F470616

General Info

Members Datasets Scaffolds Average Seq Length
628 276 628 447

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10095716|Ga0065715_100957165
Length 483
Sequence LWLPPSGGRKISVTLRGAAKIVAAPFLFSRRLLADLAAPTRTLPHSLDAEKSVLGAILIYNDAFNAAAEVIDAGDFFRDAHRRIFDRMVALNERGDAIDFVTLKEELLRRGDLDEVGGPAYIAALADGVPRSANVEYYAKIVKEKSTLRNLIHSANKILADAYEAEEEPDLLLDSAERAIFAIAEDRIRTGFVPLRDLXXXXFATIEALQQHKGLVTGVPTGFVDLDEMTSGLQPSDLILVAARPSMGKTSFVLNVAQHVGTSTDMTVGFFSLEMSKEQLFMRLLTSEARIDAHRFRSGYLSEKDYGRLSHALGTLAEARVFIDDTASLGVLEMRAKARRLKAEHGLHLLIIDYIQLMQGRGRFESRQVELASISRSLKGLAKELQVPIIALSQLSRAPETRSDHRPQLSDLRESGALEQDADVVMFIYREEQYRDADGAPNEGAEGVAEIIIGKQRNGPVGTAKLAFIKEHTRFENLAHGAP

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
144 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
145 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
146 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
147 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
148 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
152 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
169 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
170 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
171 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
174 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
267 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
268 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.1
Nodule 0
Rhizoplane 4.94
Rhizosphere 88.06
Stem 0
Stem Tuber 0
Unclassified 1.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10011478 3300002459 Bacteria 1827
2 Ga0065712_10003788 3300005290 Bacteria 3743
3 Ga0065712_10070494 3300005290 Bacteria 5960
4 Ga0065712_10072809 3300005290 Bacteria 4591
5 Ga0065712_10074835 3300005290 Bacteria 3996
6 Ga0065712_10081865 3300005290 Bacteria 2946
7 Ga0065715_10000948 3300005293 Bacteria 10836
8 Ga0065715_10095716 3300005293 Bacteria 4020
9 Ga0065707_10001756 3300005295 Bacteria 6829
10 Ga0065707_10019567 3300005295 Bacteria 1986
11 Ga0065707_10099613 3300005295 Bacteria 2993
12 Ga0065707_10141556 3300005295 Bacteria 1746
13 Ga0070676_10024444 3300005328 Bacteria 3403
14 Ga0070683_100000094 3300005329 Bacteria 58242
15 Ga0070683_100015813 3300005329 Bacteria 6635
16 Ga0070670_100004478 3300005331 Bacteria 11706
17 Ga0070670_100006909 3300005331 Bacteria 9618
18 Ga0070670_100008888 3300005331 Bacteria 8576
19 Ga0070670_100020449 3300005331 Bacteria 5691
20 Ga0070670_100034099 3300005331 Bacteria 4382
21 Ga0070670_100103477 3300005331 Bacteria 2452
22 Ga0068869_100149393 3300005334 Bacteria 1811
23 Ga0070666_10016999 3300005335 Bacteria 4659
24 Ga0070660_100011435 3300005339 Bacteria 6305
25 Ga0070691_10088045 3300005341 Bacteria 1528
26 Ga0070687_100074041 3300005343 Bacteria 1838
27 Ga0070661_100001504 3300005344 Bacteria 16216
28 Ga0070668_100033204 3300005347 Bacteria 3928
29 Ga0070669_100001822 3300005353 Bacteria 15344
30 Ga0070669_100001826 3300005353 Bacteria 15339
31 Ga0070669_100071654 3300005353 Bacteria 2564
32 Ga0070669_100197626 3300005353 Bacteria 1581
33 Ga0070675_100000126 3300005354 Bacteria 45585
34 Ga0070675_100030848 3300005354 Bacteria 4329
35 Ga0070675_100034056 3300005354 Bacteria 4132
36 Ga0070675_100069557 3300005354 Bacteria 2917
37 Ga0070675_100173071 3300005354 Bacteria 1863
38 Ga0070671_100014812 3300005355 Bacteria 6300
39 Ga0070671_100030807 3300005355 Bacteria 4427
40 Ga0070671_100034791 3300005355 Bacteria 4171
41 Ga0070671_100096726 3300005355 Bacteria 2476
42 Ga0070674_100009134 3300005356 Bacteria 5930
43 Ga0070674_100025038 3300005356 Bacteria 3879
44 Ga0070674_100079368 3300005356 Bacteria 2341
45 Ga0070673_100014365 3300005364 Bacteria 5511
46 Ga0070673_100024733 3300005364 Bacteria 4408
47 Ga0070673_100042176 3300005364 Bacteria 3516
48 Ga0070688_100161770 3300005365 Bacteria 1538
49 Ga0070667_100023967 3300005367 Bacteria 5068
50 Ga0070714_100007866 3300005435 Bacteria 8305
51 Ga0070701_10027212 3300005438 Bacteria 2798
52 Ga0070711_100102635 3300005439 Bacteria 2083
53 Ga0070705_100012340 3300005440 Bacteria 4341
54 Ga0070708_100000162 3300005445 Bacteria 47341
55 Ga0070663_100031649 3300005455 Bacteria 3638
56 Ga0070662_100156363 3300005457 Bacteria 1780
57 Ga0068867_100228558 3300005459 Bacteria 1503
58 Ga0070698_100046350 3300005471 Bacteria 4445
59 Ga0070698_100054713 3300005471 Bacteria 4051
60 Ga0070699_100001694 3300005518 Bacteria 20061
61 Ga0070699_100028109 3300005518 Bacteria 4850
62 Ga0070679_100028072 3300005530 Bacteria 5545
63 Ga0070679_100074307 3300005530 Bacteria 3390
64 Ga0070684_100000166 3300005535 Bacteria 45212
65 Ga0070672_100056176 3300005543 Bacteria 3086
66 Ga0070686_100000486 3300005544 Bacteria 24080
67 Ga0070695_100011283 3300005545 Bacteria 5344
68 Ga0070695_100032173 3300005545 Bacteria 3279
69 Ga0070665_100001142 3300005548 Bacteria 32621
70 Ga0070665_100023391 3300005548 Bacteria 6221
71 Ga0070665_100111511 3300005548 Bacteria 2738
72 Ga0070665_100218077 3300005548 Bacteria 1908
73 Ga0070704_100008602 3300005549 Bacteria 6131
74 Ga0070664_100000479 3300005564 Bacteria 30222
