 2565
172 Ga0068871_100254411 3300006358 Bacteria 1531
173 Ga0068871_100271456 3300006358 Bacteria 1482
174 Ga0068865_100037684 3300006881 Bacteria 3267
175 Ga0068865_100059763 3300006881 Bacteria 2667
176 Ga0068865_100089827 3300006881 Unclassified 2226
177 Ga0068865_100109653 3300006881 Bacteria 2034
178 Ga0068865_100133353 3300006881 Bacteria 1863
179 Ga0097620_100000003 3300006931 Bacteria 479218
180 Ga0097620_100000872 3300006931 Bacteria 30780
181 Ga0097620_100025447 3300006931 Bacteria 5936
182 Ga0097620_100031439 3300006931 Bacteria 5332
183 Ga0097620_100063758 3300006931 Bacteria 3716
184 Ga0097620_100076731 3300006931 Bacteria 3382
185 Ga0097620_100368791 3300006931 Unclassified 1531
186 Ga0097620_100635014 3300006931 Bacteria 1160
187 Ga0075435_100008606 3300007076 Bacteria 7332
188 Ga0105244_10000102 3300009036 Bacteria 88074
189 Ga0111539_10027777 3300009094 Bacteria 6911
190 Ga0111539_10130528 3300009094 Bacteria 2942
191 Ga0105245_10196362 3300009098 Bacteria 1936
192 Ga0105245_10400620 3300009098 Bacteria 1371
193 Ga0105247_10001414 3300009101 Bacteria 17416
194 Ga0105247_10100105 3300009101 Bacteria 1852
195 Ga0114129_10000574 3300009147 Bacteria 45251
196 Ga0105243_10000696 3300009148 Bacteria 32612
197 Ga0105243_10234757 3300009148 Bacteria 1629
198 Ga0105241_10001052 3300009174 Bacteria 21045
199 Ga0105242_10062366 3300009176 Bacteria 3067
200 Ga0105242_10117909 3300009176 Bacteria 2273
201 Ga0105242_10119081 3300009176 Bacteria 2263
202 Ga0105248_10002485 3300009177 Bacteria 20490
203 Ga0105248_10050131 3300009177 Bacteria 4682
204 Ga0105248_10747535 3300009177 Bacteria 1103
205 Ga0105237_10001093 3300009545 Bacteria 36314
206 Ga0105237_10014135 3300009545 Bacteria 8354
207 Ga0105249_10001422 3300009553 Bacteria 20964
208 Ga0105249_10006153 3300009553 Bacteria 10409
209 Ga0105249_10007824 3300009553 Bacteria 9307
210 Ga0105249_10019463 3300009553 Bacteria 6057
211 Ga0105249_10067192 3300009553 Bacteria 3302
212 Ga0105249_10089134 3300009553 Bacteria 2882
213 Ga0105249_10123093 3300009553 Bacteria 2467
214 Ga0105249_10145419 3300009553 Bacteria 2277
215 Ga0105249_10153165 3300009553 Bacteria 2221
216 Ga0105249_10343967 3300009553 Bacteria 1509
217 Ga0105249_10359277 3300009553 Bacteria 1477
218 Ga0105239_10009054 3300010375 Bacteria 11265
219 Ga0157373_10006620 3300013100 Bacteria 8643
220 Ga0157371_10000012 3300013102 Bacteria 355318
221 Ga0157371_10059129 3300013102 Bacteria 2718
222 Ga0157371_10061101 3300013102 Bacteria 2671
223 Ga0157370_10001425 3300013104 Bacteria 29663
224 Ga0157370_10009609 3300013104 Bacteria 10296
225 Ga0157370_10018285 3300013104 Bacteria 7051
226 Ga0157370_10022602 3300013104 Bacteria 6257
227 Ga0157370_10157037 3300013104 Bacteria 2116
228 Ga0157369_10006875 3300013105 Bacteria 13126
229 Ga0157369_10106570 3300013105 Bacteria 2983
230 Ga0157369_10132895 3300013105 Bacteria 2636
231 Ga0157369_10133731 3300013105 Bacteria 2627
232 Ga0157374_10006069 3300013296 Bacteria 10225
233 Ga0157374_10120046 3300013296 Bacteria 2536
234 Ga0157378_10004040 3300013297 Bacteria 12957
235 Ga0157378_10011276 3300013297 Bacteria 7821
236 Ga0157378_10046321 3300013297 Bacteria 3866
237 Ga0157378_10070515 3300013297 Bacteria 3138
238 Ga0157378_10087183 3300013297 Bacteria 2831
239 Ga0157378_10114246 3300013297 Bacteria 2480
240 Ga0157378_10182727 3300013297 Bacteria 1974
241 Ga0163162_10000579 3300013306 Bacteria 33893
242 Ga0163162_10001945 3300013306 Bacteria 19409
243 Ga0163162_10002569 3300013306 Bacteria 17179
244 Ga0163162_10002730 3300013306 Bacteria 16751
245 Ga0163162_10003086 3300013306 Bacteria 15916
246 Ga0163162_10021490 3300013306 Bacteria 6357
247 Ga0163162_10134788 3300013306 Bacteria 2580
248 Ga0157372_10021078 3300013307 Bacteria 7038
249 Ga0157375_10002298 3300013308 Bacteria 16512
250 Ga0157375_10002648 3300013308 Bacteria 15501
251 Ga0157375_10008218 3300013308 Bacteria 9133
252 Ga0157375_10032503 3300013308 Bacteria 4950
253 Ga0157375_10051436 3300013308 Bacteria 4046
254 Ga0157375_10055248 3300013308 Bacteria 3915
255 Ga0157375_10106132 3300013308 Bacteria 2900
256 Ga0157375_10119101 3300013308 Bacteria 2747
257 Ga0157375_10180129 3300013308 Bacteria 2264
258 Ga0157375_10263489 3300013308 Bacteria 1885
259 Ga0157375_10497121 3300013308 Bacteria 1384
260 Ga0163163_10000401 3300014325 Bacteria 40925
261 Ga0163163_10014243 3300014325 Bacteria 7308
262 Ga0163163_10086851 3300014325 Bacteria 3137
263 Ga0163163_10155766 3300014325 Unclassified 2329
264 Ga0163163_10203770 3300014325 Bacteria 2027
265 Ga0157380_10000248 3300014326 Bacteria 32510
266 Ga0157380_10002215 3300014326 Bacteria 13073
267 Ga0157380_10010366 3300014326 Bacteria 6703
268 Ga0157380_10015227 3300014326 Bacteria 5646
