F470613
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 628 | 307 | 1256 | 343 |
Family's Representative Sequence
| Representative Sequence | 3300003316|rootH1_10186422|rootH1_101864222 |
| Length | 378 |
| Sequence | MHLWRKLTAVKGIFSVLSRLKLKHQQNLMPKTRIAGVGMYVPKNVITNADLMKHMDTTDEWIQQRTGIKERRYANREGETTTTMGVEAAKQAIENAGITKDDVDFIVFATLCPDYYFPGCGVLLQRAMQMKTIGALDIRNQCTGFIYALSVADQFIKTGMYKNILVVGSEKHSFALDFSTRGRTVSVMFGDGAGAVILQPTENEGEGILSTHLHADGNGAEALACYNPGSHANHWVKEKIAEYDDTDFYGQQFVSHSMIDNAQIFPSMDGNAVMKRAISFLPEVIGEALTQNNYTIDDLNMLILNQSNARIAEYVQQKLGLTDDEIYINIYRYGNTTAASIPIAMFEAMRDGKLKRGDLLCLAAYGSGFTWASALIRF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 147 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 148 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 149 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 150 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 152 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 153 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 154 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 157 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 158 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 159 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 163 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 166 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 168 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 170 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 171 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 172 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 173 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 174 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 176 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 177 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 178 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 179 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 180 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 181 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 182 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 183 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 184 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 185 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 186 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 187 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 220 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 221 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 222 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 223 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 224 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 225 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 226 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 227 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 228 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 229 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 230 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 231 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 246 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 249 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 253 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 254 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 257 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 258 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 259 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 260 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 261 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 263 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 264 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 265 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 266 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 267 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 268 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 269 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 270 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 271 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 272 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 273 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 274 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 275 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 276 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 277 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 278 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 279 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 280 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 281 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 282 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 283 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 284 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 285 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 286 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 287 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 288 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 289 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 290 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 291 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 292 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 293 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 294 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 295 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 296 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 297 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 298 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 299 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 300 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 301 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 302 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 303 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 304 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 305 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 306 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 307 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.68 |
| Metatranscriptomes | 0 |
| Isolates | 7.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.32 |
| Bulb | 0 |
| Endosphere | 1.91 |
| Nodule | 0.16 |
| Rhizoplane | 1.43 |
| Rhizosphere | 88.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10186422 | 3300003316 | Bacteria | 1507 |
| 2 | JGI24741J21665_1004093 | 3300001915 | Bacteria | 3307 |
| 3 | JGI24740J21852_10004256 | 3300001979 | Bacteria | 6167 |
| 4 | JGI25406J46586_10003794 | 3300003203 | Bacteria | 7068 |
| 5 | rootL2_10119958 | 3300003322 | Bacteria | 5696 |
| 6 | rootL2_10193522 | 3300003322 | Bacteria | 3688 |
| 7 | rootH1_10026469 | 3300003323 | Bacteria | 22797 |
| 8 | JGI25160J50197_1000912 | 3300003354 | Bacteria | 15528 |
| 9 | Ga0065714_10070919 | 3300005288 | Bacteria | 3728 |
| 10 | Ga0065714_10104632 | 3300005288 | Bacteria | 1581 |
| 11 | Ga0065704_10074654 | 3300005289 | Bacteria | 6109 |
| 12 | Ga0065704_10089097 | 3300005289 | Bacteria | 2886 |
| 13 | Ga0065712_10142849 | 3300005290 | Bacteria | 1434 |
| 14 | Ga0065712_10161806 | 3300005290 | Bacteria | 1297 |
| 15 | Ga0065715_10234060 | 3300005293 | Unclassified | 1223 |
| 16 | Ga0065715_10249922 | 3300005293 | Bacteria | 1170 |
| 17 | Ga0065707_10008827 | 3300005295 | Unclassified | 2828 |
| 18 | Ga0070676_10005217 | 3300005328 | Bacteria | 6907 |
| 19 | Ga0070676_10020770 | 3300005328 | Bacteria | 3671 |
| 20 | Ga0070676_10105200 | 3300005328 | Bacteria | 1750 |
| 21 | Ga0070683_100003599 | 3300005329 | Bacteria | 12623 |
| 22 | Ga0070683_100125605 | 3300005329 | Unclassified | 2425 |
| 23 | Ga0070683_100131378 | 3300005329 | Bacteria | 2369 |
| 24 | Ga0070690_100097891 | 3300005330 | Bacteria | 1941 |
| 25 | Ga0070690_100114118 | 3300005330 | Bacteria | 1806 |
| 26 | Ga0070670_100012714 | 3300005331 | Bacteria | 7203 |
| 27 | Ga0070670_100052599 | 3300005331 | Bacteria | 3497 |
| 28 | Ga0070670_100071585 | 3300005331 | Bacteria | 2977 |
| 29 | Ga0070670_100093511 | 3300005331 | Bacteria | 2586 |
| 30 | Ga0070670_100103297 | 3300005331 | Unclassified | 2455 |
| 31 | Ga0070670_100278242 | 3300005331 | Bacteria | 1461 |