75 Ga0070664_100017862 3300005564 Bacteria 5824
76 Ga0070664_100092357 3300005564 Bacteria 2621
77 Ga0068857_100088516 3300005577 Bacteria 2770
78 Ga0068854_100012140 3300005578 Bacteria 5634
79 Ga0068854_100060652 3300005578 Bacteria 2737
80 Ga0068856_100194009 3300005614 Bacteria 2045
81 Ga0068859_100012501 3300005617 Bacteria 8540
82 Ga0068859_100043379 3300005617 Bacteria 4520
83 Ga0068859_100155036 3300005617 Bacteria 2367
84 Ga0068859_100187387 3300005617 Bacteria 2153
85 Ga0068864_100105780 3300005618 Bacteria 2501
86 Ga0068864_100138272 3300005618 Bacteria 2195
87 Ga0068866_10051816 3300005718 Bacteria 2091
88 Ga0068861_100044855 3300005719 Bacteria 3327
89 Ga0068863_100002641 3300005841 Bacteria 17739
90 Ga0068863_100091208 3300005841 Bacteria 2889
91 Ga0068863_100187754 3300005841 Bacteria 1986
92 Ga0068858_100001750 3300005842 Bacteria 22134
93 Ga0068858_100044229 3300005842 Bacteria 4128
94 Ga0068858_100058941 3300005842 Bacteria 3549
95 Ga0068858_100110332 3300005842 Bacteria 2569
96 Ga0068858_100181638 3300005842 Bacteria 1987
97 Ga0068858_100250448 3300005842 Bacteria 1682
98 Ga0068860_100204813 3300005843 Bacteria 1913
99 Ga0068860_100337354 3300005843 Bacteria 1481
100 Ga0068862_100003872 3300005844 Bacteria 12736
101 Ga0068862_100032463 3300005844 Bacteria 4412
102 Ga0068862_100069193 3300005844 Bacteria 3046
103 Ga0068862_100103821 3300005844 Bacteria 2489
104 Ga0081455_10033236 3300005937 Bacteria 4638
105 Ga0081539_10032414 3300005985 Bacteria 3200
106 Ga0075365_10023639 3300006038 Bacteria 3868
107 Ga0075368_10010990 3300006042 Bacteria 3286
108 Ga0075368_10029383 3300006042 Bacteria 2125
109 Ga0075364_10012231 3300006051 Bacteria 5244
110 Ga0075364_10094940 3300006051 Bacteria 1982
111 Ga0075367_10006328 3300006178 Bacteria 5972
112 Ga0075367_10021992 3300006178 Bacteria 3570
113 Ga0075367_10042952 3300006178 Bacteria 2647
114 Ga0075367_10047619 3300006178 Bacteria 2523
115 Ga0075366_10005550 3300006195 Bacteria 6838
116 Ga0075366_10019318 3300006195 Bacteria 3941
117 Ga0075366_10063890 3300006195 Bacteria 2188
118 Ga0097621_100001492 3300006237 Bacteria 16045
119 Ga0097621_100002965 3300006237 Bacteria 11648
120 Ga0097621_100028749 3300006237 Bacteria 4384
121 Ga0097621_100054521 3300006237 Bacteria 3261
122 Ga0097621_100223723 3300006237 Bacteria 1641
123 Ga0075370_10006583 3300006353 Bacteria 5853
124 Ga0068871_100007809 3300006358 Bacteria 7661
125 Ga0068871_100037728 3300006358 Bacteria 3855
126 Ga0068871_100060378 3300006358 Bacteria 3093
127 Ga0068871_100085065 3300006358 Bacteria 2625
128 Ga0068871_100131725 3300006358 Bacteria 2120
129 Ga0068871_100172716 3300006358 Bacteria 1854
130 Ga0075428_100000017 3300006844 Bacteria 147833
131 Ga0075428_100003278 3300006844 Bacteria 17699
132 Ga0075428_100005429 3300006844 Bacteria 14163
133 Ga0075428_100008684 3300006844 Bacteria 11272
134 Ga0075428_100036637 3300006844 Bacteria 5402
135 Ga0075428_100303756 3300006844 Bacteria 1716
136 Ga0075430_100005222 3300006846 Bacteria 10947
137 Ga0075430_100017112 3300006846 Bacteria 6175
138 Ga0075430_100055833 3300006846 Bacteria 3321
139 Ga0075430_100172356 3300006846 Bacteria 1800
140 Ga0075431_100003437 3300006847 Bacteria 15361
141 Ga0075431_100031118 3300006847 Bacteria 5496
142 Ga0075431_100188792 3300006847 Bacteria 2112
143 Ga0075431_100321780 3300006847 Bacteria 1559
144 Ga0075433_10026586 3300006852 Bacteria 4901
145 Ga0075433_10029168 3300006852 Bacteria 4698
146 Ga0075433_10084562 3300006852 Bacteria 2801
147 Ga0075433_10138524 3300006852 Bacteria 2163
148 Ga0075433_10147817 3300006852 Bacteria 2089
149 Ga0075433_10200726 3300006852 Bacteria 1773
150 Ga0075434_100001891 3300006871 Bacteria 18122
151 Ga0075434_100014324 3300006871 Bacteria 7578
152 Ga0075434_100022053 3300006871 Bacteria 6200
153 Ga0075429_100112902 3300006880 Bacteria 2375
154 Ga0068865_100000768 3300006881 Bacteria 17997
155 Ga0068865_100158979 3300006881 Bacteria 1722
156 Ga0075436_100001121 3300006914 Bacteria 18122
157 Ga0075436_100020929 3300006914 Bacteria 4486
158 Ga0075436_100027279 3300006914 Bacteria 3931
159 Ga0097620_100012502 3300006931 Bacteria 8540
160 Ga0097620_100043380 3300006931 Bacteria 4520
161 Ga0097620_100155039 3300006931 Bacteria 2367
162 Ga0097620_100187389 3300006931 Bacteria 2153
163 Ga0075435_100000342 3300007076 Bacteria 28702
164 Ga0075435_100001286 3300007076 Bacteria 16131
165 Ga0075435_100001999 3300007076 Bacteria 13346
166 Ga0075435_100002624 3300007076 Bacteria 11969
167 Ga0075435_100009261 3300007076 Bacteria 7116
168 Ga0075435_100046688 3300007076 Bacteria 3475
169 Ga0105240_10055960 3300009093 Bacteria 4938
170 Ga0105240_10105162 3300009093 Bacteria 3427
171 Ga0111539_10000002 3300009094 Bacteria 983359
172 Ga0111539_10007496 3300009094 Bacteria 13967
173 Ga0111539_10019212 3300009094 Bacteria 8441
174 Ga0111539_10034772 3300009094 Bacteria 6105
175 Ga0111539_10120022 3300009094 Bacteria 3080
176 Ga0111539_10165743 3300009094 Bacteria 2583
177 Ga0105245_10059423 3300009098 Bacteria 3443
178 Ga0105245_10063005 3300009098 Bacteria 3347
179 Ga0114129_10000509 3300009147 Bacteria 47512