269 Ga0182008_10000684 3300014497 Bacteria 24468
270 Ga0182008_10029635 3300014497 Bacteria 2764
271 Ga0157377_10003418 3300014745 Bacteria 7184
272 Ga0157377_10136180 3300014745 Bacteria 1505
273 Ga0157379_10053413 3300014968 Bacteria 3609
274 Ga0157379_10095212 3300014968 Bacteria 2672
275 Ga0157376_10006244 3300014969 Bacteria 8399
276 Ga0157376_10006909 3300014969 Bacteria 8041
277 Ga0157376_10030234 3300014969 Bacteria 4323
278 Ga0157376_10036517 3300014969 Bacteria 3982
279 Ga0157376_10132525 3300014969 Bacteria 2226
280 Ga0182006_1000016 3300015261 Bacteria 303558
281 Ga0163161_10001723 3300017792 Bacteria 16029
282 Ga0163161_10001778 3300017792 Bacteria 15708
283 Ga0163161_10003553 3300017792 Bacteria 10912
284 Ga0163161_10005845 3300017792 Bacteria 8527
285 Ga0163161_10183104 3300017792 Bacteria 1607
286 Ga0213876_10006872 3300021384 Bacteria 6202
287 Ga0209675_1000103 3300025291 Bacteria 121526
288 Ga0207426_1000040 3300025302 Bacteria 433920
289 Ga0207656_10000167 3300025321 Bacteria 24201
290 Ga0207655_1000013 3300025728 Bacteria 637510
291 Ga0207682_10065031 3300025893 Bacteria 1534
292 Ga0207642_10031154 3300025899 Bacteria 2230
293 Ga0207642_10055197 3300025899 Bacteria 1816
294 Ga0207710_10000837 3300025900 Bacteria 16584
295 Ga0207710_10057035 3300025900 Bacteria 1763
296 Ga0207688_10004997 3300025901 Bacteria 7216
297 Ga0207688_10138920 3300025901 Bacteria 1429
298 Ga0207680_10000054 3300025903 Bacteria 54305
299 Ga0207680_10048983 3300025903 Bacteria 2512
300 Ga0207680_10145462 3300025903 Bacteria 1575
301 Ga0207680_10232712 3300025903 Bacteria 1267
302 Ga0207647_10005536 3300025904 Bacteria 9246
303 Ga0207645_10000748 3300025907 Bacteria 27039
304 Ga0207645_10017210 3300025907 Bacteria 4775
305 Ga0207645_10138872 3300025907 Bacteria 1583
306 Ga0207643_10007164 3300025908 Bacteria 5984
307 Ga0207643_10020201 3300025908 Unclassified 3654
308 Ga0207643_10142064 3300025908 Bacteria 1434
309 Ga0207654_10004259 3300025911 Bacteria 7218
310 Ga0207671_10001498 3300025914 Bacteria 26937
311 Ga0207662_10172879 3300025918 Bacteria 1386
312 Ga0207657_10050681 3300025919 Bacteria 3612
313 Ga0207657_10261355 3300025919 Bacteria 1378
314 Ga0207649_10046440 3300025920 Bacteria 2668
315 Ga0207681_10082001 3300025923 Bacteria 2279
316 Ga0207650_10030339 3300025925 Bacteria 3893
317 Ga0207650_10030710 3300025925 Bacteria 3873
318 Ga0207650_10320992 3300025925 Bacteria 1268
319 Ga0207659_10108318 3300025926 Bacteria 2107
320 Ga0207659_10316259 3300025926 Bacteria 1287
321 Ga0207687_10109681 3300025927 Bacteria 2045
322 Ga0207644_10035729 3300025931 Bacteria 3484
323 Ga0207644_10118440 3300025931 Bacteria 2012
324 Ga0207706_10026986 3300025933 Bacteria 5138
325 Ga0207706_10027760 3300025933 Bacteria 5059
326 Ga0207706_10280721 3300025933 Bacteria 1453
327 Ga0207686_10090031 3300025934 Bacteria 2023
328 Ga0207686_10187235 3300025934 Bacteria 1473
329 Ga0207686_10218904 3300025934 Bacteria 1373
330 Ga0207709_10000890 3300025935 Bacteria 22592
331 Ga0207670_10077894 3300025936 Bacteria 2310
332 Ga0207670_10259276 3300025936 Bacteria 1347
333 Ga0207669_10011006 3300025937 Bacteria 4380
334 Ga0207669_10237750 3300025937 Bacteria 1348
335 Ga0207704_10175133 3300025938 Bacteria 1544
336 Ga0207691_10073268 3300025940 Unclassified 3089
337 Ga0207691_10092122 3300025940 Bacteria 2714
338 Ga0207689_10000337 3300025942 Bacteria 43636
339 Ga0207689_10000628 3300025942 Bacteria 33617
340 Ga0207689_10003117 3300025942 Bacteria 15212
341 Ga0207689_10013936 3300025942 Bacteria 6848
342 Ga0207689_10020993 3300025942 Bacteria 5488
343 Ga0207689_10026700 3300025942 Bacteria 4837
344 Ga0207661_10004869 3300025944 Bacteria 9409
345 Ga0207679_10002211 3300025945 Bacteria 12015
346 Ga0207679_10040287 3300025945 Bacteria 3343
347 Ga0207679_10328064 3300025945 Bacteria 1327
348 Ga0207651_10028429 3300025960 Unclassified 3527
349 Ga0207651_10169559 3300025960 Bacteria 1720
350 Ga0207651_10198091 3300025960 Bacteria 1607
351 Ga0207712_10000844 3300025961 Bacteria 22396
352 Ga0207712_10027942 3300025961 Bacteria 3770
353 Ga0207712_10039063 3300025961 Bacteria 3250
354 Ga0207712_10089354 3300025961 Bacteria 2265
355 Ga0207712_10089998 3300025961 Bacteria 2257
356 Ga0207712_10139329 3300025961 Bacteria 1859
357 Ga0207668_10193006 3300025972 Bacteria 1615
358 Ga0207668_10306227 3300025972 Bacteria 1313
359 Ga0207668_10398381 3300025972 Bacteria 1163
360 Ga0207640_10102757 3300025981 Bacteria 2008
361 Ga0207658_10010834 3300025986 Bacteria 6204
362 Ga0207658_10013795 3300025986 Bacteria 5527
363 Ga0207658_10022800 3300025986 Bacteria 4361
364 Ga0207658_10067462 3300025986 Bacteria 2695
365 Ga0207677_10001734 3300026023 Bacteria 11568
366 Ga0207677_10008694 3300026023 Bacteria 5686