| 32 | Ga0068869_100004070 | 3300005334 | Bacteria | 9050 |
| 33 | Ga0068869_100035028 | 3300005334 | Bacteria | 3556 |
| 34 | Ga0068869_100053181 | 3300005334 | Bacteria | 2943 |
| 35 | Ga0068869_100072689 | 3300005334 | Bacteria | 2548 |
| 36 | Ga0068869_100082031 | 3300005334 | Bacteria | 2409 |
| 37 | Ga0068869_100087617 | 3300005334 | Bacteria | 2336 |
| 38 | Ga0068869_100092239 | 3300005334 | Unclassified | 2280 |
| 39 | Ga0070666_10000064 | 3300005335 | Bacteria | 79823 |
| 40 | Ga0070666_10025660 | 3300005335 | Bacteria | 3843 |
| 41 | Ga0070666_10065042 | 3300005335 | Bacteria | 2474 |
| 42 | Ga0070666_10319829 | 3300005335 | Bacteria | 1107 |
| 43 | Ga0070682_100000041 | 3300005337 | Bacteria | 142152 |
| 44 | Ga0070682_100000251 | 3300005337 | Bacteria | 38982 |
| 45 | Ga0068868_100010337 | 3300005338 | Bacteria | 6749 |
| 46 | Ga0068868_100011564 | 3300005338 | Bacteria | 6428 |
| 47 | Ga0068868_100232903 | 3300005338 | Bacteria | 1545 |
| 48 | Ga0070660_100359929 | 3300005339 | Bacteria | 1199 |
| 49 | Ga0070689_100004075 | 3300005340 | Bacteria | 9839 |
| 50 | Ga0070689_100013479 | 3300005340 | Bacteria | 5916 |
| 51 | Ga0070689_100021838 | 3300005340 | Bacteria | 4771 |
| 52 | Ga0070689_100310830 | 3300005340 | Bacteria | 1314 |
| 53 | Ga0070661_100018669 | 3300005344 | Bacteria | 4934 |
| 54 | Ga0070668_100029119 | 3300005347 | Bacteria | 4193 |
| 55 | Ga0070668_100031692 | 3300005347 | Bacteria | 4022 |
| 56 | Ga0070668_100335636 | 3300005347 | Bacteria | 1276 |
| 57 | Ga0070669_100012514 | 3300005353 | Bacteria | 6019 |
| 58 | Ga0070669_100114533 | 3300005353 | Bacteria | 2050 |
| 59 | Ga0070675_100019691 | 3300005354 | Bacteria | 5380 |
| 60 | Ga0070675_100029134 | 3300005354 | Bacteria | 4450 |
| 61 | Ga0070675_100032856 | 3300005354 | Unclassified | 4201 |
| 62 | Ga0070675_100220146 | 3300005354 | Bacteria | 1653 |
| 63 | Ga0070675_100464775 | 3300005354 | Bacteria | 1136 |
| 64 | Ga0070671_100039379 | 3300005355 | Bacteria | 3923 |
| 65 | Ga0070671_100041838 | 3300005355 | Bacteria | 3808 |
| 66 | Ga0070671_100113096 | 3300005355 | Bacteria | 2281 |
| 67 | Ga0070671_100274956 | 3300005355 | Bacteria | 1432 |
| 68 | Ga0070674_100020055 | 3300005356 | Bacteria | 4261 |
| 69 | Ga0070674_100050388 | 3300005356 | Bacteria | 2866 |
| 70 | Ga0070674_100054635 | 3300005356 | Bacteria | 2763 |
| 71 | Ga0070674_100126299 | 3300005356 | Bacteria | 1900 |
| 72 | Ga0070673_100059631 | 3300005364 | Bacteria | 3022 |
| 73 | Ga0070659_100133308 | 3300005366 | Bacteria | 2019 |
| 74 | Ga0070667_100007241 | 3300005367 | Bacteria | 9217 |
| 75 | Ga0070667_100011918 | 3300005367 | Bacteria | 7194 |
| 76 | Ga0070667_100020250 | 3300005367 | Bacteria | 5523 |
| 77 | Ga0070667_100120411 | 3300005367 | Bacteria | 2282 |
| 78 | Ga0070701_10021013 | 3300005438 | Bacteria | 3109 |
| 79 | Ga0070705_100095925 | 3300005440 | Bacteria | 1861 |
| 80 | Ga0070705_100298513 | 3300005440 | Unclassified | 1153 |
| 81 | Ga0070700_100208317 | 3300005441 | Bacteria | 1378 |
| 82 | Ga0070678_100033638 | 3300005456 | Bacteria | 3561 |
| 83 | Ga0070662_100020905 | 3300005457 | Bacteria | 4464 |
| 84 | Ga0070662_100025032 | 3300005457 | Bacteria | 4118 |
| 85 | Ga0070662_100048568 | 3300005457 | Unclassified | 3057 |
| 86 | Ga0070662_100384142 | 3300005457 | Bacteria | 1156 |
| 87 | Ga0068867_100026168 | 3300005459 | Bacteria | 4188 |
| 88 | Ga0068867_100036762 | 3300005459 | Bacteria | 3556 |
| 89 | Ga0068867_100144633 | 3300005459 | Bacteria | 1862 |
| 90 | Ga0068867_100365196 | 3300005459 | Bacteria | 1208 |
| 91 | Ga0070685_10201849 | 3300005466 | Bacteria | 1293 |
| 92 | Ga0070706_100067646 | 3300005467 | Bacteria | 3304 |
| 93 | Ga0070684_100005000 | 3300005535 | Bacteria | 10126 |
| 94 | Ga0070684_100011331 | 3300005535 | Bacteria | 7100 |
| 95 | Ga0070684_100236707 | 3300005535 | Bacteria | 1668 |
| 96 | Ga0070684_100319154 | 3300005535 | Bacteria | 1427 |
| 97 | Ga0068853_100002818 | 3300005539 | Bacteria | 13167 |
| 98 | Ga0068853_100009011 | 3300005539 | Bacteria | 8037 |
| 99 | Ga0068853_100011823 | 3300005539 | Bacteria | 7097 |
| 100 | Ga0068853_100180780 | 3300005539 | Bacteria | 1913 |
| 101 | Ga0068853_100202069 | 3300005539 | Bacteria | 1809 |
| 102 | Ga0070672_100089614 | 3300005543 | Bacteria | 2479 |
| 103 | Ga0070672_100188953 | 3300005543 | Bacteria | 1719 |
| 104 | Ga0070672_100236358 | 3300005543 | Bacteria | 1536 |
| 105 | Ga0070672_100261775 | 3300005543 | Bacteria | 1459 |
| 106 | Ga0070672_100323579 | 3300005543 | Bacteria | 1311 |
| 107 | Ga0070686_100026141 | 3300005544 | Bacteria | 3520 |
| 108 | Ga0070693_100121378 | 3300005547 | Unclassified | 1621 |
| 109 | Ga0070665_100047753 | 3300005548 | Bacteria | 4296 |
| 110 | Ga0070665_100077931 | 3300005548 | Bacteria | 3320 |
| 111 | Ga0070665_100155308 | 3300005548 | Unclassified | 2290 |
| 112 | Ga0070665_100188615 | 3300005548 | Bacteria | 2063 |
| 113 | Ga0070664_100009001 | 3300005564 | Bacteria | 8098 |
| 114 | Ga0070664_100098480 | 3300005564 | Bacteria | 2540 |
| 115 | Ga0070664_100373746 | 3300005564 | Bacteria | 1300 |
| 116 | Ga0068857_100019122 | 3300005577 | Bacteria | 6012 |
| 117 | Ga0068857_100285067 | 3300005577 | Bacteria | 1520 |
| 118 | Ga0070702_100148723 | 3300005615 | Bacteria | 1501 |
| 119 | Ga0070702_100190394 | 3300005615 | Bacteria | 1349 |
| 120 | Ga0068852_100080977 | 3300005616 | Bacteria | 2881 |
| 121 | Ga0068852_100188185 | 3300005616 | Bacteria | 1946 |
| 122 | Ga0068852_100196414 | 3300005616 | Bacteria | 1907 |
| 123 | Ga0068859_100000003 | 3300005617 | Bacteria | 479218 |
| 124 | Ga0068859_100000872 | 3300005617 | Bacteria | 30780 |
| 125 | Ga0068859_100025447 | 3300005617 | Bacteria | 5936 |
| 126 | Ga0068859_100031440 | 3300005617 | Bacteria | 5332 |
| 127 | Ga0068859_100063757 | 3300005617 | Bacteria | 3716 |
| 128 | Ga0068859_100076736 | 3300005617 | Bacteria | 3382 |
| 129 | Ga0068859_100368761 | 3300005617 | Unclassified | 1531 |
| 130 | Ga0068859_100634962 | 3300005617 | Bacteria | 1160 |
| 131 | Ga0068864_100002531 | 3300005618 | Bacteria | 15099 |
| 132 | Ga0068864_100007444 | 3300005618 | Bacteria | 9016 |
| 133 | Ga0068864_100051658 | 3300005618 | Unclassified | 3542 |
| 134 | Ga0068864_100084464 | 3300005618 | Bacteria | 2790 |
| 135 | Ga0068864_100258057 | 3300005618 | Bacteria | 1620 |
| 136 | Ga0068866_10020328 | 3300005718 | Bacteria | 3040 |
| 137 | Ga0068866_10046772 | 3300005718 | Bacteria | 2178 |
| 138 | Ga0068861_100005990 | 3300005719 | Bacteria | 8263 |
| 139 | Ga0068861_100019977 | 3300005719 | Bacteria | 4790 |
| 140 | Ga0068861_100102988 | 3300005719 | Bacteria | 2274 |
| 141 | Ga0068851_10000117 | 3300005834 | Bacteria | 42529 |
| 142 | Ga0068851_10009566 | 3300005834 | Bacteria | 4512 |
| 143 | Ga0068851_10072811 | 3300005834 | Bacteria | 1781 |
| 144 | Ga0068870_10046317 | 3300005840 | Bacteria | 2280 |
| 145 | Ga0068863_100005585 | 3300005841 | Bacteria | 12361 |
| 146 | Ga0068863_100014768 | 3300005841 | Bacteria | 7512 |
| 147 | Ga0068863_100255115 | 3300005841 | Bacteria | 1695 |
| 148 | Ga0068858_100020164 | 3300005842 | Bacteria | 6234 |
| 149 | Ga0068858_100086152 | 3300005842 | Bacteria | 2922 |
| 150 | Ga0068858_100305125 | 3300005842 | Bacteria | 1519 |
| 151 | Ga0068858_100398721 | 3300005842 | Bacteria | 1322 |
| 152 | Ga0068860_100001759 | 3300005843 | Bacteria | 23117 |
| 153 | Ga0068860_100003400 | 3300005843 | Bacteria | 16366 |
| 154 | Ga0068860_100013798 | 3300005843 | Bacteria | 7922 |
| 155 | Ga0068860_100054400 | 3300005843 | Bacteria | 3805 |
| 156 | Ga0068860_100312149 | 3300005843 | Bacteria | 1542 |
| 157 | Ga0068862_100164046 | 3300005844 | Bacteria | 1985 |
| 158 | Ga0068862_100168728 | 3300005844 | Bacteria | 1958 |
| 159 | Ga0068862_100230173 | 3300005844 | Bacteria | 1681 |
| 160 | Ga0068862_100550710 | 3300005844 | Unclassified | 1101 |
| 161 | Ga0081539_10000382 | 3300005985 | Bacteria | 96235 |
| 162 | Ga0075366_10013250 | 3300006195 | Bacteria | 4689 |
| 163 | Ga0075366_10033313 | 3300006195 | Bacteria | 3034 |
| 164 | Ga0097621_100000109 | 3300006237 | Bacteria | 46477 |
| 165 | Ga0097621_100031989 | 3300006237 | Bacteria | 4179 |
| 166 | Ga0097621_100041789 | 3300006237 | Bacteria | 3692 |
| 167 | Ga0097621_100062609 | 3300006237 | Bacteria | 3055 |