180 Ga0114129_10001667 3300009147 Bacteria 30241
181 Ga0114129_10003035 3300009147 Bacteria 23547
182 Ga0114129_10009415 3300009147 Bacteria 13923
183 Ga0114129_10009699 3300009147 Bacteria 13740
184 Ga0114129_10014680 3300009147 Bacteria 11160
185 Ga0114129_10020336 3300009147 Bacteria 9444
186 Ga0114129_10054015 3300009147 Bacteria 5634
187 Ga0114129_10058610 3300009147 Bacteria 5386
188 Ga0114129_10186842 3300009147 Bacteria 2816
189 Ga0105241_10047376 3300009174 Bacteria 3269
190 Ga0105248_10004266 3300009177 Bacteria 15819
191 Ga0105248_10024004 3300009177 Bacteria 6778
192 Ga0105248_10026969 3300009177 Bacteria 6389
193 Ga0105248_10102509 3300009177 Bacteria 3225
194 Ga0105248_10138322 3300009177 Bacteria 2747
195 Ga0105248_10184596 3300009177 Bacteria 2350
196 Ga0105248_10266326 3300009177 Bacteria 1929
197 Ga0105249_10005969 3300009553 Bacteria 10554
198 Ga0105249_10040966 3300009553 Bacteria 4208
199 Ga0105249_10110728 3300009553 Bacteria 2595
200 Ga0105249_10251709 3300009553 Bacteria 1752
201 Ga0157374_10058802 3300013296 Bacteria 3593
202 Ga0157374_10333221 3300013296 Bacteria 1505
203 Ga0157374_10360290 3300013296 Bacteria 1446
204 Ga0157378_10100195 3300013297 Bacteria 2644
205 Ga0163162_10012905 3300013306 Bacteria 8158
206 Ga0163162_10219281 3300013306 Bacteria 2032
207 Ga0157375_10167031 3300013308 Bacteria 2346
208 Ga0157375_10382497 3300013308 Bacteria 1574
209 Ga0163163_10003727 3300014325 Bacteria 12970
210 Ga0163163_10029039 3300014325 Bacteria 5317
211 Ga0163163_10219336 3300014325 Bacteria 1950
212 Ga0157380_10011831 3300014326 Bacteria 6310
213 Ga0157380_10012730 3300014326 Bacteria 6109
214 Ga0157380_10050159 3300014326 Bacteria 3295
215 Ga0157380_10063406 3300014326 Bacteria 2963
216 Ga0157377_10040929 3300014745 Bacteria 2568
217 Ga0157379_10006964 3300014968 Bacteria 9776
218 Ga0157379_10046448 3300014968 Bacteria 3874
219 Ga0157379_10050038 3300014968 Bacteria 3730
220 Ga0157379_10050918 3300014968 Bacteria 3698
221 Ga0157379_10084538 3300014968 Bacteria 2844
222 Ga0157376_10007845 3300014969 Bacteria 7654
223 Ga0157376_10008007 3300014969 Bacteria 7586
224 Ga0157376_10172096 3300014969 Bacteria 1973
225 Ga0207697_10011895 3300025315 Bacteria 3667
226 Ga0207688_10028214 3300025901 Bacteria 3089
227 Ga0207647_10058576 3300025904 Bacteria 2359
228 Ga0207645_10033518 3300025907 Bacteria 3301
229 Ga0207643_10037681 3300025908 Bacteria 2713
230 Ga0207654_10086014 3300025911 Bacteria 1905
231 Ga0207707_10197614 3300025912 Bacteria 1754
232 Ga0207695_10039395 3300025913 Bacteria 5080
233 Ga0207663_10084762 3300025916 Bacteria 2085
234 Ga0207662_10011144 3300025918 Bacteria 4976
235 Ga0207662_10018922 3300025918 Bacteria 3912
236 Ga0207657_10005005 3300025919 Bacteria 13923
237 Ga0207657_10067902 3300025919 Bacteria 3030
238 Ga0207649_10010919 3300025920 Bacteria 4994
239 Ga0207652_10022007 3300025921 Bacteria 5268
240 Ga0207652_10084407 3300025921 Bacteria 2782
241 Ga0207681_10004627 3300025923 Bacteria 8460
242 Ga0207681_10014196 3300025923 Bacteria 4944
243 Ga0207681_10072528 3300025923 Bacteria 2405
244 Ga0207681_10114895 3300025923 Bacteria 1964
245 Ga0207650_10003836 3300025925 Bacteria 10275
246 Ga0207650_10014293 3300025925 Bacteria 5515
247 Ga0207650_10015514 3300025925 Bacteria 5307
248 Ga0207659_10000390 3300025926 Bacteria 26422
249 Ga0207659_10042679 3300025926 Bacteria 3181
250 Ga0207659_10107442 3300025926 Bacteria 2115
251 Ga0207644_10010148 3300025931 Bacteria 6204
252 Ga0207644_10142973 3300025931 Bacteria 1844
253 Ga0207706_10019072 3300025933 Bacteria 6170
254 Ga0207706_10076550 3300025933 Bacteria 2943
255 Ga0207706_10114722 3300025933 Bacteria 2370
256 Ga0207686_10007943 3300025934 Bacteria 5720
257 Ga0207686_10096590 3300025934 Bacteria 1963
258 Ga0207670_10105661 3300025936 Bacteria 2019
259 Ga0207669_10016642 3300025937 Bacteria 3743
260 Ga0207704_10095550 3300025938 Bacteria 1965
261 Ga0207691_10035100 3300025940 Bacteria 4659
262 Ga0207691_10053787 3300025940 Bacteria 3674
263 Ga0207691_10079823 3300025940 Bacteria 2944
264 Ga0207711_10010209 3300025941 Bacteria 7796
265 Ga0207711_10019590 3300025941 Bacteria 5632
266 Ga0207711_10044920 3300025941 Bacteria 3773
267 Ga0207711_10135936 3300025941 Bacteria 2208
268 Ga0207711_10207639 3300025941 Bacteria 1789
269 Ga0207711_10287012 3300025941 Bacteria 1516
270 Ga0207661_10065930 3300025944 Bacteria 2940
271 Ga0207661_10124148 3300025944 Bacteria 2203
272 Ga0207679_10002245 3300025945 Bacteria 11932
273 Ga0207679_10029861 3300025945 Bacteria 3800
274 Ga0207679_10043426 3300025945 Bacteria 3236
275 Ga0207679_10106771 3300025945 Bacteria 2201
276 Ga0207651_10082337 3300025960 Bacteria 2323
277 Ga0207712_10200293 3300025961 Bacteria 1583
278 Ga0207668_10199597 3300025972 Bacteria 1592
279 Ga0207658_10032627 3300025986 Bacteria 3708
280 Ga0207658_10051075 3300025986 Bacteria 3046
281 Ga0207677_10145233 3300026023 Bacteria 1822
282 Ga0207703_10003700 3300026035 Bacteria 12733
283 Ga0207703_10014502 3300026035 Bacteria 6147
284 Ga0207703_10052596 3300026035 Bacteria 3308
285 Ga0207703_10159697 3300026035 Bacteria 1973