367 Ga0207677_10073019 3300026023 Bacteria 2428
368 Ga0207703_10005580 3300026035 Bacteria 10099
369 Ga0207703_10346495 3300026035 Bacteria 1367
370 Ga0207703_10378414 3300026035 Bacteria 1309
371 Ga0207639_10002203 3300026041 Bacteria 13125
372 Ga0207639_10018417 3300026041 Bacteria 4961
373 Ga0207641_10000026 3300026088 Bacteria 245091
374 Ga0207641_10043818 3300026088 Bacteria 3760
375 Ga0207641_10111360 3300026088 Bacteria 2427
376 Ga0207648_10000372 3300026089 Bacteria 49262
377 Ga0207648_10018970 3300026089 Bacteria 6211
378 Ga0207648_10021307 3300026089 Bacteria 5826
379 Ga0207648_10061633 3300026089 Bacteria 3271
380 Ga0207648_10159417 3300026089 Bacteria 1993
381 Ga0207648_10167029 3300026089 Bacteria 1945
382 Ga0207648_10212140 3300026089 Bacteria 1719
383 Ga0207648_10344972 3300026089 Unclassified 1342
384 Ga0207676_10004513 3300026095 Bacteria 9845
385 Ga0207676_10030348 3300026095 Bacteria 4057
386 Ga0207676_10038905 3300026095 Unclassified 3634
387 Ga0207674_10006730 3300026116 Bacteria 13496
388 Ga0207674_10010951 3300026116 Bacteria 10207
389 Ga0207674_10108465 3300026116 Bacteria 2753
390 Ga0207675_100001072 3300026118 Bacteria 27156
391 Ga0207675_100022028 3300026118 Bacteria 5931
392 Ga0207675_100042016 3300026118 Bacteria 4268
393 Ga0207683_10001617 3300026121 Bacteria 20205
394 Ga0207683_10044988 3300026121 Bacteria 3860
395 Ga0207683_10314105 3300026121 Bacteria 1435
396 Ga0207698_10126863 3300026142 Bacteria 2172
397 Ga0207698_10221127 3300026142 Bacteria 1711
398 Ga0207698_10276042 3300026142 Bacteria 1552
399 Ga0268265_10089490 3300028380 Bacteria 2456
400 Ga0268265_10188192 3300028380 Bacteria 1780
401 Ga0268264_10008138 3300028381 Bacteria 8716
402 Ga0268264_10018301 3300028381 Bacteria 5729
403 Ga0268264_10022974 3300028381 Bacteria 5089
404 Ga0268264_10029070 3300028381 Bacteria 4525
405 Ga0268264_10206013 3300028381 Bacteria 1802
406 Ga0307515_10000001 3300028794 Bacteria 4259510
407 Ga0307515_10007482 3300028794 Bacteria 21576
408 Ga0265327_10000013 3300031251 Bacteria 519549
409 Ga0265327_10024131 3300031251 Bacteria 3581
410 Ga0265316_10247439 3300031344 Bacteria 1310
411 Ga0307513_10117217 3300031456 Bacteria 2641
412 Ga0265313_10040303 3300031595 Unclassified 2310
413 Ga0316576_10136673 3300031727 Bacteria 1845
414 Ga0316578_10023882 3300031728 Unclassified 3425
415 Ga0316577_10001749 3300031733 Bacteria 10456
416 Ga0316577_10004637 3300031733 Bacteria 7126
417 Ga0316577_10005128 3300031733 Bacteria 6842
418 Ga0307410_10030360 3300031852 Unclassified 3454
419 Ga0307412_10000184 3300031911 Bacteria 43850
420 Ga0307412_10000551 3300031911 Bacteria 22305
421 Ga0307416_100000051 3300032002 Bacteria 115585
422 Ga0307414_10000004 3300032004 Bacteria 472218
423 Ga0307414_10031638 3300032004 Bacteria 3474
424 Ga0307414_10046132 3300032004 Bacteria 2989
425 Ga0307414_10061410 3300032004 Bacteria 2662
426 Ga0307414_10254299 3300032004 Bacteria 1462
427 Ga0307414_10254542 3300032004 Bacteria 1461
428 Ga0373926_0007855 3300035083 Bacteria 3555
429 Ga0373934_0009251 3300035086 Bacteria 3688
430 Ga0373949_0036333 3300035090 Bacteria 1195
431 Ga0373955_0004601 3300035172 Bacteria 6115
432 Ga0316574_0010391 3300035398 Bacteria 5260
433 Ga0316574_0192067 3300035398 Bacteria 1313
434 Ga0373924_0005807 3300035410 Bacteria 4392
435 Ga0373924_0095716 3300035410 Bacteria 1274
436 Ga0373931_0028110 3300035691 Unclassified 2876
437 Ga0373933_0015285 3300035724 Bacteria 4279
438 Ga0373937_0002667 3300036401 Bacteria 14878
439 Ga0316584_0029981 3300036712 Unclassified 4018
440 Ga0316584_0044470 3300036712 Unclassified 3311
441 Ga0373925_0193972 3300037068 Bacteria 1613
442 Ga0316581_0009138 3300037588 Bacteria 2716
443 Ga0400484_17565 3300038725 Bacteria 1567
444 Ga0400484_33210 3300038725 Bacteria 2026
445 Ga0400484_36796 3300038725 Bacteria 3069
446 Ga0400483_006822 3300039062 Bacteria 2957
447 Ga0400483_029114 3300039062 Bacteria 2070
448 Ga0400483_088593 3300039062 Bacteria 2443
449 Ga0400483_101201 3300039062 Bacteria 3778
450 Ga0400483_288640 3300039062 Bacteria 2955
451 Ga0436365_1656319 3300039437 Bacteria 11225
452 Ga0436361_0751163 3300039447 Bacteria 1428
453 Ga0451789_1247108 3300041443 Bacteria 1537
454 Ga0451837_0890985 3300041494 Bacteria 5266
455 Ga0439431_0042817 3300041997 Bacteria 1157
456 Ga0439445_0000535 3300042004 Bacteria 7678
457 Ga0439454_000970 3300042011 Bacteria 2564
458 Ga0450898_002007 3300042134 Bacteria 2788
459 Ga0450899_005788 3300042135 Bacteria 1331
460 Ga0450904_006452 3300042139 Bacteria 1170
461 Ga0451577_0044831 3300042876 Bacteria 3958
462 Ga0451577_0072954 3300042876 Bacteria 3063
463 Ga0466972_0000146 3300044658 Bacteria 57580
464 Ga0453683_0000438 3300044673 Bacteria 47738