| 168 | Ga0068871_100001161 | 3300006358 | Bacteria | 17698 |
| 169 | Ga0068871_100029457 | 3300006358 | Bacteria | 4312 |
| 170 | Ga0068871_100085698 | 3300006358 | Bacteria | 2617 |
| 171 | Ga0068871_100089275 | 3300006358 | Bacteria | 2565 |
| 172 | Ga0068871_100254411 | 3300006358 | Bacteria | 1531 |
| 173 | Ga0068871_100271456 | 3300006358 | Bacteria | 1482 |
| 174 | Ga0068865_100037684 | 3300006881 | Bacteria | 3267 |
| 175 | Ga0068865_100059763 | 3300006881 | Bacteria | 2667 |
| 176 | Ga0068865_100089827 | 3300006881 | Unclassified | 2226 |
| 177 | Ga0068865_100109653 | 3300006881 | Bacteria | 2034 |
| 178 | Ga0068865_100133353 | 3300006881 | Bacteria | 1863 |
| 179 | Ga0097620_100000003 | 3300006931 | Bacteria | 479218 |
| 180 | Ga0097620_100000872 | 3300006931 | Bacteria | 30780 |
| 181 | Ga0097620_100025447 | 3300006931 | Bacteria | 5936 |
| 182 | Ga0097620_100031439 | 3300006931 | Bacteria | 5332 |
| 183 | Ga0097620_100063758 | 3300006931 | Bacteria | 3716 |
| 184 | Ga0097620_100076731 | 3300006931 | Bacteria | 3382 |
| 185 | Ga0097620_100368791 | 3300006931 | Unclassified | 1531 |
| 186 | Ga0097620_100635014 | 3300006931 | Bacteria | 1160 |
| 187 | Ga0075435_100008606 | 3300007076 | Bacteria | 7332 |
| 188 | Ga0105244_10000102 | 3300009036 | Bacteria | 88074 |
| 189 | Ga0111539_10027777 | 3300009094 | Bacteria | 6911 |
| 190 | Ga0111539_10130528 | 3300009094 | Bacteria | 2942 |
| 191 | Ga0105245_10196362 | 3300009098 | Bacteria | 1936 |
| 192 | Ga0105245_10400620 | 3300009098 | Bacteria | 1371 |
| 193 | Ga0105247_10001414 | 3300009101 | Bacteria | 17416 |
| 194 | Ga0105247_10100105 | 3300009101 | Bacteria | 1852 |
| 195 | Ga0114129_10000574 | 3300009147 | Bacteria | 45251 |
| 196 | Ga0105243_10000696 | 3300009148 | Bacteria | 32612 |
| 197 | Ga0105243_10234757 | 3300009148 | Bacteria | 1629 |
| 198 | Ga0105241_10001052 | 3300009174 | Bacteria | 21045 |
| 199 | Ga0105242_10062366 | 3300009176 | Bacteria | 3067 |
| 200 | Ga0105242_10117909 | 3300009176 | Bacteria | 2273 |
| 201 | Ga0105242_10119081 | 3300009176 | Bacteria | 2263 |
| 202 | Ga0105248_10002485 | 3300009177 | Bacteria | 20490 |
| 203 | Ga0105248_10050131 | 3300009177 | Bacteria | 4682 |
| 204 | Ga0105248_10747535 | 3300009177 | Bacteria | 1103 |
| 205 | Ga0105237_10001093 | 3300009545 | Bacteria | 36314 |
| 206 | Ga0105237_10014135 | 3300009545 | Bacteria | 8354 |
| 207 | Ga0105249_10001422 | 3300009553 | Bacteria | 20964 |
| 208 | Ga0105249_10006153 | 3300009553 | Bacteria | 10409 |
| 209 | Ga0105249_10007824 | 3300009553 | Bacteria | 9307 |
| 210 | Ga0105249_10019463 | 3300009553 | Bacteria | 6057 |
| 211 | Ga0105249_10067192 | 3300009553 | Bacteria | 3302 |
| 212 | Ga0105249_10089134 | 3300009553 | Bacteria | 2882 |
| 213 | Ga0105249_10123093 | 3300009553 | Bacteria | 2467 |
| 214 | Ga0105249_10145419 | 3300009553 | Bacteria | 2277 |
| 215 | Ga0105249_10153165 | 3300009553 | Bacteria | 2221 |
| 216 | Ga0105249_10343967 | 3300009553 | Bacteria | 1509 |
| 217 | Ga0105249_10359277 | 3300009553 | Bacteria | 1477 |
| 218 | Ga0105239_10009054 | 3300010375 | Bacteria | 11265 |
| 219 | Ga0157373_10006620 | 3300013100 | Bacteria | 8643 |
| 220 | Ga0157371_10000012 | 3300013102 | Bacteria | 355318 |
| 221 | Ga0157371_10059129 | 3300013102 | Bacteria | 2718 |
| 222 | Ga0157371_10061101 | 3300013102 | Bacteria | 2671 |
| 223 | Ga0157370_10001425 | 3300013104 | Bacteria | 29663 |
| 224 | Ga0157370_10009609 | 3300013104 | Bacteria | 10296 |
| 225 | Ga0157370_10018285 | 3300013104 | Bacteria | 7051 |
| 226 | Ga0157370_10022602 | 3300013104 | Bacteria | 6257 |
| 227 | Ga0157370_10157037 | 3300013104 | Bacteria | 2116 |
| 228 | Ga0157369_10006875 | 3300013105 | Bacteria | 13126 |
| 229 | Ga0157369_10106570 | 3300013105 | Bacteria | 2983 |
| 230 | Ga0157369_10132895 | 3300013105 | Bacteria | 2636 |
| 231 | Ga0157369_10133731 | 3300013105 | Bacteria | 2627 |
| 232 | Ga0157374_10006069 | 3300013296 | Bacteria | 10225 |
| 233 | Ga0157374_10120046 | 3300013296 | Bacteria | 2536 |
| 234 | Ga0157378_10004040 | 3300013297 | Bacteria | 12957 |
| 235 | Ga0157378_10011276 | 3300013297 | Bacteria | 7821 |
| 236 | Ga0157378_10046321 | 3300013297 | Bacteria | 3866 |
| 237 | Ga0157378_10070515 | 3300013297 | Bacteria | 3138 |
| 238 | Ga0157378_10087183 | 3300013297 | Bacteria | 2831 |
| 239 | Ga0157378_10114246 | 3300013297 | Bacteria | 2480 |
| 240 | Ga0157378_10182727 | 3300013297 | Bacteria | 1974 |
| 241 | Ga0163162_10000579 | 3300013306 | Bacteria | 33893 |
| 242 | Ga0163162_10001945 | 3300013306 | Bacteria | 19409 |
| 243 | Ga0163162_10002569 | 3300013306 | Bacteria | 17179 |
| 244 | Ga0163162_10002730 | 3300013306 | Bacteria | 16751 |
| 245 | Ga0163162_10003086 | 3300013306 | Bacteria | 15916 |
| 246 | Ga0163162_10021490 | 3300013306 | Bacteria | 6357 |
| 247 | Ga0163162_10134788 | 3300013306 | Bacteria | 2580 |
| 248 | Ga0157372_10021078 | 3300013307 | Bacteria | 7038 |
| 249 | Ga0157375_10002298 | 3300013308 | Bacteria | 16512 |
| 250 | Ga0157375_10002648 | 3300013308 | Bacteria | 15501 |
| 251 | Ga0157375_10008218 | 3300013308 | Bacteria | 9133 |
| 252 | Ga0157375_10032503 | 3300013308 | Bacteria | 4950 |
| 253 | Ga0157375_10051436 | 3300013308 | Bacteria | 4046 |
| 254 | Ga0157375_10055248 | 3300013308 | Bacteria | 3915 |
| 255 | Ga0157375_10106132 | 3300013308 | Bacteria | 2900 |
| 256 | Ga0157375_10119101 | 3300013308 | Bacteria | 2747 |
| 257 | Ga0157375_10180129 | 3300013308 | Bacteria | 2264 |
| 258 | Ga0157375_10263489 | 3300013308 | Bacteria | 1885 |
| 259 | Ga0157375_10497121 | 3300013308 | Bacteria | 1384 |
| 260 | Ga0163163_10000401 | 3300014325 | Bacteria | 40925 |
| 261 | Ga0163163_10014243 | 3300014325 | Bacteria | 7308 |
| 262 | Ga0163163_10086851 | 3300014325 | Bacteria | 3137 |
| 263 | Ga0163163_10155766 | 3300014325 | Unclassified | 2329 |
| 264 | Ga0163163_10203770 | 3300014325 | Bacteria | 2027 |
| 265 | Ga0157380_10000248 | 3300014326 | Bacteria | 32510 |
| 266 | Ga0157380_10002215 | 3300014326 | Bacteria | 13073 |
| 267 | Ga0157380_10010366 | 3300014326 | Bacteria | 6703 |
| 268 | Ga0157380_10015227 | 3300014326 | Bacteria | 5646 |
| 269 | Ga0182008_10000684 | 3300014497 | Bacteria | 24468 |
| 270 | Ga0182008_10029635 | 3300014497 | Bacteria | 2764 |
| 271 | Ga0157377_10003418 | 3300014745 | Bacteria | 7184 |
| 272 | Ga0157377_10136180 | 3300014745 | Bacteria | 1505 |
| 273 | Ga0157379_10053413 | 3300014968 | Bacteria | 3609 |
| 274 | Ga0157379_10095212 | 3300014968 | Bacteria | 2672 |
| 275 | Ga0157376_10006244 | 3300014969 | Bacteria | 8399 |
| 276 | Ga0157376_10006909 | 3300014969 | Bacteria | 8041 |
| 277 | Ga0157376_10030234 | 3300014969 | Bacteria | 4323 |
| 278 | Ga0157376_10036517 | 3300014969 | Bacteria | 3982 |
| 279 | Ga0157376_10132525 | 3300014969 | Bacteria | 2226 |
| 280 | Ga0182006_1000016 | 3300015261 | Bacteria | 303558 |
| 281 | Ga0163161_10001723 | 3300017792 | Bacteria | 16029 |
| 282 | Ga0163161_10001778 | 3300017792 | Bacteria | 15708 |
| 283 | Ga0163161_10003553 | 3300017792 | Bacteria | 10912 |
| 284 | Ga0163161_10005845 | 3300017792 | Bacteria | 8527 |
| 285 | Ga0163161_10183104 | 3300017792 | Bacteria | 1607 |
| 286 | Ga0213876_10006872 | 3300021384 | Bacteria | 6202 |
| 287 | Ga0209675_1000103 | 3300025291 | Bacteria | 121526 |
| 288 | Ga0207426_1000040 | 3300025302 | Bacteria | 433920 |
| 289 | Ga0207656_10000167 | 3300025321 | Bacteria | 24201 |
| 290 | Ga0207655_1000013 | 3300025728 | Bacteria | 637510 |
| 291 | Ga0207682_10065031 | 3300025893 | Bacteria | 1534 |
| 292 | Ga0207642_10031154 | 3300025899 | Bacteria | 2230 |
| 293 | Ga0207642_10055197 | 3300025899 | Bacteria | 1816 |
| 294 | Ga0207710_10000837 | 3300025900 | Bacteria | 16584 |
| 295 | Ga0207710_10057035 | 3300025900 | Bacteria | 1763 |
| 296 | Ga0207688_10004997 | 3300025901 | Bacteria | 7216 |
| 297 | Ga0207688_10138920 | 3300025901 | Bacteria | 1429 |
| 298 | Ga0207680_10000054 | 3300025903 | Bacteria | 54305 |
| 299 | Ga0207680_10048983 | 3300025903 | Bacteria | 2512 |
| 300 | Ga0207680_10145462 | 3300025903 | Bacteria | 1575 |
| 301 | Ga0207680_10232712 | 3300025903 | Bacteria | 1267 |
| 302 | Ga0207647_10005536 | 3300025904 | Bacteria | 9246 |
| 303 | Ga0207645_10000748 | 3300025907 | Bacteria | 27039 |
| 304 | Ga0207645_10017210 | 3300025907 | Bacteria | 4775 |