286 Ga0207678_10040510 3300026067 Bacteria 4040
287 Ga0207678_10181967 3300026067 Bacteria 1795
288 Ga0207708_10010053 3300026075 Bacteria 7025
289 Ga0207708_10030974 3300026075 Bacteria 4059
290 Ga0207708_10033577 3300026075 Bacteria 3899
291 Ga0207641_10012095 3300026088 Bacteria 7078
292 Ga0207641_10191323 3300026088 Bacteria 1881
293 Ga0207641_10194986 3300026088 Bacteria 1864
294 Ga0207648_10023964 3300026089 Bacteria 5456
295 Ga0207648_10042908 3300026089 Bacteria 3972
296 Ga0207648_10083579 3300026089 Bacteria 2784
297 Ga0207648_10141879 3300026089 Bacteria 2117
298 Ga0207676_10006796 3300026095 Bacteria 8098
299 Ga0207676_10017193 3300026095 Bacteria 5241
300 Ga0207676_10155794 3300026095 Bacteria 1973
301 Ga0207674_10089536 3300026116 Bacteria 3070
302 Ga0207674_10095976 3300026116 Bacteria 2950
303 Ga0207675_100009283 3300026118 Bacteria 9224
304 Ga0207675_100085552 3300026118 Bacteria 2959
305 Ga0207683_10030430 3300026121 Bacteria 4678
306 Ga0209971_1013155 3300027682 Bacteria 1961
307 Ga0207428_10000004 3300027907 Bacteria 727800
308 Ga0207428_10004630 3300027907 Bacteria 13038
309 Ga0207428_10005890 3300027907 Bacteria 11357
310 Ga0207428_10024129 3300027907 Bacteria 5107
311 Ga0207428_10027128 3300027907 Bacteria 4770
312 Ga0207428_10036140 3300027907 Bacteria 4032
313 Ga0268266_10028632 3300028379 Bacteria 4734
314 Ga0268266_10033789 3300028379 Bacteria 4347
315 Ga0268266_10035948 3300028379 Bacteria 4213
316 Ga0268265_10001769 3300028380 Bacteria 17327
317 Ga0268265_10049460 3300028380 Bacteria 3162
318 Ga0268265_10097487 3300028380 Bacteria 2365
319 Ga0268264_10072000 3300028381 Bacteria 2930
320 Ga0268264_10211732 3300028381 Bacteria 1780
321 Ga0268264_10229424 3300028381 Bacteria 1714
322 Ga0265336_10008570 3300028666 Bacteria 3579
323 Ga0307408_100087751 3300031548 Bacteria 2341
324 Ga0307408_100114902 3300031548 Bacteria 2075
325 Ga0265314_10112931 3300031711 Bacteria 1723
326 Ga0307405_10040699 3300031731 Bacteria 2816
327 Ga0307410_10014419 3300031852 Bacteria 4650
328 Ga0307410_10028237 3300031852 Bacteria 3556
329 Ga0307410_10104215 3300031852 Bacteria 2039
330 Ga0307412_10061545 3300031911 Bacteria 2524
331 Ga0307409_100049813 3300031995 Bacteria 3196
332 Ga0307409_100155745 3300031995 Bacteria 1990
333 Ga0307416_100054406 3300032002 Bacteria 3217
334 Ga0307414_10020289 3300032004 Bacteria 4140
335 Ga0307411_10016973 3300032005 Bacteria 4133
336 Ga0307411_10054969 3300032005 Bacteria 2617
337 Ga0307415_100057639 3300032126 Bacteria 2670
338 Ga0373930_0000441 3300034816 Bacteria 5541
339 Ga0373948_0000557 3300034817 Bacteria 4719
340 Ga0373958_0000887 3300034819 Bacteria 3859
341 Ga0373938_0001804 3300034957 Bacteria 3419
342 Ga0373928_0001759 3300035084 Bacteria 4218
343 Ga0373929_0001613 3300035085 Bacteria 4274
344 Ga0373940_0008255 3300035088 Bacteria 2382
345 Ga0373944_0016400 3300035089 Bacteria 2089
346 Ga0373951_0000690 3300035091 Bacteria 9267
347 Ga0373952_0001034 3300035092 Bacteria 5082
348 Ga0373923_0061173 3300035111 Bacteria 1600
349 Ga0373932_0003685 3300035112 Bacteria 3664
350 Ga0373939_0001367 3300035114 Bacteria 5907
351 Ga0373941_0000981 3300035115 Bacteria 5914
352 Ga0373960_0026152 3300035121 Bacteria 1592
353 Ga0373946_0003457 3300035171 Bacteria 5607
354 Ga0373942_0001306 3300035207 Bacteria 6502
355 Ga0373962_0021961 3300035242 Bacteria 1688
356 Ga0373962_0024712 3300035242 Bacteria 1609
357 Ga0373931_0005785 3300035691 Bacteria 5747
358 Ga0373935_0079353 3300035692 Bacteria 2131
359 Ga0373947_0017466 3300035725 Bacteria 4126
360 Ga0373947_0043246 3300035725 Bacteria 2691
361 Ga0373947_0073076 3300035725 Bacteria 2107
362 Ga0373937_0005827 3300036401 Bacteria 10593
363 Ga0373937_0077236 3300036401 Bacteria 3077
364 Ga0373937_0095858 3300036401 Bacteria 2751
365 Ga0373937_0300884 3300036401 Bacteria 1516
366 Ga0373925_0003124 3300037068 Bacteria 12999
367 Ga0373925_0078527 3300037068 Bacteria 2506
368 Ga0400483_039556 3300039062 Bacteria 10415
369 Ga0436365_0524534 3300039437 Bacteria 2654
370 Ga0439453_0014082 3300041408 Bacteria 1367
371 Ga0451855_0795620 3300041511 Bacteria 1542
372 Ga0439433_0016785 3300041999 Bacteria 1622
373 Ga0450923_002608 3300042125 Bacteria 2612
374 Ga0439446_0008260 3300042156 Bacteria 2759
375 Ga0439446_0017105 3300042156 Bacteria 2024
376 Ga0450908_004137 3300042184 Bacteria 2804
377 Ga0439460_0027810 3300042461 Bacteria 1591
378 Ga0451577_0030159 3300042876 Bacteria 4900
379 Ga0453684_0056633 3300044712 Bacteria 5083
380 Ga0453684_0076262 3300044712 Bacteria 4210
381 Ga0451576_0005235 3300045051 Bacteria 16381
382 Ga0451576_0052316 3300045051 Bacteria 4279
383 Ga0466967_0041952 3300045976 Bacteria 3950
384 Ga0495592_0064223 3300046454 Bacteria 2691
385 Ga0495603_0031140 3300046455 Bacteria 3212
386 Ga0495653_0055782 3300046463 Bacteria 3014
387 Ga0495584_0099036 3300046491 Bacteria 1473
388 Ga0495608_0051364 3300046511 Bacteria 2732
389 Ga0495628_0044481 3300046516 Bacteria 3532
390 Ga0495630_0009657 3300046517 Bacteria 6938
391 Ga0495586_0107331 3300046535 Bacteria 1553
392 Ga0495587_0091378 3300046536 Bacteria 1758
393 Ga0495645_0001970 3300046543 Bacteria 13950