465 Ga0453683_0116159 3300044673 Bacteria 1684
466 Ga0453683_0169626 3300044673 Bacteria 1382
467 Ga0453684_0003280 3300044712 Bacteria 36908
468 Ga0453684_0021278 3300044712 Bacteria 9703
469 Ga0453684_0022637 3300044712 Bacteria 9311
470 Ga0453684_0179910 3300044712 Bacteria 2483
471 Ga0466970_0000169 3300044765 Bacteria 31008
472 Ga0495627_000002 3300046453 Bacteria 903861
473 Ga0495627_021367 3300046453 Bacteria 2147
474 Ga0495590_0007763 3300046457 Bacteria 4118
475 Ga0495638_0163379 3300046460 Bacteria 1283
476 Ga0495580_0061854 3300046472 Bacteria 2628
477 Ga0495594_0145457 3300046499 Bacteria 1345
478 Ga0495596_0001340 3300046500 Bacteria 14167
479 Ga0495606_0022518 3300046507 Bacteria 4588
480 Ga0495606_0068657 3300046507 Bacteria 2242
481 Ga0495608_0104404 3300046511 Bacteria 1825
482 Ga0495610_0000009 3300046512 Bacteria 554843
483 Ga0495630_0008167 3300046517 Bacteria 7518
484 Ga0495632_0001733 3300046519 Bacteria 17686
485 Ga0495643_0042896 3300046522 Bacteria 2463
486 Ga0495643_0066223 3300046522 Bacteria 1906
487 Ga0495643_0138771 3300046522 Bacteria 1214
488 Ga0495663_0000065 3300046525 Bacteria 49401
489 Ga0495652_0087187 3300046529 Bacteria 2561
490 Ga0495654_0000056 3300046530 Bacteria 140658
491 Ga0495609_0000063 3300046538 Bacteria 135584
492 Ga0495633_0000003 3300046558 Bacteria 472476
493 Ga0495633_0000805 3300046558 Bacteria 27889
494 Ga0495656_0007055 3300046615 Bacteria 3960
495 Ga0495668_0000023 3300046616 Bacteria 363848
496 Ga0495668_0002875 3300046616 Bacteria 13651
497 Ga0495625_0000560 3300046660 Bacteria 54525
498 Ga0495635_0264309 3300046663 Bacteria 1158
499 Ga0495649_0000619 3300046694 Bacteria 29384
500 Ga0495604_0048545 3300047317 Bacteria 3302
501 Ga0495674_0264110 3300047319 Bacteria 1414
502 Ga0495672_0028614 3300047320 Bacteria 3522
503 Ga0495680_0110530 3300047322 Bacteria 2037
504 Ga0495684_0029757 3300047471 Bacteria 4191
505 Ga0495686_0000144 3300047472 Bacteria 142704
506 Ga0495686_0005176 3300047472 Bacteria 10383
507 Ga0495686_0048335 3300047472 Bacteria 2683
508 Ga0496100_0355515 3300048903 Unclassified 1107
509 Ga0496101_0059649 3300048904 Bacteria 2766
510 Ga0496102_0046632 3300048905 Bacteria 3936
511 Ga0496110_0134416 3300048913 Bacteria 2235
512 Ga0496110_0427817 3300048913 Bacteria 1207
513 Ga0496111_0050742 3300048914 Bacteria 2994
514 Ga0496113_0248729 3300048916 Bacteria 1419
515 Ga0496114_0195320 3300048917 Bacteria 1771
516 Ga0496116_0000006 3300048919 Bacteria 811937
517 Ga0496117_0000491 3300048920 Bacteria 65366
518 Ga0496118_0000543 3300048921 Bacteria 62008
519 Ga0496119_0000379 3300048922 Bacteria 61360
520 Ga0496122_0000334 3300048925 Bacteria 102325
521 Ga0496122_0000486 3300048925 Bacteria 82431
522 Ga0496122_0000775 3300048925 Bacteria 61542
523 Ga0496122_0001546 3300048925 Bacteria 36521
524 Ga0496122_0002699 3300048925 Bacteria 24684
525 Ga0496123_0001808 3300048926 Bacteria 28164
526 Ga0496123_0002784 3300048926 Bacteria 20812
527 Ga0496123_0039971 3300048926 Bacteria 3274
528 Ga0496123_0047124 3300048926 Bacteria 2916
529 Ga0496124_0010448 3300048927 Bacteria 9396
530 Ga0496124_0075338 3300048927 Bacteria 2788
531 Ga0496125_0001284 3300048928 Bacteria 37298
532 Ga0496125_0002600 3300048928 Bacteria 23176
533 Ga0496126_0001645 3300048929 Bacteria 33724
534 Ga0501032_0030572 3300049569 Bacteria 3696
535 Ga0501034_0000152 3300049571 Bacteria 130576
536 Ga0501034_0003578 3300049571 Bacteria 17643
537 Ga0501034_0099189 3300049571 Bacteria 2908
538 Ga0501034_0145959 3300049571 Bacteria 2343
539 Ga0501034_0279316 3300049571 Bacteria 1610
540 Ga0501037_0004609 3300049573 Bacteria 10016
541 Ga0501037_0465259 3300049573 Bacteria 861
542 Ga0501038_0077080 3300049574 Bacteria 2815
543 Ga0501038_0122053 3300049574 Bacteria 2147
544 Ga0501039_0104660 3300049575 Bacteria 2209
545 Ga0501040_0100245 3300049576 Bacteria 2019
546 Ga0501043_0355626 3300049579 Bacteria 1112
547 Ga0501047_0020753 3300049581 Bacteria 6310
548 Ga0501047_0160990 3300049581 Bacteria 2116
549 Ga0501067_0003375 3300049583 Bacteria 8778
550 Ga0501067_0040932 3300049583 Bacteria 2574
551 Ga0501067_0042141 3300049583 Bacteria 2534
552 Ga0501068_0219572 3300049584 Bacteria 1208
553 Ga0501070_0040124 3300049586 Bacteria 3904
554 Ga0501073_0028030 3300049589 Bacteria 4023
555 Ga0501073_0253066 3300049589 Bacteria 1216
556 Ga0501073_0262148 3300049589 Bacteria 1193
557 Ga0501074_0082340 3300049590 Bacteria 2308
558 Ga0501077_0061912 3300049593 Bacteria 2375
559 Ga0501219_000281 3300049703 Bacteria 9039
560 Ga0501080_0144694 3300049742 Bacteria 2197
561 Ga0501080_0197699 3300049742 Bacteria 1846
562 Ga0501080_0346019 3300049742 Bacteria 1343
563 Ga0501083_0025284 3300049744 Bacteria 4110
564 Ga0501241_000029 3300049758 Bacteria 55736