| 305 | Ga0207645_10138872 | 3300025907 | Bacteria | 1583 |
| 306 | Ga0207643_10007164 | 3300025908 | Bacteria | 5984 |
| 307 | Ga0207643_10020201 | 3300025908 | Unclassified | 3654 |
| 308 | Ga0207643_10142064 | 3300025908 | Bacteria | 1434 |
| 309 | Ga0207654_10004259 | 3300025911 | Bacteria | 7218 |
| 310 | Ga0207671_10001498 | 3300025914 | Bacteria | 26937 |
| 311 | Ga0207662_10172879 | 3300025918 | Bacteria | 1386 |
| 312 | Ga0207657_10050681 | 3300025919 | Bacteria | 3612 |
| 313 | Ga0207657_10261355 | 3300025919 | Bacteria | 1378 |
| 314 | Ga0207649_10046440 | 3300025920 | Bacteria | 2668 |
| 315 | Ga0207681_10082001 | 3300025923 | Bacteria | 2279 |
| 316 | Ga0207650_10030339 | 3300025925 | Bacteria | 3893 |
| 317 | Ga0207650_10030710 | 3300025925 | Bacteria | 3873 |
| 318 | Ga0207650_10320992 | 3300025925 | Bacteria | 1268 |
| 319 | Ga0207659_10108318 | 3300025926 | Bacteria | 2107 |
| 320 | Ga0207659_10316259 | 3300025926 | Bacteria | 1287 |
| 321 | Ga0207687_10109681 | 3300025927 | Bacteria | 2045 |
| 322 | Ga0207644_10035729 | 3300025931 | Bacteria | 3484 |
| 323 | Ga0207644_10118440 | 3300025931 | Bacteria | 2012 |
| 324 | Ga0207706_10026986 | 3300025933 | Bacteria | 5138 |
| 325 | Ga0207706_10027760 | 3300025933 | Bacteria | 5059 |
| 326 | Ga0207706_10280721 | 3300025933 | Bacteria | 1453 |
| 327 | Ga0207686_10090031 | 3300025934 | Bacteria | 2023 |
| 328 | Ga0207686_10187235 | 3300025934 | Bacteria | 1473 |
| 329 | Ga0207686_10218904 | 3300025934 | Bacteria | 1373 |
| 330 | Ga0207709_10000890 | 3300025935 | Bacteria | 22592 |
| 331 | Ga0207670_10077894 | 3300025936 | Bacteria | 2310 |
| 332 | Ga0207670_10259276 | 3300025936 | Bacteria | 1347 |
| 333 | Ga0207669_10011006 | 3300025937 | Bacteria | 4380 |
| 334 | Ga0207669_10237750 | 3300025937 | Bacteria | 1348 |
| 335 | Ga0207704_10175133 | 3300025938 | Bacteria | 1544 |
| 336 | Ga0207691_10073268 | 3300025940 | Unclassified | 3089 |
| 337 | Ga0207691_10092122 | 3300025940 | Bacteria | 2714 |
| 338 | Ga0207689_10000337 | 3300025942 | Bacteria | 43636 |
| 339 | Ga0207689_10000628 | 3300025942 | Bacteria | 33617 |
| 340 | Ga0207689_10003117 | 3300025942 | Bacteria | 15212 |
| 341 | Ga0207689_10013936 | 3300025942 | Bacteria | 6848 |
| 342 | Ga0207689_10020993 | 3300025942 | Bacteria | 5488 |
| 343 | Ga0207689_10026700 | 3300025942 | Bacteria | 4837 |
| 344 | Ga0207661_10004869 | 3300025944 | Bacteria | 9409 |
| 345 | Ga0207679_10002211 | 3300025945 | Bacteria | 12015 |
| 346 | Ga0207679_10040287 | 3300025945 | Bacteria | 3343 |
| 347 | Ga0207679_10328064 | 3300025945 | Bacteria | 1327 |
| 348 | Ga0207651_10028429 | 3300025960 | Unclassified | 3527 |
| 349 | Ga0207651_10169559 | 3300025960 | Bacteria | 1720 |
| 350 | Ga0207651_10198091 | 3300025960 | Bacteria | 1607 |
| 351 | Ga0207712_10000844 | 3300025961 | Bacteria | 22396 |
| 352 | Ga0207712_10027942 | 3300025961 | Bacteria | 3770 |
| 353 | Ga0207712_10039063 | 3300025961 | Bacteria | 3250 |
| 354 | Ga0207712_10089354 | 3300025961 | Bacteria | 2265 |
| 355 | Ga0207712_10089998 | 3300025961 | Bacteria | 2257 |
| 356 | Ga0207712_10139329 | 3300025961 | Bacteria | 1859 |
| 357 | Ga0207668_10193006 | 3300025972 | Bacteria | 1615 |
| 358 | Ga0207668_10306227 | 3300025972 | Bacteria | 1313 |
| 359 | Ga0207668_10398381 | 3300025972 | Bacteria | 1163 |
| 360 | Ga0207640_10102757 | 3300025981 | Bacteria | 2008 |
| 361 | Ga0207658_10010834 | 3300025986 | Bacteria | 6204 |
| 362 | Ga0207658_10013795 | 3300025986 | Bacteria | 5527 |
| 363 | Ga0207658_10022800 | 3300025986 | Bacteria | 4361 |
| 364 | Ga0207658_10067462 | 3300025986 | Bacteria | 2695 |
| 365 | Ga0207677_10001734 | 3300026023 | Bacteria | 11568 |
| 366 | Ga0207677_10008694 | 3300026023 | Bacteria | 5686 |
| 367 | Ga0207677_10073019 | 3300026023 | Bacteria | 2428 |
| 368 | Ga0207703_10005580 | 3300026035 | Bacteria | 10099 |
| 369 | Ga0207703_10346495 | 3300026035 | Bacteria | 1367 |
| 370 | Ga0207703_10378414 | 3300026035 | Bacteria | 1309 |
| 371 | Ga0207639_10002203 | 3300026041 | Bacteria | 13125 |
| 372 | Ga0207639_10018417 | 3300026041 | Bacteria | 4961 |
| 373 | Ga0207641_10000026 | 3300026088 | Bacteria | 245091 |
| 374 | Ga0207641_10043818 | 3300026088 | Bacteria | 3760 |
| 375 | Ga0207641_10111360 | 3300026088 | Bacteria | 2427 |
| 376 | Ga0207648_10000372 | 3300026089 | Bacteria | 49262 |
| 377 | Ga0207648_10018970 | 3300026089 | Bacteria | 6211 |
| 378 | Ga0207648_10021307 | 3300026089 | Bacteria | 5826 |
| 379 | Ga0207648_10061633 | 3300026089 | Bacteria | 3271 |
| 380 | Ga0207648_10159417 | 3300026089 | Bacteria | 1993 |
| 381 | Ga0207648_10167029 | 3300026089 | Bacteria | 1945 |
| 382 | Ga0207648_10212140 | 3300026089 | Bacteria | 1719 |
| 383 | Ga0207648_10344972 | 3300026089 | Unclassified | 1342 |
| 384 | Ga0207676_10004513 | 3300026095 | Bacteria | 9845 |
| 385 | Ga0207676_10030348 | 3300026095 | Bacteria | 4057 |
| 386 | Ga0207676_10038905 | 3300026095 | Unclassified | 3634 |
| 387 | Ga0207674_10006730 | 3300026116 | Bacteria | 13496 |
| 388 | Ga0207674_10010951 | 3300026116 | Bacteria | 10207 |
| 389 | Ga0207674_10108465 | 3300026116 | Bacteria | 2753 |
| 390 | Ga0207675_100001072 | 3300026118 | Bacteria | 27156 |
| 391 | Ga0207675_100022028 | 3300026118 | Bacteria | 5931 |
| 392 | Ga0207675_100042016 | 3300026118 | Bacteria | 4268 |
| 393 | Ga0207683_10001617 | 3300026121 | Bacteria | 20205 |
| 394 | Ga0207683_10044988 | 3300026121 | Bacteria | 3860 |
| 395 | Ga0207683_10314105 | 3300026121 | Bacteria | 1435 |
| 396 | Ga0207698_10126863 | 3300026142 | Bacteria | 2172 |
| 397 | Ga0207698_10221127 | 3300026142 | Bacteria | 1711 |
| 398 | Ga0207698_10276042 | 3300026142 | Bacteria | 1552 |
| 399 | Ga0268265_10089490 | 3300028380 | Bacteria | 2456 |
| 400 | Ga0268265_10188192 | 3300028380 | Bacteria | 1780 |
| 401 | Ga0268264_10008138 | 3300028381 | Bacteria | 8716 |
| 402 | Ga0268264_10018301 | 3300028381 | Bacteria | 5729 |
| 403 | Ga0268264_10022974 | 3300028381 | Bacteria | 5089 |
| 404 | Ga0268264_10029070 | 3300028381 | Bacteria | 4525 |
| 405 | Ga0268264_10206013 | 3300028381 | Bacteria | 1802 |
| 406 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 407 | Ga0307515_10007482 | 3300028794 | Bacteria | 21576 |
| 408 | Ga0265327_10000013 | 3300031251 | Bacteria | 519549 |
| 409 | Ga0265327_10024131 | 3300031251 | Bacteria | 3581 |
| 410 | Ga0265316_10247439 | 3300031344 | Bacteria | 1310 |
| 411 | Ga0307513_10117217 | 3300031456 | Bacteria | 2641 |
| 412 | Ga0265313_10040303 | 3300031595 | Unclassified | 2310 |
| 413 | Ga0316576_10136673 | 3300031727 | Bacteria | 1845 |
| 414 | Ga0316578_10023882 | 3300031728 | Unclassified | 3425 |
| 415 | Ga0316577_10001749 | 3300031733 | Bacteria | 10456 |
| 416 | Ga0316577_10004637 | 3300031733 | Bacteria | 7126 |
| 417 | Ga0316577_10005128 | 3300031733 | Bacteria | 6842 |
| 418 | Ga0307410_10030360 | 3300031852 | Unclassified | 3454 |
| 419 | Ga0307412_10000184 | 3300031911 | Bacteria | 43850 |
| 420 | Ga0307412_10000551 | 3300031911 | Bacteria | 22305 |
| 421 | Ga0307416_100000051 | 3300032002 | Bacteria | 115585 |
| 422 | Ga0307414_10000004 | 3300032004 | Bacteria | 472218 |
| 423 | Ga0307414_10031638 | 3300032004 | Bacteria | 3474 |
| 424 | Ga0307414_10046132 | 3300032004 | Bacteria | 2989 |
| 425 | Ga0307414_10061410 | 3300032004 | Bacteria | 2662 |
| 426 | Ga0307414_10254299 | 3300032004 | Bacteria | 1462 |
| 427 | Ga0307414_10254542 | 3300032004 | Bacteria | 1461 |
| 428 | Ga0373926_0007855 | 3300035083 | Bacteria | 3555 |
| 429 | Ga0373934_0009251 | 3300035086 | Bacteria | 3688 |
| 430 | Ga0373949_0036333 | 3300035090 | Bacteria | 1195 |
| 431 | Ga0373955_0004601 | 3300035172 | Bacteria | 6115 |
| 432 | Ga0316574_0010391 | 3300035398 | Bacteria | 5260 |
| 433 | Ga0316574_0192067 | 3300035398 | Bacteria | 1313 |
| 434 | Ga0373924_0005807 | 3300035410 | Bacteria | 4392 |
| 435 | Ga0373924_0095716 | 3300035410 | Bacteria | 1274 |
| 436 | Ga0373931_0028110 | 3300035691 | Unclassified | 2876 |
| 437 | Ga0373933_0015285 | 3300035724 | Bacteria | 4279 |
| 438 | Ga0373937_0002667 | 3300036401 | Bacteria | 14878 |
| 439 | Ga0316584_0029981 | 3300036712 | Unclassified | 4018 |
| 440 | Ga0316584_0044470 | 3300036712 | Unclassified | 3311 |
| 441 | Ga0373925_0193972 | 3300037068 | Bacteria | 1613 |
| 442 | Ga0316581_0009138 | 3300037588 | Bacteria | 2716 |