394 Ga0495645_0109708 3300046543 Bacteria 1953
395 Ga0495599_0027828 3300046678 Bacteria 3542
396 Ga0495623_0029105 3300046679 Bacteria 3556
397 Ga0495647_0035491 3300046681 Bacteria 1873
398 Ga0495658_0050694 3300046683 Bacteria 2349
399 Ga0495658_0066925 3300046683 Bacteria 2076
400 Ga0495669_0088007 3300046684 Bacteria 1431
401 Ga0495613_0070257 3300046689 Bacteria 2553
402 Ga0495600_0029435 3300046809 Bacteria 3556
403 Ga0495604_0063069 3300047317 Bacteria 2828
404 Ga0495674_0071787 3300047319 Bacteria 2987
405 Ga0495674_0138611 3300047319 Bacteria 2046
406 Ga0495684_0003170 3300047471 Bacteria 12891
407 Ga0496100_0002904 3300048903 Bacteria 8800
408 Ga0496101_0029791 3300048904 Bacteria 3819
409 Ga0496102_0012018 3300048905 Bacteria 7480
410 Ga0496102_0094309 3300048905 Bacteria 2773
411 Ga0496102_0304985 3300048905 Bacteria 1501
412 Ga0496104_0002167 3300048907 Bacteria 17038
413 Ga0496104_0003182 3300048907 Bacteria 14111
414 Ga0496104_0020436 3300048907 Bacteria 6070
415 Ga0496104_0319615 3300048907 Bacteria 1465
416 Ga0496105_0043898 3300048908 Bacteria 3687
417 Ga0496105_0065453 3300048908 Bacteria 3000
418 Ga0496105_0080185 3300048908 Bacteria 2696
419 Ga0496106_0129581 3300048909 Bacteria 1978
420 Ga0496108_0004769 3300048911 Bacteria 10933
421 Ga0496108_0046024 3300048911 Bacteria 3644
422 Ga0496108_0155789 3300048911 Bacteria 1973
423 Ga0496109_0000869 3300048912 Bacteria 25170
424 Ga0496109_0012600 3300048912 Bacteria 7303
425 Ga0496110_0009331 3300048913 Bacteria 7939
426 Ga0496110_0065613 3300048913 Bacteria 3210
427 Ga0496111_0030399 3300048914 Bacteria 3840
428 Ga0496111_0080652 3300048914 Bacteria 2374
429 Ga0496112_0000918 3300048915 Bacteria 21281
430 Ga0496112_0006389 3300048915 Bacteria 10345
431 Ga0496112_0039457 3300048915 Bacteria 4615
432 Ga0496112_0044954 3300048915 Bacteria 4328
433 Ga0496112_0088413 3300048915 Bacteria 3066
434 Ga0496113_0038387 3300048916 Bacteria 3521
435 Ga0496114_0000494 3300048917 Bacteria 28861
436 Ga0496114_0195861 3300048917 Bacteria 1769
437 Ga0496114_0273397 3300048917 Bacteria 1489
438 Ga0496116_0000815 3300048919 Bacteria 39464
439 Ga0496122_0000349 3300048925 Bacteria 99749
440 Ga0496122_0023007 3300048925 Bacteria 5515
441 Ga0496123_0024362 3300048926 Bacteria 4602
442 Ga0496125_0000574 3300048928 Bacteria 62986
443 Ga0496125_0014145 3300048928 Bacteria 7786
444 Ga0496125_0039832 3300048928 Bacteria 4040
445 Ga0496126_0000424 3300048929 Bacteria 85019
446 Ga0496126_0066038 3300048929 Bacteria 3236
447 Ga0501032_0004704 3300049569 Bacteria 10237
448 Ga0501033_0045609 3300049570 Bacteria 3261
449 Ga0501034_0013282 3300049571 Bacteria 8486
450 Ga0501034_0013896 3300049571 Bacteria 8289
451 Ga0501034_0015056 3300049571 Bacteria 7951
452 Ga0501034_0032055 3300049571 Bacteria 5339
453 Ga0501036_0009593 3300049572 Bacteria 7960
454 Ga0501036_0016338 3300049572 Bacteria 6201
455 Ga0501036_0101653 3300049572 Bacteria 2432
456 Ga0501036_0124735 3300049572 Bacteria 2174
457 Ga0501036_0126719 3300049572 Bacteria 2156
458 Ga0501037_0002266 3300049573 Bacteria 13901
459 Ga0501037_0002567 3300049573 Bacteria 13115
460 Ga0501038_0005902 3300049574 Bacteria 11316
461 Ga0501039_0018193 3300049575 Bacteria 5394
462 Ga0501040_0004136 3300049576 Bacteria 9443
463 Ga0501040_0006238 3300049576 Bacteria 7740
464 Ga0501040_0045941 3300049576 Bacteria 2981
465 Ga0501041_0010308 3300049577 Bacteria 5507
466 Ga0501041_0022760 3300049577 Bacteria 3754
467 Ga0501041_0149784 3300049577 Bacteria 1456
468 Ga0501042_0001424 3300049578 Bacteria 14078
469 Ga0501042_0002431 3300049578 Bacteria 11427
470 Ga0501042_0086827 3300049578 Bacteria 2244
471 Ga0501043_0003546 3300049579 Bacteria 12818
472 Ga0501043_0031965 3300049579 Bacteria 4136
473 Ga0501043_0039369 3300049579 Bacteria 3715
474 Ga0501046_0002275 3300049580 Bacteria 18106
475 Ga0501046_0054732 3300049580 Bacteria 3137
476 Ga0501046_0063267 3300049580 Bacteria 2889
477 Ga0501046_0070814 3300049580 Bacteria 2710
478 Ga0501047_0030091 3300049581 Bacteria 5234
479 Ga0501047_0038630 3300049581 Bacteria 4618
480 Ga0501047_0043788 3300049581 Bacteria 4324
481 Ga0501048_0002414 3300049582 Bacteria 14253
482 Ga0501048_0003455 3300049582 Bacteria 12008
483 Ga0501048_0045271 3300049582 Bacteria 3143
484 Ga0501048_0052050 3300049582 Bacteria 2913
485 Ga0501048_0099953 3300049582 Bacteria 2046
486 Ga0501067_0000782 3300049583 Bacteria 17114
487 Ga0501067_0070322 3300049583 Bacteria 1938
488 Ga0501068_0004277 3300049584 Bacteria 7755
489 Ga0501069_0002468 3300049585 Bacteria 9433
490 Ga0501069_0038187 3300049585 Bacteria 2651
491 Ga0501070_0005948 3300049586 Bacteria 10398
492 Ga0501071_0006748 3300049587 Bacteria 7472
493 Ga0501071_0016306 3300049587 Bacteria 5109
494 Ga0501071_0019912 3300049587 Bacteria 4660
495 Ga0501071_0056395 3300049587 Bacteria 2838
496 Ga0501071_0067384 3300049587 Bacteria 2603
497 Ga0501071_0067647 3300049587 Bacteria 2598
498 Ga0501071_0119224 3300049587 Bacteria 1955
499 Ga0501072_0016341 3300049588 Bacteria 5694
500 Ga0501072_0017659 3300049588 Bacteria 5487
501 Ga0501072_0061899 3300049588 Bacteria 2952