565 Ga0501241_003940 3300049758 Bacteria 2793
566 Ga0501269_000008 3300049766 Bacteria 71498
567 Ga0501035_0017525 3300049822 Bacteria 6608
568 Ga0501035_0180943 3300049822 Bacteria 1816
569 Ga0501035_0286821 3300049822 Bacteria 1390
570 Ga0501044_0055704 3300049823 Bacteria 4060
571 Ga0501044_0214481 3300049823 Bacteria 1878
572 Ga0501284_00002 3300050005 Bacteria 220402
573 nmdc:mga0k408_37721_c1 3300050493 Bacteria 2774
574 nmdc:mga0k408_37816_c1 3300050493 Bacteria 2771
575 nmdc:mga05p37_569_c2 3300050507 Bacteria 24307
576 Ga0495619_0046338 3300053085 Bacteria 2859
577 Ga0500643_000698 3300053087 Bacteria 22326
578 Ga0500651_0065700 3300053093 Bacteria 2260
579 Ga0500641_0016230 3300053096 Bacteria 2771
580 Ga0500618_013300 3300053125 Bacteria 2131
581 Ga0500611_000003 3300053727 Bacteria 333431
582 Ga0501084_0223350 3300054114 Bacteria 1589
583 2511232242 2511231000 Bacteria 4488346
584 2524006983 2523533629 Bacteria 2982326
585 2585144988 2582581278 Bacteria 5296881
586 2585159217 2582581281 Bacteria 4487904
587 2585163498 2582581282 Bacteria 4495830
588 2585425586 2582581873 Bacteria 3032664
589 2587678205 2585428045 Bacteria 5203023
590 2587748207 2585428060 Bacteria 5304711
591 2587753560 2585428061 Bacteria 3939663
592 2587865411 2585428095 Bacteria 3789702
593 2587944248 2585428115 Bacteria 4420269
594 2588209925 2585428182 Bacteria 5007281
595 2588214899 2585428183 Bacteria 5166119
596 2588218119 2585428184 Bacteria 4978681
597 2588222674 2585428185 Bacteria 4969476
598 2588231469 2585428187 Bacteria 4629388
599 2588444562 2588253712 Bacteria 5403181
600 2590602629 2588254255 Bacteria 5014294
601 2590613060 2588254257 Bacteria 5436094
602 2729199606 2728369107 Bacteria 5082720
603 2738699083 2738541273 Bacteria 4048577
604 2739254799 2738543014 Bacteria 4048139
605 2740032961 2739367866 Bacteria 4215900
606 2740058667 2739367874 Bacteria 4872888
607 2753670760 2751185877 Bacteria 4921427
608 2765573697 2765235839 Bacteria 5314748
609 2772606973 2772190705 Bacteria 4666226
610 2775672261 2775506739 Bacteria 3855222
611 2816874044 2816332188 Bacteria 5133218
612 2839992777 2839989709 Bacteria 3773432
613 2842088127 2842083920 Bacteria 4857652
614 2871720591 2871720351 Bacteria 4862476
615 2889295708 2889290771 Bacteria 5530962
616 2906000426 2905999023 Bacteria 4591259
617 2910247594 2910245624 Bacteria 6935613
618 2919099133 2919097161 Bacteria 3860339
619 2919399806 2919399522 Bacteria 5164947
620 2928974940 2928972540 Bacteria 3058286
621 2945926320 2945924605 Bacteria 4296724
622 2946022292 2946019816 Bacteria 4621265
623 2977242017 2977240413 Bacteria 3191065
624 2977245310 2977243572 Bacteria 4374394
625 2984572788 2984572630 Bacteria 4186940
626 2984610238 2984606641 Bacteria 4186971
627 2993372825 2993372514 Bacteria 4214139
628 2993483489 2993480792 Bacteria 4022225
629 rootH1_10186422
630 JGI24741J21665_1004093
631 JGI24740J21852_10004256
632 JGI25406J46586_10003794
633 rootL2_10119958
634 rootL2_10193522
635 rootH1_10026469
636 JGI25160J50197_1000912
637 Ga0065714_10070919
638 Ga0065714_10104632
639 Ga0065704_10074654
640 Ga0065704_10089097
641 Ga0065712_10142849
642 Ga0065712_10161806
643 Ga0065715_10234060
644 Ga0065715_10249922
645 Ga0065707_10008827
646 Ga0070676_10005217
647 Ga0070676_10020770
648 Ga0070676_10105200
649 Ga0070683_100003599
650 Ga0070683_100125605
651 Ga0070683_100131378
652 Ga0070690_100097891
653 Ga0070690_100114118
654 Ga0070670_100012714
655 Ga0070670_100052599
656 Ga0070670_100071585
657 Ga0070670_100093511
658 Ga0070670_100103297
659 Ga0070670_100278242
660 Ga0068869_100004070
661 Ga0068869_100035028
662 Ga0068869_100053181
663 Ga0068869_100072689
664 Ga0068869_100082031
665 Ga0068869_100087617
666 Ga0068869_100092239
667 Ga0070666_10000064
668 Ga0070666_10025660
669 Ga0070666_10065042
670 Ga0070666_10319829
671 Ga0070682_100000041
672 Ga0070682_100000251
673 Ga0068868_100010337
674 Ga0068868_100011564
675 Ga0068868_100232903
676 Ga0070660_100359929
677 Ga0070689_100004075
678 Ga0070689_100013479
679 Ga0070689_100021838
680 Ga0070689_100310830
681 Ga0070661_100018669
682 Ga0070668_100029119
683 Ga0070668_100031692
684 Ga0070668_100335636
685 Ga0070669_100012514
686 Ga0070669_100114533
687 Ga0070675_100019691
688 Ga0070675_100029134
689 Ga0070675_100032856
690 Ga0070675_100220146
691 Ga0070675_100464775
692 Ga0070671_100039379
693 Ga0070671_100041838
694 Ga0070671_100113096
695 Ga0070671_100274956
696 Ga0070674_100020055
697 Ga0070674_100050388
698 Ga0070674_100054635
699 Ga0070674_100126299
700 Ga0070673_100059631
701 Ga0070659_100133308
702 Ga0070667_100007241
703 Ga0070667_100011918
704 Ga0070667_100020250
705 Ga0070667_100120411
706 Ga0070701_10021013
707 Ga0070705_100095925