| 443 | Ga0400484_17565 | 3300038725 | Bacteria | 1567 |
| 444 | Ga0400484_33210 | 3300038725 | Bacteria | 2026 |
| 445 | Ga0400484_36796 | 3300038725 | Bacteria | 3069 |
| 446 | Ga0400483_006822 | 3300039062 | Bacteria | 2957 |
| 447 | Ga0400483_029114 | 3300039062 | Bacteria | 2070 |
| 448 | Ga0400483_088593 | 3300039062 | Bacteria | 2443 |
| 449 | Ga0400483_101201 | 3300039062 | Bacteria | 3778 |
| 450 | Ga0400483_288640 | 3300039062 | Bacteria | 2955 |
| 451 | Ga0436365_1656319 | 3300039437 | Bacteria | 11225 |
| 452 | Ga0436361_0751163 | 3300039447 | Bacteria | 1428 |
| 453 | Ga0451789_1247108 | 3300041443 | Bacteria | 1537 |
| 454 | Ga0451837_0890985 | 3300041494 | Bacteria | 5266 |
| 455 | Ga0439431_0042817 | 3300041997 | Bacteria | 1157 |
| 456 | Ga0439445_0000535 | 3300042004 | Bacteria | 7678 |
| 457 | Ga0439454_000970 | 3300042011 | Bacteria | 2564 |
| 458 | Ga0450898_002007 | 3300042134 | Bacteria | 2788 |
| 459 | Ga0450899_005788 | 3300042135 | Bacteria | 1331 |
| 460 | Ga0450904_006452 | 3300042139 | Bacteria | 1170 |
| 461 | Ga0451577_0044831 | 3300042876 | Bacteria | 3958 |
| 462 | Ga0451577_0072954 | 3300042876 | Bacteria | 3063 |
| 463 | Ga0466972_0000146 | 3300044658 | Bacteria | 57580 |
| 464 | Ga0453683_0000438 | 3300044673 | Bacteria | 47738 |
| 465 | Ga0453683_0116159 | 3300044673 | Bacteria | 1684 |
| 466 | Ga0453683_0169626 | 3300044673 | Bacteria | 1382 |
| 467 | Ga0453684_0003280 | 3300044712 | Bacteria | 36908 |
| 468 | Ga0453684_0021278 | 3300044712 | Bacteria | 9703 |
| 469 | Ga0453684_0022637 | 3300044712 | Bacteria | 9311 |
| 470 | Ga0453684_0179910 | 3300044712 | Bacteria | 2483 |
| 471 | Ga0466970_0000169 | 3300044765 | Bacteria | 31008 |
| 472 | Ga0495627_000002 | 3300046453 | Bacteria | 903861 |
| 473 | Ga0495627_021367 | 3300046453 | Bacteria | 2147 |
| 474 | Ga0495590_0007763 | 3300046457 | Bacteria | 4118 |
| 475 | Ga0495638_0163379 | 3300046460 | Bacteria | 1283 |
| 476 | Ga0495580_0061854 | 3300046472 | Bacteria | 2628 |
| 477 | Ga0495594_0145457 | 3300046499 | Bacteria | 1345 |
| 478 | Ga0495596_0001340 | 3300046500 | Bacteria | 14167 |
| 479 | Ga0495606_0022518 | 3300046507 | Bacteria | 4588 |
| 480 | Ga0495606_0068657 | 3300046507 | Bacteria | 2242 |
| 481 | Ga0495608_0104404 | 3300046511 | Bacteria | 1825 |
| 482 | Ga0495610_0000009 | 3300046512 | Bacteria | 554843 |
| 483 | Ga0495630_0008167 | 3300046517 | Bacteria | 7518 |
| 484 | Ga0495632_0001733 | 3300046519 | Bacteria | 17686 |
| 485 | Ga0495643_0042896 | 3300046522 | Bacteria | 2463 |
| 486 | Ga0495643_0066223 | 3300046522 | Bacteria | 1906 |
| 487 | Ga0495643_0138771 | 3300046522 | Bacteria | 1214 |
| 488 | Ga0495663_0000065 | 3300046525 | Bacteria | 49401 |
| 489 | Ga0495652_0087187 | 3300046529 | Bacteria | 2561 |
| 490 | Ga0495654_0000056 | 3300046530 | Bacteria | 140658 |
| 491 | Ga0495609_0000063 | 3300046538 | Bacteria | 135584 |
| 492 | Ga0495633_0000003 | 3300046558 | Bacteria | 472476 |
| 493 | Ga0495633_0000805 | 3300046558 | Bacteria | 27889 |
| 494 | Ga0495656_0007055 | 3300046615 | Bacteria | 3960 |
| 495 | Ga0495668_0000023 | 3300046616 | Bacteria | 363848 |
| 496 | Ga0495668_0002875 | 3300046616 | Bacteria | 13651 |
| 497 | Ga0495625_0000560 | 3300046660 | Bacteria | 54525 |
| 498 | Ga0495635_0264309 | 3300046663 | Bacteria | 1158 |
| 499 | Ga0495649_0000619 | 3300046694 | Bacteria | 29384 |
| 500 | Ga0495604_0048545 | 3300047317 | Bacteria | 3302 |
| 501 | Ga0495674_0264110 | 3300047319 | Bacteria | 1414 |
| 502 | Ga0495672_0028614 | 3300047320 | Bacteria | 3522 |
| 503 | Ga0495680_0110530 | 3300047322 | Bacteria | 2037 |
| 504 | Ga0495684_0029757 | 3300047471 | Bacteria | 4191 |
| 505 | Ga0495686_0000144 | 3300047472 | Bacteria | 142704 |
| 506 | Ga0495686_0005176 | 3300047472 | Bacteria | 10383 |
| 507 | Ga0495686_0048335 | 3300047472 | Bacteria | 2683 |
| 508 | Ga0496100_0355515 | 3300048903 | Unclassified | 1107 |
| 509 | Ga0496101_0059649 | 3300048904 | Bacteria | 2766 |
| 510 | Ga0496102_0046632 | 3300048905 | Bacteria | 3936 |
| 511 | Ga0496110_0134416 | 3300048913 | Bacteria | 2235 |
| 512 | Ga0496110_0427817 | 3300048913 | Bacteria | 1207 |
| 513 | Ga0496111_0050742 | 3300048914 | Bacteria | 2994 |
| 514 | Ga0496113_0248729 | 3300048916 | Bacteria | 1419 |
| 515 | Ga0496114_0195320 | 3300048917 | Bacteria | 1771 |
| 516 | Ga0496116_0000006 | 3300048919 | Bacteria | 811937 |
| 517 | Ga0496117_0000491 | 3300048920 | Bacteria | 65366 |
| 518 | Ga0496118_0000543 | 3300048921 | Bacteria | 62008 |
| 519 | Ga0496119_0000379 | 3300048922 | Bacteria | 61360 |
| 520 | Ga0496122_0000334 | 3300048925 | Bacteria | 102325 |
| 521 | Ga0496122_0000486 | 3300048925 | Bacteria | 82431 |
| 522 | Ga0496122_0000775 | 3300048925 | Bacteria | 61542 |
| 523 | Ga0496122_0001546 | 3300048925 | Bacteria | 36521 |
| 524 | Ga0496122_0002699 | 3300048925 | Bacteria | 24684 |
| 525 | Ga0496123_0001808 | 3300048926 | Bacteria | 28164 |
| 526 | Ga0496123_0002784 | 3300048926 | Bacteria | 20812 |
| 527 | Ga0496123_0039971 | 3300048926 | Bacteria | 3274 |
| 528 | Ga0496123_0047124 | 3300048926 | Bacteria | 2916 |
| 529 | Ga0496124_0010448 | 3300048927 | Bacteria | 9396 |
| 530 | Ga0496124_0075338 | 3300048927 | Bacteria | 2788 |
| 531 | Ga0496125_0001284 | 3300048928 | Bacteria | 37298 |
| 532 | Ga0496125_0002600 | 3300048928 | Bacteria | 23176 |
| 533 | Ga0496126_0001645 | 3300048929 | Bacteria | 33724 |
| 534 | Ga0501032_0030572 | 3300049569 | Bacteria | 3696 |
| 535 | Ga0501034_0000152 | 3300049571 | Bacteria | 130576 |
| 536 | Ga0501034_0003578 | 3300049571 | Bacteria | 17643 |
| 537 | Ga0501034_0099189 | 3300049571 | Bacteria | 2908 |
| 538 | Ga0501034_0145959 | 3300049571 | Bacteria | 2343 |
| 539 | Ga0501034_0279316 | 3300049571 | Bacteria | 1610 |
| 540 | Ga0501037_0004609 | 3300049573 | Bacteria | 10016 |
| 541 | Ga0501037_0465259 | 3300049573 | Bacteria | 861 |
| 542 | Ga0501038_0077080 | 3300049574 | Bacteria | 2815 |
| 543 | Ga0501038_0122053 | 3300049574 | Bacteria | 2147 |
| 544 | Ga0501039_0104660 | 3300049575 | Bacteria | 2209 |
| 545 | Ga0501040_0100245 | 3300049576 | Bacteria | 2019 |
| 546 | Ga0501043_0355626 | 3300049579 | Bacteria | 1112 |
| 547 | Ga0501047_0020753 | 3300049581 | Bacteria | 6310 |
| 548 | Ga0501047_0160990 | 3300049581 | Bacteria | 2116 |
| 549 | Ga0501067_0003375 | 3300049583 | Bacteria | 8778 |
| 550 | Ga0501067_0040932 | 3300049583 | Bacteria | 2574 |
| 551 | Ga0501067_0042141 | 3300049583 | Bacteria | 2534 |
| 552 | Ga0501068_0219572 | 3300049584 | Bacteria | 1208 |
| 553 | Ga0501070_0040124 | 3300049586 | Bacteria | 3904 |
| 554 | Ga0501073_0028030 | 3300049589 | Bacteria | 4023 |
| 555 | Ga0501073_0253066 | 3300049589 | Bacteria | 1216 |
| 556 | Ga0501073_0262148 | 3300049589 | Bacteria | 1193 |
| 557 | Ga0501074_0082340 | 3300049590 | Bacteria | 2308 |
| 558 | Ga0501077_0061912 | 3300049593 | Bacteria | 2375 |
| 559 | Ga0501219_000281 | 3300049703 | Bacteria | 9039 |
| 560 | Ga0501080_0144694 | 3300049742 | Bacteria | 2197 |
| 561 | Ga0501080_0197699 | 3300049742 | Bacteria | 1846 |
| 562 | Ga0501080_0346019 | 3300049742 | Bacteria | 1343 |
| 563 | Ga0501083_0025284 | 3300049744 | Bacteria | 4110 |
| 564 | Ga0501241_000029 | 3300049758 | Bacteria | 55736 |
| 565 | Ga0501241_003940 | 3300049758 | Bacteria | 2793 |
| 566 | Ga0501269_000008 | 3300049766 | Bacteria | 71498 |
| 567 | Ga0501035_0017525 | 3300049822 | Bacteria | 6608 |
| 568 | Ga0501035_0180943 | 3300049822 | Bacteria | 1816 |
| 569 | Ga0501035_0286821 | 3300049822 | Bacteria | 1390 |
| 570 | Ga0501044_0055704 | 3300049823 | Bacteria | 4060 |
| 571 | Ga0501044_0214481 | 3300049823 | Bacteria | 1878 |
| 572 | Ga0501284_00002 | 3300050005 | Bacteria | 220402 |
| 573 | nmdc:mga0k408_37721_c1 | 3300050493 | Bacteria | 2774 |
| 574 | nmdc:mga0k408_37816_c1 | 3300050493 | Bacteria | 2771 |
| 575 | nmdc:mga05p37_569_c2 | 3300050507 | Bacteria | 24307 |
| 576 | Ga0495619_0046338 | 3300053085 | Bacteria | 2859 |
| 577 | Ga0500643_000698 | 3300053087 | Bacteria | 22326 |
| 578 | Ga0500651_0065700 | 3300053093 | Bacteria | 2260 |
| 579 | Ga0500641_0016230 | 3300053096 | Bacteria | 2771 |
| 580 | Ga0500618_013300 | 3300053125 | Bacteria | 2131 |
| 581 | Ga0500611_000003 | 3300053727 | Bacteria | 333431 |
| 582 | Ga0501084_0223350 | 3300054114 | Bacteria | 1589 |