502 Ga0501072_0099199 3300049588 Bacteria 2315
503 Ga0501073_0002917 3300049589 Bacteria 12835
504 Ga0501073_0005139 3300049589 Bacteria 9820
505 Ga0501073_0007964 3300049589 Bacteria 7864
506 Ga0501074_0002067 3300049590 Bacteria 13873
507 Ga0501075_0001274 3300049591 Bacteria 16341
508 Ga0501075_0007335 3300049591 Bacteria 7647
509 Ga0501076_0005066 3300049592 Bacteria 9434
510 Ga0501076_0065901 3300049592 Bacteria 2889
511 Ga0501076_0089690 3300049592 Bacteria 2472
512 Ga0501076_0101039 3300049592 Bacteria 2324
513 Ga0501076_0138260 3300049592 Bacteria 1978
514 Ga0501076_0158808 3300049592 Bacteria 1841
515 Ga0501077_0015655 3300049593 Bacteria 4777
516 Ga0501077_0090010 3300049593 Bacteria 1945
517 Ga0501079_0001902 3300049741 Bacteria 14973
518 Ga0501079_0050762 3300049741 Bacteria 3201
519 Ga0501079_0177126 3300049741 Bacteria 1663
520 Ga0501080_0015434 3300049742 Bacteria 7041
521 Ga0501080_0021766 3300049742 Bacteria 5939
522 Ga0501080_0050302 3300049742 Bacteria 3879
523 Ga0501080_0087756 3300049742 Bacteria 2889
524 Ga0501081_0001000 3300049743 Bacteria 16843
525 Ga0501081_0052995 3300049743 Bacteria 2800
526 Ga0501083_0018618 3300049744 Bacteria 4838
527 Ga0501083_0085637 3300049744 Bacteria 2085
528 Ga0501083_0098078 3300049744 Bacteria 1933
529 Ga0501035_0019824 3300049822 Bacteria 6178
530 Ga0501035_0099096 3300049822 Bacteria 2558
531 Ga0501035_0143590 3300049822 Bacteria 2074
532 Ga0501044_0101794 3300049823 Bacteria 2889
533 Ga0501045_0001367 3300049824 Bacteria 16231
534 Ga0501045_0018171 3300049824 Bacteria 4997
535 Ga0501045_0036744 3300049824 Bacteria 3558
536 Ga0501045_0067868 3300049824 Bacteria 2619
537 Ga0501045_0085246 3300049824 Bacteria 2331
538 Ga0501045_0090057 3300049824 Bacteria 2266
539 nmdc:mga03683_26814_c1 3300050489 Bacteria 2277
540 nmdc:mga00v17_28120_c1 3300050491 Bacteria 3291
541 nmdc:mga00v17_48985_c1 3300050491 Bacteria 2562
542 nmdc:mga00v17_5561_c1 3300050491 Bacteria 6642
543 nmdc:mga0yw44_107822_c1 3300050492 Bacteria 1781
544 nmdc:mga0yw44_22581_c1 3300050492 Bacteria 3530
545 nmdc:mga0k408_12780_c1 3300050493 Bacteria 4593
546 nmdc:mga0k408_2125_c1 3300050493 Bacteria 10615
547 nmdc:mga0k408_4013_c1 3300050493 Bacteria 7810
548 nmdc:mga0k408_42982_c1 3300050493 Bacteria 2603
549 nmdc:mga06z11_101975_c1 3300050494 Bacteria 1576
550 nmdc:mga06z11_7360_c1 3300050494 Bacteria 4524
551 nmdc:mga06z11_76999_c1 3300050494 Bacteria 1780
552 nmdc:mga07m45_3761_c1 3300050496 Bacteria 7342
553 nmdc:mga05p37_10752_c1 3300050507 Bacteria 10865
554 nmdc:mga05p37_174_c1 3300050507 Bacteria 62666
555 nmdc:mga05p37_1991_c1 3300050507 Bacteria 23842
556 nmdc:mga05p37_211412_c1 3300050507 Bacteria 2345
557 nmdc:mga05p37_25037_c1 3300050507 Bacteria 7255
558 nmdc:mga05p37_28754_c1 3300050507 Bacteria 6781
559 nmdc:mga05p37_38671_c1 3300050507 Bacteria 5854
560 nmdc:mga05p37_79286_c1 3300050507 Bacteria 4044
561 nmdc:mga05p37_90050_c1 3300050507 Bacteria 3781
562 nmdc:mga09592_147875_c1 3300050508 Bacteria 2026
563 nmdc:mga09592_36441_c1 3300050508 Bacteria 4120
564 nmdc:mga09592_86359_c1 3300050508 Bacteria 2677
565 nmdc:mga0qj67_11170_c1 3300050509 Bacteria 6725
566 nmdc:mga0qj67_14596_c1 3300050509 Bacteria 5939
567 nmdc:mga0qj67_23016_c1 3300050509 Bacteria 4789
568 nmdc:mga0qj67_41323_c1 3300050509 Bacteria 3626
569 nmdc:mga06r32_16241_c1 3300050510 Bacteria 6781
570 nmdc:mga06r32_25841_c1 3300050510 Bacteria 5466
571 nmdc:mga06r32_297470_c1 3300050510 Bacteria 1600
572 nmdc:mga06r32_43448_c1 3300050510 Bacteria 4276
573 nmdc:mga08y16_141291_c1 3300050511 Bacteria 2503
574 nmdc:mga08y16_22244_c1 3300050511 Bacteria 6690
575 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
576 nmdc:mga08y16_33801_c1 3300050511 Bacteria 5371
577 nmdc:mga08y16_61461_c1 3300050511 Bacteria 3923
578 nmdc:mga08y16_7358_c1 3300050511 Bacteria 11548
579 nmdc:mga08y16_74127_c1 3300050511 Bacteria 3546
580 nmdc:mga08y16_8235_c1 3300050511 Bacteria 10905
581 nmdc:mga0n895_13885_c1 3300050512 Bacteria 7292
582 nmdc:mga0n895_139476_c1 3300050512 Bacteria 2452
583 nmdc:mga0n895_205450_c1 3300050512 Bacteria 2000
584 nmdc:mga0n895_227_c1 3300050512 Bacteria 35542
585 nmdc:mga0n895_281415_c1 3300050512 Bacteria 1687
586 nmdc:mga0n895_29979_c1 3300050512 Bacteria 5194
587 nmdc:mga0n895_3182_c1 3300050512 Bacteria 13119
588 nmdc:mga0n895_67811_c1 3300050512 Bacteria 3534
589 nmdc:mga0rr50_132_c1 3300050513 Bacteria 40800
590 nmdc:mga0rr50_145140_c1 3300050513 Bacteria 1913
591 nmdc:mga0rr50_175_c1 3300050513 Bacteria 34417
592 nmdc:mga0rr50_50838_c1 3300050513 Bacteria 3073
593 nmdc:mga0rr50_75340_c1 3300050513 Bacteria 2586
594 nmdc:mga08x19_954_c1 3300050514 Bacteria 18158
595 nmdc:mga0a205_20223_c1 3300050515 Bacteria 6279
596 nmdc:mga0a205_203574_c1 3300050515 Bacteria 1869
597 nmdc:mga0a205_26590_c1 3300050515 Bacteria 4003
598 nmdc:mga0a205_43843_c1 3300050515 Bacteria 4312
599 nmdc:mga0a205_72618_c1 3300050515 Bacteria 3325
600 nmdc:mga0a205_81626_c1 3300050515 Bacteria 3123
601 Ga0495601_0016819 3300053077 Bacteria 4437
602 Ga0495619_0017244 3300053085 Bacteria 4572