708 Ga0070705_100298513
709 Ga0070700_100208317
710 Ga0070678_100033638
711 Ga0070662_100020905
712 Ga0070662_100025032
713 Ga0070662_100048568
714 Ga0070662_100384142
715 Ga0068867_100026168
716 Ga0068867_100036762
717 Ga0068867_100144633
718 Ga0068867_100365196
719 Ga0070685_10201849
720 Ga0070706_100067646
721 Ga0070684_100005000
722 Ga0070684_100011331
723 Ga0070684_100236707
724 Ga0070684_100319154
725 Ga0068853_100002818
726 Ga0068853_100009011
727 Ga0068853_100011823
728 Ga0068853_100180780
729 Ga0068853_100202069
730 Ga0070672_100089614
731 Ga0070672_100188953
732 Ga0070672_100236358
733 Ga0070672_100261775
734 Ga0070672_100323579
735 Ga0070686_100026141
736 Ga0070693_100121378
737 Ga0070665_100047753
738 Ga0070665_100077931
739 Ga0070665_100155308
740 Ga0070665_100188615
741 Ga0070664_100009001
742 Ga0070664_100098480
743 Ga0070664_100373746
744 Ga0068857_100019122
745 Ga0068857_100285067
746 Ga0070702_100148723
747 Ga0070702_100190394
748 Ga0068852_100080977
749 Ga0068852_100188185
750 Ga0068852_100196414
751 Ga0068859_100000003
752 Ga0068859_100000872
753 Ga0068859_100025447
754 Ga0068859_100031440
755 Ga0068859_100063757
756 Ga0068859_100076736
757 Ga0068859_100368761
758 Ga0068859_100634962
759 Ga0068864_100002531
760 Ga0068864_100007444
761 Ga0068864_100051658
762 Ga0068864_100084464
763 Ga0068864_100258057
764 Ga0068866_10020328
765 Ga0068866_10046772
766 Ga0068861_100005990
767 Ga0068861_100019977
768 Ga0068861_100102988
769 Ga0068851_10000117
770 Ga0068851_10009566
771 Ga0068851_10072811
772 Ga0068870_10046317
773 Ga0068863_100005585
774 Ga0068863_100014768
775 Ga0068863_100255115
776 Ga0068858_100020164
777 Ga0068858_100086152
778 Ga0068858_100305125
779 Ga0068858_100398721
780 Ga0068860_100001759
781 Ga0068860_100003400
782 Ga0068860_100013798
783 Ga0068860_100054400
784 Ga0068860_100312149
785 Ga0068862_100164046
786 Ga0068862_100168728
787 Ga0068862_100230173
788 Ga0068862_100550710
789 Ga0081539_10000382
790 Ga0075366_10013250
791 Ga0075366_10033313
792 Ga0097621_100000109
793 Ga0097621_100031989
794 Ga0097621_100041789
795 Ga0097621_100062609
796 Ga0068871_100001161
797 Ga0068871_100029457
798 Ga0068871_100085698
799 Ga0068871_100089275
800 Ga0068871_100254411
801 Ga0068871_100271456
802 Ga0068865_100037684
803 Ga0068865_100059763
804 Ga0068865_100089827
805 Ga0068865_100109653
806 Ga0068865_100133353
807 Ga0097620_100000003
808 Ga0097620_100000872
809 Ga0097620_100025447
810 Ga0097620_100031439
811 Ga0097620_100063758
812 Ga0097620_100076731
813 Ga0097620_100368791
814 Ga0097620_100635014
815 Ga0075435_100008606
816 Ga0105244_10000102
817 Ga0111539_10027777
818 Ga0111539_10130528
819 Ga0105245_10196362
820 Ga0105245_10400620
821 Ga0105247_10001414
822 Ga0105247_10100105
823 Ga0114129_10000574
824 Ga0105243_10000696
825 Ga0105243_10234757
826 Ga0105241_10001052
827 Ga0105242_10062366
828 Ga0105242_10117909
829 Ga0105242_10119081
830 Ga0105248_10002485
831 Ga0105248_10050131
832 Ga0105248_10747535
833 Ga0105237_10001093
834 Ga0105237_10014135
835 Ga0105249_10001422
836 Ga0105249_10006153
837 Ga0105249_10007824
838 Ga0105249_10019463
839 Ga0105249_10067192
840 Ga0105249_10089134
841 Ga0105249_10123093
842 Ga0105249_10145419
843 Ga0105249_10153165
844 Ga0105249_10343967
845 Ga0105249_10359277
846 Ga0105239_10009054
847 Ga0157373_10006620
848 Ga0157371_10000012
849 Ga0157371_10059129
850 Ga0157371_10061101
851 Ga0157370_10001425
852 Ga0157370_10009609
853 Ga0157370_10018285
854 Ga0157370_10022602
855 Ga0157370_10157037
856 Ga0157369_10006875
857 Ga0157369_10106570
858 Ga0157369_10132895
859 Ga0157369_10133731
860 Ga0157374_10006069
861 Ga0157374_10120046
862 Ga0157378_10004040
863 Ga0157378_10011276
864 Ga0157378_10046321
865 Ga0157378_10070515
866 Ga0157378_10087183
867 Ga0157378_10114246
868 Ga0157378_10182727
869 Ga0163162_10000579
870 Ga0163162_10001945
871 Ga0163162_10002569
872 Ga0163162_10002730
873 Ga0163162_10003086
874 Ga0163162_10021490
875 Ga0163162_10134788
876 Ga0157372_10021078
877 Ga0157375_10002298
878 Ga0157375_10002648
879 Ga0157375_10008218
880 Ga0157375_10032503
881 Ga0157375_10051436
882 Ga0157375_10055248
883 Ga0157375_10106132
884 Ga0157375_10119101
885 Ga0157375_10180129
886 Ga0157375_10263489
887 Ga0157375_10497121
888 Ga0163163_10000401
889 Ga0163163_10014243
890 Ga0163163_10086851
891 Ga0163163_10155766
892 Ga0163163_10203770
893 Ga0157380_10000248
894 Ga0157380_10002215
895 Ga0157380_10010366
896 Ga0157380_10015227
897 Ga0182008_10000684
898 Ga0182008_10029635
899 Ga0157377_10003418
900 Ga0157377_10136180
901 Ga0157379_10053413
902 Ga0157379_10095212
903 Ga0157376_10006244
904 Ga0157376_10006909
905 Ga0157376_10030234
906 Ga0157376_10036517
907 Ga0157376_10132525
908 Ga0182006_1000016