| 583 | 2511232242 | 2511231000 | Bacteria | 4488346 |
| 584 | 2524006983 | 2523533629 | Bacteria | 2982326 |
| 585 | 2585144988 | 2582581278 | Bacteria | 5296881 |
| 586 | 2585159217 | 2582581281 | Bacteria | 4487904 |
| 587 | 2585163498 | 2582581282 | Bacteria | 4495830 |
| 588 | 2585425586 | 2582581873 | Bacteria | 3032664 |
| 589 | 2587678205 | 2585428045 | Bacteria | 5203023 |
| 590 | 2587748207 | 2585428060 | Bacteria | 5304711 |
| 591 | 2587753560 | 2585428061 | Bacteria | 3939663 |
| 592 | 2587865411 | 2585428095 | Bacteria | 3789702 |
| 593 | 2587944248 | 2585428115 | Bacteria | 4420269 |
| 594 | 2588209925 | 2585428182 | Bacteria | 5007281 |
| 595 | 2588214899 | 2585428183 | Bacteria | 5166119 |
| 596 | 2588218119 | 2585428184 | Bacteria | 4978681 |
| 597 | 2588222674 | 2585428185 | Bacteria | 4969476 |
| 598 | 2588231469 | 2585428187 | Bacteria | 4629388 |
| 599 | 2588444562 | 2588253712 | Bacteria | 5403181 |
| 600 | 2590602629 | 2588254255 | Bacteria | 5014294 |
| 601 | 2590613060 | 2588254257 | Bacteria | 5436094 |
| 602 | 2729199606 | 2728369107 | Bacteria | 5082720 |
| 603 | 2738699083 | 2738541273 | Bacteria | 4048577 |
| 604 | 2739254799 | 2738543014 | Bacteria | 4048139 |
| 605 | 2740032961 | 2739367866 | Bacteria | 4215900 |
| 606 | 2740058667 | 2739367874 | Bacteria | 4872888 |
| 607 | 2753670760 | 2751185877 | Bacteria | 4921427 |
| 608 | 2765573697 | 2765235839 | Bacteria | 5314748 |
| 609 | 2772606973 | 2772190705 | Bacteria | 4666226 |
| 610 | 2775672261 | 2775506739 | Bacteria | 3855222 |
| 611 | 2816874044 | 2816332188 | Bacteria | 5133218 |
| 612 | 2839992777 | 2839989709 | Bacteria | 3773432 |
| 613 | 2842088127 | 2842083920 | Bacteria | 4857652 |
| 614 | 2871720591 | 2871720351 | Bacteria | 4862476 |
| 615 | 2889295708 | 2889290771 | Bacteria | 5530962 |
| 616 | 2906000426 | 2905999023 | Bacteria | 4591259 |
| 617 | 2910247594 | 2910245624 | Bacteria | 6935613 |
| 618 | 2919099133 | 2919097161 | Bacteria | 3860339 |
| 619 | 2919399806 | 2919399522 | Bacteria | 5164947 |
| 620 | 2928974940 | 2928972540 | Bacteria | 3058286 |
| 621 | 2945926320 | 2945924605 | Bacteria | 4296724 |
| 622 | 2946022292 | 2946019816 | Bacteria | 4621265 |
| 623 | 2977242017 | 2977240413 | Bacteria | 3191065 |
| 624 | 2977245310 | 2977243572 | Bacteria | 4374394 |
| 625 | 2984572788 | 2984572630 | Bacteria | 4186940 |
| 626 | 2984610238 | 2984606641 | Bacteria | 4186971 |
| 627 | 2993372825 | 2993372514 | Bacteria | 4214139 |
| 628 | 2993483489 | 2993480792 | Bacteria | 4022225 |
| 629 | rootH1_10186422 | |||
| 630 | JGI24741J21665_1004093 | |||
| 631 | JGI24740J21852_10004256 | |||
| 632 | JGI25406J46586_10003794 | |||
| 633 | rootL2_10119958 | |||
| 634 | rootL2_10193522 | |||
| 635 | rootH1_10026469 | |||
| 636 | JGI25160J50197_1000912 | |||
| 637 | Ga0065714_10070919 | |||
| 638 | Ga0065714_10104632 | |||
| 639 | Ga0065704_10074654 | |||
| 640 | Ga0065704_10089097 | |||
| 641 | Ga0065712_10142849 | |||
| 642 | Ga0065712_10161806 | |||
| 643 | Ga0065715_10234060 | |||
| 644 | Ga0065715_10249922 | |||
| 645 | Ga0065707_10008827 | |||
| 646 | Ga0070676_10005217 | |||
| 647 | Ga0070676_10020770 | |||
| 648 | Ga0070676_10105200 | |||
| 649 | Ga0070683_100003599 | |||
| 650 | Ga0070683_100125605 | |||
| 651 | Ga0070683_100131378 | |||
| 652 | Ga0070690_100097891 | |||
| 653 | Ga0070690_100114118 | |||
| 654 | Ga0070670_100012714 | |||
| 655 | Ga0070670_100052599 | |||
| 656 | Ga0070670_100071585 | |||
| 657 | Ga0070670_100093511 | |||
| 658 | Ga0070670_100103297 | |||
| 659 | Ga0070670_100278242 | |||
| 660 | Ga0068869_100004070 | |||
| 661 | Ga0068869_100035028 | |||
| 662 | Ga0068869_100053181 | |||
| 663 | Ga0068869_100072689 | |||
| 664 | Ga0068869_100082031 | |||
| 665 | Ga0068869_100087617 | |||
| 666 | Ga0068869_100092239 | |||
| 667 | Ga0070666_10000064 | |||
| 668 | Ga0070666_10025660 | |||
| 669 | Ga0070666_10065042 | |||
| 670 | Ga0070666_10319829 | |||
| 671 | Ga0070682_100000041 | |||
| 672 | Ga0070682_100000251 | |||
| 673 | Ga0068868_100010337 | |||
| 674 | Ga0068868_100011564 | |||
| 675 | Ga0068868_100232903 | |||
| 676 | Ga0070660_100359929 | |||
| 677 | Ga0070689_100004075 | |||
| 678 | Ga0070689_100013479 | |||
| 679 | Ga0070689_100021838 | |||
| 680 | Ga0070689_100310830 | |||
| 681 | Ga0070661_100018669 | |||
| 682 | Ga0070668_100029119 | |||
| 683 | Ga0070668_100031692 | |||
| 684 | Ga0070668_100335636 | |||
| 685 | Ga0070669_100012514 | |||
| 686 | Ga0070669_100114533 | |||
| 687 | Ga0070675_100019691 | |||
| 688 | Ga0070675_100029134 | |||
| 689 | Ga0070675_100032856 | |||
| 690 | Ga0070675_100220146 | |||
| 691 | Ga0070675_100464775 | |||
| 692 | Ga0070671_100039379 | |||
| 693 | Ga0070671_100041838 | |||
| 694 | Ga0070671_100113096 | |||
| 695 | Ga0070671_100274956 | |||
| 696 | Ga0070674_100020055 | |||
| 697 | Ga0070674_100050388 | |||
| 698 | Ga0070674_100054635 | |||
| 699 | Ga0070674_100126299 | |||
| 700 | Ga0070673_100059631 | |||
| 701 | Ga0070659_100133308 | |||
| 702 | Ga0070667_100007241 | |||
| 703 | Ga0070667_100011918 | |||
| 704 | Ga0070667_100020250 | |||
| 705 | Ga0070667_100120411 | |||
| 706 | Ga0070701_10021013 | |||
| 707 | Ga0070705_100095925 | |||
| 708 | Ga0070705_100298513 | |||
| 709 | Ga0070700_100208317 | |||
| 710 | Ga0070678_100033638 | |||
| 711 | Ga0070662_100020905 | |||
| 712 | Ga0070662_100025032 | |||
| 713 | Ga0070662_100048568 | |||
| 714 | Ga0070662_100384142 | |||
| 715 | Ga0068867_100026168 | |||
| 716 | Ga0068867_100036762 | |||
| 717 | Ga0068867_100144633 | |||
| 718 | Ga0068867_100365196 | |||
| 719 | Ga0070685_10201849 | |||
| 720 | Ga0070706_100067646 | |||
| 721 | Ga0070684_100005000 | |||
| 722 | Ga0070684_100011331 | |||
| 723 | Ga0070684_100236707 | |||
| 724 | Ga0070684_100319154 | |||
| 725 | Ga0068853_100002818 | |||
| 726 | Ga0068853_100009011 | |||
| 727 | Ga0068853_100011823 | |||
| 728 | Ga0068853_100180780 | |||
| 729 | Ga0068853_100202069 | |||
| 730 | Ga0070672_100089614 | |||
| 731 | Ga0070672_100188953 | |||
| 732 | Ga0070672_100236358 | |||
| 733 | Ga0070672_100261775 | |||
| 734 | Ga0070672_100323579 | |||
| 735 | Ga0070686_100026141 | |||
| 736 | Ga0070693_100121378 | |||
| 737 | Ga0070665_100047753 | |||
| 738 | Ga0070665_100077931 | |||
| 739 | Ga0070665_100155308 | |||
| 740 | Ga0070665_100188615 | |||
| 741 | Ga0070664_100009001 | |||
| 742 | Ga0070664_100098480 | |||
| 743 | Ga0070664_100373746 | |||
| 744 | Ga0068857_100019122 | |||
| 745 | Ga0068857_100285067 | |||
| 746 | Ga0070702_100148723 | |||
| 747 | Ga0070702_100190394 | |||
| 748 | Ga0068852_100080977 | |||
| 749 | Ga0068852_100188185 | |||
| 750 | Ga0068852_100196414 | |||
| 751 | Ga0068859_100000003 | |||
| 752 | Ga0068859_100000872 | |||
| 753 | Ga0068859_100025447 | |||
| 754 | Ga0068859_100031440 | |||
| 755 | Ga0068859_100063757 | |||
| 756 | Ga0068859_100076736 | |||
| 757 | Ga0068859_100368761 | |||
| 758 | Ga0068859_100634962 | |||
| 759 | Ga0068864_100002531 | |||
| 760 | Ga0068864_100007444 | |||
| 761 | Ga0068864_100051658 | |||
| 762 | Ga0068864_100084464 | |||
| 763 | Ga0068864_100258057 | |||
| 764 | Ga0068866_10020328 | |||
| 765 | Ga0068866_10046772 | |||
| 766 | Ga0068861_100005990 | |||
| 767 | Ga0068861_100019977 | |||
| 768 | Ga0068861_100102988 | |||
| 769 | Ga0068851_10000117 | |||
| 770 | Ga0068851_10009566 | |||
| 771 | Ga0068851_10072811 | |||
| 772 | Ga0068870_10046317 | |||
| 773 | Ga0068863_100005585 | |||
| 774 | Ga0068863_100014768 | |||
| 775 | Ga0068863_100255115 | |||
| 776 | Ga0068858_100020164 | |||
| 777 | Ga0068858_100086152 | |||
| 778 | Ga0068858_100305125 | |||
| 779 | Ga0068858_100398721 | |||
| 780 | Ga0068860_100001759 | |||
| 781 | Ga0068860_100003400 | |||
| 782 | Ga0068860_100013798 | |||
| 783 | Ga0068860_100054400 | |||
| 784 | Ga0068860_100312149 | |||
| 785 | Ga0068862_100164046 | |||
| 786 | Ga0068862_100168728 | |||
| 787 | Ga0068862_100230173 | |||
| 788 | Ga0068862_100550710 | |||
| 789 | Ga0081539_10000382 | |||
| 790 | Ga0075366_10013250 | |||
| 791 | Ga0075366_10033313 | |||
| 792 | Ga0097621_100000109 | |||
| 793 | Ga0097621_100031989 | |||
| 794 | Ga0097621_100041789 | |||
| 795 | Ga0097621_100062609 | |||
| 796 | Ga0068871_100001161 | |||
| 797 | Ga0068871_100029457 | |||
| 798 | Ga0068871_100085698 | |||