603 Ga0495619_0030649 3300053085 Bacteria 3482
604 Ga0495619_0031918 3300053085 Bacteria 3415
605 Ga0500555_000499 3300053103 Bacteria 15999
606 Ga0500556_0044243 3300053104 Bacteria 1584
607 Ga0500568_0003412 3300053139 Bacteria 8870
608 Ga0500616_0000357 3300053153 Bacteria 64980
609 Ga0500645_001011 3300053730 Bacteria 15815
610 Ga0501084_0003838 3300054114 Bacteria 12230
611 Ga0501084_0018012 3300054114 Bacteria 5882
612 Ga0501084_0019295 3300054114 Bacteria 5680
613 Ga0501084_0058046 3300054114 Bacteria 3238
614 Ga0590071_001237 3300059421 Bacteria 6908
615 Ga0590071_002281 3300059421 Bacteria 4854
616 Ga0590074_001098 3300059423 Bacteria 4263
617 Ga0590077_001268 3300059426 Bacteria 6039
618 Ga0501082_0003127 3300060353 Bacteria 14437
619 Ga0501082_0007448 3300060353 Bacteria 9445
620 Ga0501082_0063280 3300060353 Bacteria 3186
621 Ga0501082_0118569 3300060353 Bacteria 2293
622 Ga0501082_0119482 3300060353 Bacteria 2284
623 Ga0501082_0136285 3300060353 Bacteria 2130
624 Ga0530510_0001585 3300061734 Bacteria 15338
625 Ga0530510_0003022 3300061734 Bacteria 11553
626 Ga0530510_0038208 3300061734 Bacteria 3466
627 Ga0530510_0044052 3300061734 Bacteria 3224
628 Ga0530510_0094472 3300061734 Bacteria 2184

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047319 Ga0495674_0138611 Ga0495674_0138611_578_1795 371
2 3300048904 Ga0496101_0029791 Ga0496101_0029791_1651_3021 385
3 3300048914 Ga0496111_0030399 Ga0496111_0030399_1272_2642 385
4 3300048915 Ga0496112_0044954 Ga0496112_0044954_1408_2778 385
5 3300042156 Ga0439446_0008260 Ga0439446_0008260_1573_2748 390
6 3300050494 nmdc:mga06z11_101975_c1 nmdc:mga06z11_101975_c1_381_1565 391
7 3300041408 Ga0439453_0014082 Ga0439453_0014082_120_1310 392
8 3300025961 Ga0207712_10200293 Ga0207712_102002931 393
9 3300025972 Ga0207668_10199597 Ga0207668_101995972 393
10 3300048914 Ga0496111_0080652 Ga0496111_0080652_1154_2344 394
11 3300049592 Ga0501076_0101039 Ga0501076_0101039_99_1454 411
12 3300060353 Ga0501082_0063280 Ga0501082_0063280_241_1596 411
13 3300006844 Ga0075428_100008684 Ga0075428_1000086846 412
14 3300006846 Ga0075430_100172356 Ga0075430_1001723562 412
15 3300006847 Ga0075431_100321780 Ga0075431_1003217802 412
16 3300009147 Ga0114129_10014680 Ga0114129_100146802 412
17 3300009553 Ga0105249_10110728 Ga0105249_101107282 412
18 3300013296 Ga0157374_10333221 Ga0157374_103332211 412
19 3300049587 Ga0501071_0056395 Ga0501071_0056395_473_1831 412
20 3300050507 nmdc:mga05p37_10752_c1 nmdc:mga05p37_10752_c1_8000_9355 412
21 3300050508 nmdc:mga09592_86359_c1 nmdc:mga09592_86359_c1_467_1822 412
22 3300050509 nmdc:mga0qj67_11170_c1 nmdc:mga0qj67_11170_c1_3870_5225 412
23 3300050510 nmdc:mga06r32_16241_c1 nmdc:mga06r32_16241_c1_1556_2911 412
24 3300060353 Ga0501082_0118569 Ga0501082_0118569_717_2075 412
25 3300026088 Ga0207641_10194986 Ga0207641_101949862 415
26 3300005331 Ga0070670_100004478 Ga0070670_1000044783 419
27 3300005577 Ga0068857_100088516 Ga0068857_1000885162 419
28 3300025925 Ga0207650_10014293 Ga0207650_100142932 419
29 3300025945 Ga0207679_10043426 Ga0207679_100434262 419
30 3300026116 Ga0207674_10095976 Ga0207674_100959764 419
31 3300006846 Ga0075430_100017112 Ga0075430_1000171124 420
32 3300009147 Ga0114129_10020336 Ga0114129_100203362 420
33 3300049581 Ga0501047_0043788 Ga0501047_0043788_2675_4030 420
34 3300049593 Ga0501077_0090010 Ga0501077_0090010_80_1429 420
35 3300050509 nmdc:mga0qj67_14596_c1 nmdc:mga0qj67_14596_c1_1080_2435 420
36 3300050515 nmdc:mga0a205_26590_c1 nmdc:mga0a205_26590_c1_26_1426 420
37 3300048928 Ga0496125_0014145 Ga0496125_0014145_5580_6887 422
38 3300048929 Ga0496126_0066038 Ga0496126_0066038_1681_2988 422
39 3300059421 Ga0590071_002281 Ga0590071_002281_3263_4618 422
40 3300059426 Ga0590077_001268 Ga0590077_001268_356_1711 422
41 3300006178 Ga0075367_10006328 Ga0075367_100063282 424
42 3300006195 Ga0075366_10005550 Ga0075366_100055509 424
43 3300050493 nmdc:mga0k408_12780_c1 nmdc:mga0k408_12780_c1_2113_3480 424
44 3300005617 Ga0068859_100187387 Ga0068859_1001873873 425
45 3300006931 Ga0097620_100187389 Ga0097620_1001873893 425
46 3300005290 Ga0065712_10074835 Ga0065712_100748355 426
47 3300005354 Ga0070675_100173071 Ga0070675_1001730711 426
48 3300006847 Ga0075431_100188792 Ga0075431_1001887922 426
49 3300014325 Ga0163163_10219336 Ga0163163_102193362 426
50 3300027907 Ga0207428_10005890 Ga0207428_100058905 426
51 3300031852 Ga0307410_10014419 Ga0307410_100144195 427
52 3300031995 Ga0307409_100049813 Ga0307409_1000498134 427
53 3300005365 Ga0070688_100161770 Ga0070688_1001617702 428
54 3300045976 Ga0466967_0041952 Ga0466967_0041952_1893_3248 428
55 3300005290 Ga0065712_10072809 Ga0065712_100728093 429
56 3300005295 Ga0065707_10141556 Ga0065707_101415561 429
57 3300005329 Ga0070683_100000094 Ga0070683_10000009442 429
58 3300005331 Ga0070670_100008888 Ga0070670_1000088889 429
59 3300005334 Ga0068869_100149393 Ga0068869_1001493931 429
60 3300005344 Ga0070661_100001504 Ga0070661_10000150417 429
61 3300005353 Ga0070669_100001822 Ga0070669_10000182210 429
62 3300005355 Ga0070671_100096726 Ga0070671_1000967262 429
63 3300005435 Ga0070714_100007866 Ga0070714_1000078662 429