909 Ga0163161_10001723
910 Ga0163161_10001778
911 Ga0163161_10003553
912 Ga0163161_10005845
913 Ga0163161_10183104
914 Ga0213876_10006872
915 Ga0209675_1000103
916 Ga0207426_1000040
917 Ga0207656_10000167
918 Ga0207655_1000013
919 Ga0207682_10065031
920 Ga0207642_10031154
921 Ga0207642_10055197
922 Ga0207710_10000837
923 Ga0207710_10057035
924 Ga0207688_10004997
925 Ga0207688_10138920
926 Ga0207680_10000054
927 Ga0207680_10048983
928 Ga0207680_10145462
929 Ga0207680_10232712
930 Ga0207647_10005536
931 Ga0207645_10000748
932 Ga0207645_10017210
933 Ga0207645_10138872
934 Ga0207643_10007164
935 Ga0207643_10020201
936 Ga0207643_10142064
937 Ga0207654_10004259
938 Ga0207671_10001498
939 Ga0207662_10172879
940 Ga0207657_10050681
941 Ga0207657_10261355
942 Ga0207649_10046440
943 Ga0207681_10082001
944 Ga0207650_10030339
945 Ga0207650_10030710
946 Ga0207650_10320992
947 Ga0207659_10108318
948 Ga0207659_10316259
949 Ga0207687_10109681
950 Ga0207644_10035729
951 Ga0207644_10118440
952 Ga0207706_10026986
953 Ga0207706_10027760
954 Ga0207706_10280721
955 Ga0207686_10090031
956 Ga0207686_10187235
957 Ga0207686_10218904
958 Ga0207709_10000890
959 Ga0207670_10077894
960 Ga0207670_10259276
961 Ga0207669_10011006
962 Ga0207669_10237750
963 Ga0207704_10175133
964 Ga0207691_10073268
965 Ga0207691_10092122
966 Ga0207689_10000337
967 Ga0207689_10000628
968 Ga0207689_10003117
969 Ga0207689_10013936
970 Ga0207689_10020993
971 Ga0207689_10026700
972 Ga0207661_10004869
973 Ga0207679_10002211
974 Ga0207679_10040287
975 Ga0207679_10328064
976 Ga0207651_10028429
977 Ga0207651_10169559
978 Ga0207651_10198091
979 Ga0207712_10000844
980 Ga0207712_10027942
981 Ga0207712_10039063
982 Ga0207712_10089354
983 Ga0207712_10089998
984 Ga0207712_10139329
985 Ga0207668_10193006
986 Ga0207668_10306227
987 Ga0207668_10398381
988 Ga0207640_10102757
989 Ga0207658_10010834
990 Ga0207658_10013795
991 Ga0207658_10022800
992 Ga0207658_10067462
993 Ga0207677_10001734
994 Ga0207677_10008694
995 Ga0207677_10073019
996 Ga0207703_10005580
997 Ga0207703_10346495
998 Ga0207703_10378414
999 Ga0207639_10002203
1000 Ga0207639_10018417
1001 Ga0207641_10000026
1002 Ga0207641_10043818
1003 Ga0207641_10111360
1004 Ga0207648_10000372
1005 Ga0207648_10018970
1006 Ga0207648_10021307
1007 Ga0207648_10061633
1008 Ga0207648_10159417
1009 Ga0207648_10167029
1010 Ga0207648_10212140
1011 Ga0207648_10344972
1012 Ga0207676_10004513
1013 Ga0207676_10030348
1014 Ga0207676_10038905
1015 Ga0207674_10006730
1016 Ga0207674_10010951
1017 Ga0207674_10108465
1018 Ga0207675_100001072
1019 Ga0207675_100022028
1020 Ga0207675_100042016
1021 Ga0207683_10001617
1022 Ga0207683_10044988
1023 Ga0207683_10314105
1024 Ga0207698_10126863
1025 Ga0207698_10221127
1026 Ga0207698_10276042
1027 Ga0268265_10089490
1028 Ga0268265_10188192
1029 Ga0268264_10008138
1030 Ga0268264_10018301
1031 Ga0268264_10022974
1032 Ga0268264_10029070
1033 Ga0268264_10206013
1034 Ga0307515_10000001
1035 Ga0307515_10007482
1036 Ga0265327_10000013
1037 Ga0265327_10024131
1038 Ga0265316_10247439
1039 Ga0307513_10117217
1040 Ga0265313_10040303
1041 Ga0316576_10136673
1042 Ga0316578_10023882
1043 Ga0316577_10001749
1044 Ga0316577_10004637
1045 Ga0316577_10005128
1046 Ga0307410_10030360
1047 Ga0307412_10000184
1048 Ga0307412_10000551
1049 Ga0307416_100000051
1050 Ga0307414_10000004
1051 Ga0307414_10031638
1052 Ga0307414_10046132
1053 Ga0307414_10061410
1054 Ga0307414_10254299
1055 Ga0307414_10254542
1056 Ga0373926_0007855
1057 Ga0373934_0009251
1058 Ga0373949_0036333
1059 Ga0373955_0004601
1060 Ga0316574_0010391
1061 Ga0316574_0192067
1062 Ga0373924_0005807
1063 Ga0373924_0095716
1064 Ga0373931_0028110
1065 Ga0373933_0015285
1066 Ga0373937_0002667
1067 Ga0316584_0029981
1068 Ga0316584_0044470
1069 Ga0373925_0193972
1070 Ga0316581_0009138
1071 Ga0400484_17565
1072 Ga0400484_33210
1073 Ga0400484_36796
1074 Ga0400483_006822
1075 Ga0400483_029114
1076 Ga0400483_088593
1077 Ga0400483_101201
1078 Ga0400483_288640
1079 Ga0436365_1656319
1080 Ga0436361_0751163
1081 Ga0451789_1247108
1082 Ga0451837_0890985
1083 Ga0439431_0042817
1084 Ga0439445_0000535
1085 Ga0439454_000970
1086 Ga0450898_002007
1087 Ga0450899_005788
1088 Ga0450904_006452
1089 Ga0451577_0044831
1090 Ga0451577_0072954
1091 Ga0466972_0000146
1092 Ga0453683_0000438
1093 Ga0453683_0116159
1094 Ga0453683_0169626
1095 Ga0453684_0003280
1096 Ga0453684_0021278
1097 Ga0453684_0022637
1098 Ga0453684_0179910
1099 Ga0466970_0000169
1100 Ga0495627_000002
1101 Ga0495627_021367
1102 Ga0495590_0007763
1103 Ga0495638_0163379
1104 Ga0495580_0061854
1105 Ga0495594_0145457
1106 Ga0495596_0001340
1107 Ga0495606_0022518
1108 Ga0495606_0068657
1109 Ga0495608_0104404
1110 Ga0495610_0000009
1111 Ga0495630_0008167
1112 Ga0495632_0001733