| 799 | Ga0068871_100089275 | |||
| 800 | Ga0068871_100254411 | |||
| 801 | Ga0068871_100271456 | |||
| 802 | Ga0068865_100037684 | |||
| 803 | Ga0068865_100059763 | |||
| 804 | Ga0068865_100089827 | |||
| 805 | Ga0068865_100109653 | |||
| 806 | Ga0068865_100133353 | |||
| 807 | Ga0097620_100000003 | |||
| 808 | Ga0097620_100000872 | |||
| 809 | Ga0097620_100025447 | |||
| 810 | Ga0097620_100031439 | |||
| 811 | Ga0097620_100063758 | |||
| 812 | Ga0097620_100076731 | |||
| 813 | Ga0097620_100368791 | |||
| 814 | Ga0097620_100635014 | |||
| 815 | Ga0075435_100008606 | |||
| 816 | Ga0105244_10000102 | |||
| 817 | Ga0111539_10027777 | |||
| 818 | Ga0111539_10130528 | |||
| 819 | Ga0105245_10196362 | |||
| 820 | Ga0105245_10400620 | |||
| 821 | Ga0105247_10001414 | |||
| 822 | Ga0105247_10100105 | |||
| 823 | Ga0114129_10000574 | |||
| 824 | Ga0105243_10000696 | |||
| 825 | Ga0105243_10234757 | |||
| 826 | Ga0105241_10001052 | |||
| 827 | Ga0105242_10062366 | |||
| 828 | Ga0105242_10117909 | |||
| 829 | Ga0105242_10119081 | |||
| 830 | Ga0105248_10002485 | |||
| 831 | Ga0105248_10050131 | |||
| 832 | Ga0105248_10747535 | |||
| 833 | Ga0105237_10001093 | |||
| 834 | Ga0105237_10014135 | |||
| 835 | Ga0105249_10001422 | |||
| 836 | Ga0105249_10006153 | |||
| 837 | Ga0105249_10007824 | |||
| 838 | Ga0105249_10019463 | |||
| 839 | Ga0105249_10067192 | |||
| 840 | Ga0105249_10089134 | |||
| 841 | Ga0105249_10123093 | |||
| 842 | Ga0105249_10145419 | |||
| 843 | Ga0105249_10153165 | |||
| 844 | Ga0105249_10343967 | |||
| 845 | Ga0105249_10359277 | |||
| 846 | Ga0105239_10009054 | |||
| 847 | Ga0157373_10006620 | |||
| 848 | Ga0157371_10000012 | |||
| 849 | Ga0157371_10059129 | |||
| 850 | Ga0157371_10061101 | |||
| 851 | Ga0157370_10001425 | |||
| 852 | Ga0157370_10009609 | |||
| 853 | Ga0157370_10018285 | |||
| 854 | Ga0157370_10022602 | |||
| 855 | Ga0157370_10157037 | |||
| 856 | Ga0157369_10006875 | |||
| 857 | Ga0157369_10106570 | |||
| 858 | Ga0157369_10132895 | |||
| 859 | Ga0157369_10133731 | |||
| 860 | Ga0157374_10006069 | |||
| 861 | Ga0157374_10120046 | |||
| 862 | Ga0157378_10004040 | |||
| 863 | Ga0157378_10011276 | |||
| 864 | Ga0157378_10046321 | |||
| 865 | Ga0157378_10070515 | |||
| 866 | Ga0157378_10087183 | |||
| 867 | Ga0157378_10114246 | |||
| 868 | Ga0157378_10182727 | |||
| 869 | Ga0163162_10000579 | |||
| 870 | Ga0163162_10001945 | |||
| 871 | Ga0163162_10002569 | |||
| 872 | Ga0163162_10002730 | |||
| 873 | Ga0163162_10003086 | |||
| 874 | Ga0163162_10021490 | |||
| 875 | Ga0163162_10134788 | |||
| 876 | Ga0157372_10021078 | |||
| 877 | Ga0157375_10002298 | |||
| 878 | Ga0157375_10002648 | |||
| 879 | Ga0157375_10008218 | |||
| 880 | Ga0157375_10032503 | |||
| 881 | Ga0157375_10051436 | |||
| 882 | Ga0157375_10055248 | |||
| 883 | Ga0157375_10106132 | |||
| 884 | Ga0157375_10119101 | |||
| 885 | Ga0157375_10180129 | |||
| 886 | Ga0157375_10263489 | |||
| 887 | Ga0157375_10497121 | |||
| 888 | Ga0163163_10000401 | |||
| 889 | Ga0163163_10014243 | |||
| 890 | Ga0163163_10086851 | |||
| 891 | Ga0163163_10155766 | |||
| 892 | Ga0163163_10203770 | |||
| 893 | Ga0157380_10000248 | |||
| 894 | Ga0157380_10002215 | |||
| 895 | Ga0157380_10010366 | |||
| 896 | Ga0157380_10015227 | |||
| 897 | Ga0182008_10000684 | |||
| 898 | Ga0182008_10029635 | |||
| 899 | Ga0157377_10003418 | |||
| 900 | Ga0157377_10136180 | |||
| 901 | Ga0157379_10053413 | |||
| 902 | Ga0157379_10095212 | |||
| 903 | Ga0157376_10006244 | |||
| 904 | Ga0157376_10006909 | |||
| 905 | Ga0157376_10030234 | |||
| 906 | Ga0157376_10036517 | |||
| 907 | Ga0157376_10132525 | |||
| 908 | Ga0182006_1000016 | |||
| 909 | Ga0163161_10001723 | |||
| 910 | Ga0163161_10001778 | |||
| 911 | Ga0163161_10003553 | |||
| 912 | Ga0163161_10005845 | |||
| 913 | Ga0163161_10183104 | |||
| 914 | Ga0213876_10006872 | |||
| 915 | Ga0209675_1000103 | |||
| 916 | Ga0207426_1000040 | |||
| 917 | Ga0207656_10000167 | |||
| 918 | Ga0207655_1000013 | |||
| 919 | Ga0207682_10065031 | |||
| 920 | Ga0207642_10031154 | |||
| 921 | Ga0207642_10055197 | |||
| 922 | Ga0207710_10000837 | |||
| 923 | Ga0207710_10057035 | |||
| 924 | Ga0207688_10004997 | |||
| 925 | Ga0207688_10138920 | |||
| 926 | Ga0207680_10000054 | |||
| 927 | Ga0207680_10048983 | |||
| 928 | Ga0207680_10145462 | |||
| 929 | Ga0207680_10232712 | |||
| 930 | Ga0207647_10005536 | |||
| 931 | Ga0207645_10000748 | |||
| 932 | Ga0207645_10017210 | |||
| 933 | Ga0207645_10138872 | |||
| 934 | Ga0207643_10007164 | |||
| 935 | Ga0207643_10020201 | |||
| 936 | Ga0207643_10142064 | |||
| 937 | Ga0207654_10004259 | |||
| 938 | Ga0207671_10001498 | |||
| 939 | Ga0207662_10172879 | |||
| 940 | Ga0207657_10050681 | |||
| 941 | Ga0207657_10261355 | |||
| 942 | Ga0207649_10046440 | |||
| 943 | Ga0207681_10082001 | |||
| 944 | Ga0207650_10030339 | |||
| 945 | Ga0207650_10030710 | |||
| 946 | Ga0207650_10320992 | |||
| 947 | Ga0207659_10108318 | |||
| 948 | Ga0207659_10316259 | |||
| 949 | Ga0207687_10109681 | |||
| 950 | Ga0207644_10035729 | |||
| 951 | Ga0207644_10118440 | |||
| 952 | Ga0207706_10026986 | |||
| 953 | Ga0207706_10027760 | |||
| 954 | Ga0207706_10280721 | |||
| 955 | Ga0207686_10090031 | |||
| 956 | Ga0207686_10187235 | |||
| 957 | Ga0207686_10218904 | |||
| 958 | Ga0207709_10000890 | |||
| 959 | Ga0207670_10077894 | |||
| 960 | Ga0207670_10259276 | |||
| 961 | Ga0207669_10011006 | |||
| 962 | Ga0207669_10237750 | |||
| 963 | Ga0207704_10175133 | |||
| 964 | Ga0207691_10073268 | |||
| 965 | Ga0207691_10092122 | |||
| 966 | Ga0207689_10000337 | |||
| 967 | Ga0207689_10000628 | |||
| 968 | Ga0207689_10003117 | |||
| 969 | Ga0207689_10013936 | |||
| 970 | Ga0207689_10020993 | |||
| 971 | Ga0207689_10026700 | |||
| 972 | Ga0207661_10004869 | |||
| 973 | Ga0207679_10002211 | |||
| 974 | Ga0207679_10040287 | |||
| 975 | Ga0207679_10328064 | |||
| 976 | Ga0207651_10028429 | |||
| 977 | Ga0207651_10169559 | |||
| 978 | Ga0207651_10198091 | |||
| 979 | Ga0207712_10000844 | |||
| 980 | Ga0207712_10027942 | |||
| 981 | Ga0207712_10039063 | |||
| 982 | Ga0207712_10089354 | |||
| 983 | Ga0207712_10089998 | |||
| 984 | Ga0207712_10139329 | |||
| 985 | Ga0207668_10193006 | |||
| 986 | Ga0207668_10306227 | |||
| 987 | Ga0207668_10398381 | |||
| 988 | Ga0207640_10102757 | |||
| 989 | Ga0207658_10010834 | |||
| 990 | Ga0207658_10013795 | |||
| 991 | Ga0207658_10022800 | |||
| 992 | Ga0207658_10067462 | |||
| 993 | Ga0207677_10001734 | |||
| 994 | Ga0207677_10008694 | |||
| 995 | Ga0207677_10073019 | |||
| 996 | Ga0207703_10005580 | |||
| 997 | Ga0207703_10346495 | |||
| 998 | Ga0207703_10378414 | |||
| 999 | Ga0207639_10002203 | |||
| 1000 | Ga0207639_10018417 | |||
| 1001 | Ga0207641_10000026 | |||
| 1002 | Ga0207641_10043818 | |||
| 1003 | Ga0207641_10111360 | |||
| 1004 | Ga0207648_10000372 | |||
| 1005 | Ga0207648_10018970 | |||
| 1006 | Ga0207648_10021307 | |||
| 1007 | Ga0207648_10061633 | |||
| 1008 | Ga0207648_10159417 | |||
| 1009 | Ga0207648_10167029 | |||
| 1010 | Ga0207648_10212140 | |||
| 1011 | Ga0207648_10344972 | |||
| 1012 | Ga0207676_10004513 | |||
| 1013 | Ga0207676_10030348 | |||
| 1014 | Ga0207676_10038905 | |||
| 1015 | Ga0207674_10006730 | |||
| 1016 | Ga0207674_10010951 | |||
| 1017 | Ga0207674_10108465 | |||
| 1018 | Ga0207675_100001072 | |||
| 1019 | Ga0207675_100022028 | |||
| 1020 | Ga0207675_100042016 | |||
| 1021 | Ga0207683_10001617 | |||
| 1022 | Ga0207683_10044988 | |||
| 1023 | Ga0207683_10314105 | |||
| 1024 | Ga0207698_10126863 | |||
| 1025 | Ga0207698_10221127 | |||
| 1026 | Ga0207698_10276042 | |||
| 1027 | Ga0268265_10089490 | |||
| 1028 | Ga0268265_10188192 | |||
| 1029 | Ga0268264_10008138 | |||
| 1030 | Ga0268264_10018301 | |||
| 1031 | Ga0268264_10022974 | |||
| 1032 | Ga0268264_10029070 | |||
| 1033 | Ga0268264_10206013 | |||
| 1034 | Ga0307515_10000001 | |||
| 1035 | Ga0307515_10007482 | |||
| 1036 | Ga0265327_10000013 | |||
| 1037 | Ga0265327_10024131 | |||
| 1038 | Ga0265316_10247439 | |||
| 1039 | Ga0307513_10117217 | |||
| 1040 | Ga0265313_10040303 | |||
| 1041 | Ga0316576_10136673 | |||
| 1042 | Ga0316578_10023882 | |||
| 1043 | Ga0316577_10001749 | |||
| 1044 | Ga0316577_10004637 | |||
| 1045 | Ga0316577_10005128 | |||
| 1046 | Ga0307410_10030360 | |||
| 1047 | Ga0307412_10000184 | |||
| 1048 | Ga0307412_10000551 | |||