1113 Ga0495643_0042896
1114 Ga0495643_0066223
1115 Ga0495643_0138771
1116 Ga0495663_0000065
1117 Ga0495652_0087187
1118 Ga0495654_0000056
1119 Ga0495609_0000063
1120 Ga0495633_0000003
1121 Ga0495633_0000805
1122 Ga0495656_0007055
1123 Ga0495668_0000023
1124 Ga0495668_0002875
1125 Ga0495625_0000560
1126 Ga0495635_0264309
1127 Ga0495649_0000619
1128 Ga0495604_0048545
1129 Ga0495674_0264110
1130 Ga0495672_0028614
1131 Ga0495680_0110530
1132 Ga0495684_0029757
1133 Ga0495686_0000144
1134 Ga0495686_0005176
1135 Ga0495686_0048335
1136 Ga0496100_0355515
1137 Ga0496101_0059649
1138 Ga0496102_0046632
1139 Ga0496110_0134416
1140 Ga0496110_0427817
1141 Ga0496111_0050742
1142 Ga0496113_0248729
1143 Ga0496114_0195320
1144 Ga0496116_0000006
1145 Ga0496117_0000491
1146 Ga0496118_0000543
1147 Ga0496119_0000379
1148 Ga0496122_0000334
1149 Ga0496122_0000486
1150 Ga0496122_0000775
1151 Ga0496122_0001546
1152 Ga0496122_0002699
1153 Ga0496123_0001808
1154 Ga0496123_0002784
1155 Ga0496123_0039971
1156 Ga0496123_0047124
1157 Ga0496124_0010448
1158 Ga0496124_0075338
1159 Ga0496125_0001284
1160 Ga0496125_0002600
1161 Ga0496126_0001645
1162 Ga0501032_0030572
1163 Ga0501034_0000152
1164 Ga0501034_0003578
1165 Ga0501034_0099189
1166 Ga0501034_0145959
1167 Ga0501034_0279316
1168 Ga0501037_0004609
1169 Ga0501037_0465259
1170 Ga0501038_0077080
1171 Ga0501038_0122053
1172 Ga0501039_0104660
1173 Ga0501040_0100245
1174 Ga0501043_0355626
1175 Ga0501047_0020753
1176 Ga0501047_0160990
1177 Ga0501067_0003375
1178 Ga0501067_0040932
1179 Ga0501067_0042141
1180 Ga0501068_0219572
1181 Ga0501070_0040124
1182 Ga0501073_0028030
1183 Ga0501073_0253066
1184 Ga0501073_0262148
1185 Ga0501074_0082340
1186 Ga0501077_0061912
1187 Ga0501219_000281
1188 Ga0501080_0144694
1189 Ga0501080_0197699
1190 Ga0501080_0346019
1191 Ga0501083_0025284
1192 Ga0501241_000029
1193 Ga0501241_003940
1194 Ga0501269_000008
1195 Ga0501035_0017525
1196 Ga0501035_0180943
1197 Ga0501035_0286821
1198 Ga0501044_0055704
1199 Ga0501044_0214481
1200 Ga0501284_00002
1201 nmdc:mga0k408_37721_c1
1202 nmdc:mga0k408_37816_c1
1203 nmdc:mga05p37_569_c2
1204 Ga0495619_0046338
1205 Ga0500643_000698
1206 Ga0500651_0065700
1207 Ga0500641_0016230
1208 Ga0500618_013300
1209 Ga0500611_000003
1210 Ga0501084_0223350
1211 2511232242
1212 2524006983
1213 2585144988
1214 2585159217
1215 2585163498
1216 2585425586
1217 2587678205
1218 2587748207
1219 2587753560
1220 2587865411
1221 2587944248
1222 2588209925
1223 2588214899
1224 2588218119
1225 2588222674
1226 2588231469
1227 2588444562
1228 2590602629
1229 2590613060
1230 2729199606
1231 2738699083
1232 2739254799
1233 2740032961
1234 2740058667
1235 2753670760
1236 2765573697
1237 2772606973
1238 2775672261
1239 2816874044
1240 2839992777
1241 2842088127
1242 2871720591
1243 2889295708
1244 2906000426
1245 2910247594
1246 2919099133
1247 2919399806
1248 2928974940
1249 2945926320
1250 2946022292
1251 2977242017
1252 2977245310
1253 2984572788
1254 2984610238
1255 2993372825
1256 2993483489

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

289

378

0.98

PF08545

ACP_syn_III

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

136

217

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z19-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine 0.9782 3 340
4ylt-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis 0.9779 3 340
5bnr-assembly1.cif.gz_A-2 e. coli fabh with small molecule inhibitor 2 0.9757 3 340
2ebd-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 0.9756 4 340
6x7r-assembly1.cif.gz_A e. coli beta-ketoacyl-[acyl carrier protein] synthase iii (fabh) in complex with oxa(dethia)-coenzyme a 0.973 1 340
ID Description Score Start End Superfamily
af_P0A6R0_1_317_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9752 3 340 3.40.47.10
3il3A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9701 3 177 3.40.47.10
af_Q2FZS0_1_313_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9698 3 340 3.40.47.10
af_P0A6R0_1_317_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9692 3 340 3.40.47.10
4x9oB00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9684 1 340 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A847X4G8-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III C-terminal domain-containing protein 0.9878 230 339 GO:0016746
AF-H8MCV2-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] synthase III 0.9872 174 340 GO:0016746
AF-A0A354BKT2-F1-model_v4 3-oxoacyl-ACP synthase 0.9869 239 340 GO:0016746
AF-A0A3C2AR23-F1-model_v4 3-oxoacyl-ACP synthase 0.9852 67 340 GO:0004315
GO:0006633
GO:0044550
AF-A0A497XSQ6-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) 0.9837 3 340 GO:0004315
GO:0005737
GO:0006633
GO:0033818
GO:0044550

Map