| 1049 | Ga0307416_100000051 | |||
| 1050 | Ga0307414_10000004 | |||
| 1051 | Ga0307414_10031638 | |||
| 1052 | Ga0307414_10046132 | |||
| 1053 | Ga0307414_10061410 | |||
| 1054 | Ga0307414_10254299 | |||
| 1055 | Ga0307414_10254542 | |||
| 1056 | Ga0373926_0007855 | |||
| 1057 | Ga0373934_0009251 | |||
| 1058 | Ga0373949_0036333 | |||
| 1059 | Ga0373955_0004601 | |||
| 1060 | Ga0316574_0010391 | |||
| 1061 | Ga0316574_0192067 | |||
| 1062 | Ga0373924_0005807 | |||
| 1063 | Ga0373924_0095716 | |||
| 1064 | Ga0373931_0028110 | |||
| 1065 | Ga0373933_0015285 | |||
| 1066 | Ga0373937_0002667 | |||
| 1067 | Ga0316584_0029981 | |||
| 1068 | Ga0316584_0044470 | |||
| 1069 | Ga0373925_0193972 | |||
| 1070 | Ga0316581_0009138 | |||
| 1071 | Ga0400484_17565 | |||
| 1072 | Ga0400484_33210 | |||
| 1073 | Ga0400484_36796 | |||
| 1074 | Ga0400483_006822 | |||
| 1075 | Ga0400483_029114 | |||
| 1076 | Ga0400483_088593 | |||
| 1077 | Ga0400483_101201 | |||
| 1078 | Ga0400483_288640 | |||
| 1079 | Ga0436365_1656319 | |||
| 1080 | Ga0436361_0751163 | |||
| 1081 | Ga0451789_1247108 | |||
| 1082 | Ga0451837_0890985 | |||
| 1083 | Ga0439431_0042817 | |||
| 1084 | Ga0439445_0000535 | |||
| 1085 | Ga0439454_000970 | |||
| 1086 | Ga0450898_002007 | |||
| 1087 | Ga0450899_005788 | |||
| 1088 | Ga0450904_006452 | |||
| 1089 | Ga0451577_0044831 | |||
| 1090 | Ga0451577_0072954 | |||
| 1091 | Ga0466972_0000146 | |||
| 1092 | Ga0453683_0000438 | |||
| 1093 | Ga0453683_0116159 | |||
| 1094 | Ga0453683_0169626 | |||
| 1095 | Ga0453684_0003280 | |||
| 1096 | Ga0453684_0021278 | |||
| 1097 | Ga0453684_0022637 | |||
| 1098 | Ga0453684_0179910 | |||
| 1099 | Ga0466970_0000169 | |||
| 1100 | Ga0495627_000002 | |||
| 1101 | Ga0495627_021367 | |||
| 1102 | Ga0495590_0007763 | |||
| 1103 | Ga0495638_0163379 | |||
| 1104 | Ga0495580_0061854 | |||
| 1105 | Ga0495594_0145457 | |||
| 1106 | Ga0495596_0001340 | |||
| 1107 | Ga0495606_0022518 | |||
| 1108 | Ga0495606_0068657 | |||
| 1109 | Ga0495608_0104404 | |||
| 1110 | Ga0495610_0000009 | |||
| 1111 | Ga0495630_0008167 | |||
| 1112 | Ga0495632_0001733 | |||
| 1113 | Ga0495643_0042896 | |||
| 1114 | Ga0495643_0066223 | |||
| 1115 | Ga0495643_0138771 | |||
| 1116 | Ga0495663_0000065 | |||
| 1117 | Ga0495652_0087187 | |||
| 1118 | Ga0495654_0000056 | |||
| 1119 | Ga0495609_0000063 | |||
| 1120 | Ga0495633_0000003 | |||
| 1121 | Ga0495633_0000805 | |||
| 1122 | Ga0495656_0007055 | |||
| 1123 | Ga0495668_0000023 | |||
| 1124 | Ga0495668_0002875 | |||
| 1125 | Ga0495625_0000560 | |||
| 1126 | Ga0495635_0264309 | |||
| 1127 | Ga0495649_0000619 | |||
| 1128 | Ga0495604_0048545 | |||
| 1129 | Ga0495674_0264110 | |||
| 1130 | Ga0495672_0028614 | |||
| 1131 | Ga0495680_0110530 | |||
| 1132 | Ga0495684_0029757 | |||
| 1133 | Ga0495686_0000144 | |||
| 1134 | Ga0495686_0005176 | |||
| 1135 | Ga0495686_0048335 | |||
| 1136 | Ga0496100_0355515 | |||
| 1137 | Ga0496101_0059649 | |||
| 1138 | Ga0496102_0046632 | |||
| 1139 | Ga0496110_0134416 | |||
| 1140 | Ga0496110_0427817 | |||
| 1141 | Ga0496111_0050742 | |||
| 1142 | Ga0496113_0248729 | |||
| 1143 | Ga0496114_0195320 | |||
| 1144 | Ga0496116_0000006 | |||
| 1145 | Ga0496117_0000491 | |||
| 1146 | Ga0496118_0000543 | |||
| 1147 | Ga0496119_0000379 | |||
| 1148 | Ga0496122_0000334 | |||
| 1149 | Ga0496122_0000486 | |||
| 1150 | Ga0496122_0000775 | |||
| 1151 | Ga0496122_0001546 | |||
| 1152 | Ga0496122_0002699 | |||
| 1153 | Ga0496123_0001808 | |||
| 1154 | Ga0496123_0002784 | |||
| 1155 | Ga0496123_0039971 | |||
| 1156 | Ga0496123_0047124 | |||
| 1157 | Ga0496124_0010448 | |||
| 1158 | Ga0496124_0075338 | |||
| 1159 | Ga0496125_0001284 | |||
| 1160 | Ga0496125_0002600 | |||
| 1161 | Ga0496126_0001645 | |||
| 1162 | Ga0501032_0030572 | |||
| 1163 | Ga0501034_0000152 | |||
| 1164 | Ga0501034_0003578 | |||
| 1165 | Ga0501034_0099189 | |||
| 1166 | Ga0501034_0145959 | |||
| 1167 | Ga0501034_0279316 | |||
| 1168 | Ga0501037_0004609 | |||
| 1169 | Ga0501037_0465259 | |||
| 1170 | Ga0501038_0077080 | |||
| 1171 | Ga0501038_0122053 | |||
| 1172 | Ga0501039_0104660 | |||
| 1173 | Ga0501040_0100245 | |||
| 1174 | Ga0501043_0355626 | |||
| 1175 | Ga0501047_0020753 | |||
| 1176 | Ga0501047_0160990 | |||
| 1177 | Ga0501067_0003375 | |||
| 1178 | Ga0501067_0040932 | |||
| 1179 | Ga0501067_0042141 | |||
| 1180 | Ga0501068_0219572 | |||
| 1181 | Ga0501070_0040124 | |||
| 1182 | Ga0501073_0028030 | |||
| 1183 | Ga0501073_0253066 | |||
| 1184 | Ga0501073_0262148 | |||
| 1185 | Ga0501074_0082340 | |||
| 1186 | Ga0501077_0061912 | |||
| 1187 | Ga0501219_000281 | |||
| 1188 | Ga0501080_0144694 | |||
| 1189 | Ga0501080_0197699 | |||
| 1190 | Ga0501080_0346019 | |||
| 1191 | Ga0501083_0025284 | |||
| 1192 | Ga0501241_000029 | |||
| 1193 | Ga0501241_003940 | |||
| 1194 | Ga0501269_000008 | |||
| 1195 | Ga0501035_0017525 | |||
| 1196 | Ga0501035_0180943 | |||
| 1197 | Ga0501035_0286821 | |||
| 1198 | Ga0501044_0055704 | |||
| 1199 | Ga0501044_0214481 | |||
| 1200 | Ga0501284_00002 | |||
| 1201 | nmdc:mga0k408_37721_c1 | |||
| 1202 | nmdc:mga0k408_37816_c1 | |||
| 1203 | nmdc:mga05p37_569_c2 | |||
| 1204 | Ga0495619_0046338 | |||
| 1205 | Ga0500643_000698 | |||
| 1206 | Ga0500651_0065700 | |||
| 1207 | Ga0500641_0016230 | |||
| 1208 | Ga0500618_013300 | |||
| 1209 | Ga0500611_000003 | |||
| 1210 | Ga0501084_0223350 | |||
| 1211 | 2511232242 | |||
| 1212 | 2524006983 | |||
| 1213 | 2585144988 | |||
| 1214 | 2585159217 | |||
| 1215 | 2585163498 | |||
| 1216 | 2585425586 | |||
| 1217 | 2587678205 | |||
| 1218 | 2587748207 | |||
| 1219 | 2587753560 | |||
| 1220 | 2587865411 | |||
| 1221 | 2587944248 | |||
| 1222 | 2588209925 | |||
| 1223 | 2588214899 | |||
| 1224 | 2588218119 | |||
| 1225 | 2588222674 | |||
| 1226 | 2588231469 | |||
| 1227 | 2588444562 | |||
| 1228 | 2590602629 | |||
| 1229 | 2590613060 | |||
| 1230 | 2729199606 | |||
| 1231 | 2738699083 | |||
| 1232 | 2739254799 | |||
| 1233 | 2740032961 | |||
| 1234 | 2740058667 | |||
| 1235 | 2753670760 | |||
| 1236 | 2765573697 | |||
| 1237 | 2772606973 | |||
| 1238 | 2775672261 | |||
| 1239 | 2816874044 | |||
| 1240 | 2839992777 | |||
| 1241 | 2842088127 | |||
| 1242 | 2871720591 | |||
| 1243 | 2889295708 | |||
| 1244 | 2906000426 | |||
| 1245 | 2910247594 | |||
| 1246 | 2919099133 | |||
| 1247 | 2919399806 | |||
| 1248 | 2928974940 | |||
| 1249 | 2945926320 | |||
| 1250 | 2946022292 | |||
| 1251 | 2977242017 | |||
| 1252 | 2977245310 | |||
| 1253 | 2984572788 | |||
| 1254 | 2984610238 | |||
| 1255 | 2993372825 | |||
| 1256 | 2993483489 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4z19-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine | 0.9782 | 3 | 340 |
| 4ylt-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis | 0.9779 | 3 | 340 |
| 5bnr-assembly1.cif.gz_A-2 | e. coli fabh with small molecule inhibitor 2 | 0.9757 | 3 | 340 |
| 2ebd-assembly1.cif.gz_B | crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 | 0.9756 | 4 | 340 |
| 6x7r-assembly1.cif.gz_A | e. coli beta-ketoacyl-[acyl carrier protein] synthase iii (fabh) in complex with oxa(dethia)-coenzyme a | 0.973 | 1 | 340 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A6R0_1_317_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9752 | 3 | 340 | 3.40.47.10 |
| 3il3A01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9701 | 3 | 177 | 3.40.47.10 |
| af_Q2FZS0_1_313_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9698 | 3 | 340 | 3.40.47.10 |
| af_P0A6R0_1_317_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9692 | 3 | 340 | 3.40.47.10 |
| 4x9oB00 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9684 | 1 | 340 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A847X4G8-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase III C-terminal domain-containing protein | 0.9878 | 230 | 339 |
GO:0016746
|
| AF-H8MCV2-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] synthase III | 0.9872 | 174 | 340 |
GO:0016746
|
| AF-A0A354BKT2-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9869 | 239 | 340 |
GO:0016746
|
| AF-A0A3C2AR23-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9852 | 67 | 340 |
GO:0004315
GO:0006633 GO:0044550 |
| AF-A0A497XSQ6-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) | 0.9837 | 3 | 340 |
GO:0004315
GO:0005737 GO:0006633 GO:0033818 GO:0044550 |