64 3300005455 Ga0070663_100031649 Ga0070663_1000316491 429
65 3300005535 Ga0070684_100000166 Ga0070684_1000001662 429
66 3300005543 Ga0070672_100056176 Ga0070672_1000561762 429
67 3300005564 Ga0070664_100000479 Ga0070664_10000047919 429
68 3300005844 Ga0068862_100003872 Ga0068862_1000038728 429
69 3300025315 Ga0207697_10011895 Ga0207697_100118952 429
70 3300025920 Ga0207649_10010919 Ga0207649_100109196 429
71 3300025923 Ga0207681_10004627 Ga0207681_100046271 429
72 3300025931 Ga0207644_10142973 Ga0207644_101429732 429
73 3300025933 Ga0207706_10114722 Ga0207706_101147221 429
74 3300025940 Ga0207691_10079823 Ga0207691_100798234 429
75 3300025941 Ga0207711_10044920 Ga0207711_100449202 429
76 3300025945 Ga0207679_10002245 Ga0207679_100022455 429
77 3300026067 Ga0207678_10040510 Ga0207678_100405102 429
78 3300026075 Ga0207708_10030974 Ga0207708_100309744 429
79 3300027907 Ga0207428_10004630 Ga0207428_100046308 429
80 3300006852 Ga0075433_10029168 Ga0075433_100291684 430
81 3300050515 nmdc:mga0a205_20223_c1 nmdc:mga0a205_20223_c1_2170_3519 430
82 3300005328 Ga0070676_10024444 Ga0070676_100244442 434
83 3300005335 Ga0070666_10016999 Ga0070666_100169996 434
84 3300005341 Ga0070691_10088045 Ga0070691_100880451 434
85 3300005343 Ga0070687_100074041 Ga0070687_1000740412 434
86 3300005353 Ga0070669_100071654 Ga0070669_1000716544 434
87 3300005355 Ga0070671_100030807 Ga0070671_1000308072 434
88 3300005356 Ga0070674_100025038 Ga0070674_1000250385 434
89 3300005364 Ga0070673_100014365 Ga0070673_1000143657 434
90 3300005438 Ga0070701_10027212 Ga0070701_100272122 434
91 3300005440 Ga0070705_100012340 Ga0070705_1000123403 434
92 3300005445 Ga0070708_100000162 Ga0070708_10000016237 434
93 3300005459 Ga0068867_100228558 Ga0068867_1002285581 434
94 3300005578 Ga0068854_100060652 Ga0068854_1000606522 434
95 3300005617 Ga0068859_100155036 Ga0068859_1001550362 434
96 3300005718 Ga0068866_10051816 Ga0068866_100518162 434
97 3300005841 Ga0068863_100187754 Ga0068863_1001877541 434
98 3300005842 Ga0068858_100250448 Ga0068858_1002504482 434
99 3300006931 Ga0097620_100155039 Ga0097620_1001550392 434
100 3300007076 Ga0075435_100009261 Ga0075435_1000092614 434
101 3300009098 Ga0105245_10063005 Ga0105245_100630052 434
102 3300009174 Ga0105241_10047376 Ga0105241_100473764 434
103 3300025904 Ga0207647_10058576 Ga0207647_100585761 434
104 3300025907 Ga0207645_10033518 Ga0207645_100335182 434
105 3300025911 Ga0207654_10086014 Ga0207654_100860141 434
106 3300025918 Ga0207662_10011144 Ga0207662_100111446 434
107 3300025923 Ga0207681_10072528 Ga0207681_100725282 434
108 3300025934 Ga0207686_10096590 Ga0207686_100965901 434
109 3300025936 Ga0207670_10105661 Ga0207670_101056612 434
110 3300025940 Ga0207691_10035100 Ga0207691_100351002 434
111 3300025945 Ga0207679_10106771 Ga0207679_101067712 434
112 3300026075 Ga0207708_10010053 Ga0207708_100100532 434
113 3300028381 Ga0268264_10072000 Ga0268264_100720004 434
114 3300041511 Ga0451855_0795620 Ga0451855_0795620_13_1347 436
115 3300042461 Ga0439460_0027810 Ga0439460_0027810_98_1453 436
116 3300053153 Ga0500616_0000357 Ga0500616_0000357_37398_38750 436
117 3300049582 Ga0501048_0099953 Ga0501048_0099953_152_1507 438
118 3300049587 Ga0501071_0119224 Ga0501071_0119224_443_1798 438
119 3300049592 Ga0501076_0005066 Ga0501076_0005066_43_1398 438
120 3300049824 Ga0501045_0085246 Ga0501045_0085246_822_2177 438
121 3300054114 Ga0501084_0058046 Ga0501084_0058046_84_1439 438
122 3300060353 Ga0501082_0136285 Ga0501082_0136285_372_1727 438
123 3300061734 Ga0530510_0038208 Ga0530510_0038208_23_1372 438
124 3300006844 Ga0075428_100005429 Ga0075428_1000054297 439
125 3300006847 Ga0075431_100003437 Ga0075431_10000343716 439
126 3300009094 Ga0111539_10120022 Ga0111539_101200224 439
127 3300050507 nmdc:mga05p37_38671_c1 nmdc:mga05p37_38671_c1_779_2233 439
128 3300050510 nmdc:mga06r32_43448_c1 nmdc:mga06r32_43448_c1_1181_2635 439
129 3300050511 nmdc:mga08y16_74127_c1 nmdc:mga08y16_74127_c1_598_2052 439
130 3300048928 Ga0496125_0000574 Ga0496125_0000574_59902_61236 441
131 3300049587 Ga0501071_0067384 Ga0501071_0067384_1126_2469 441
132 3300049588 Ga0501072_0017659 Ga0501072_0017659_224_1567 441
133 3300049824 Ga0501045_0036744 Ga0501045_0036744_119_1462 441
134 3300005548 Ga0070665_100218077 Ga0070665_1002180772 442
135 3300006844 Ga0075428_100303756 Ga0075428_1003037561 443
136 3300006852 Ga0075433_10084562 Ga0075433_100845622 443
137 3300009094 Ga0111539_10165743 Ga0111539_101657432 443
138 3300009147 Ga0114129_10000509 Ga0114129_1000050934 443
139 3300026035 Ga0207703_10052596 Ga0207703_100525963 443
140 3300027907 Ga0207428_10027128 Ga0207428_100271286 443
141 3300039062 Ga0400483_039556 Ga0400483_039556_4238_5569 443
142 3300044712 Ga0453684_0056633 Ga0453684_0056633_784_2115 443
143 3300045051 Ga0451576_0005235 Ga0451576_0005235_10437_11795 443
144 3300046463 Ga0495653_0055782 Ga0495653_0055782_656_1990 443
145 3300048909 Ga0496106_0129581 Ga0496106_0129581_194_1552 443
146 3300048925 Ga0496122_0023007 Ga0496122_0023007_1659_2990 443
147 3300049742 Ga0501080_0021766 Ga0501080_0021766_1209_2555 443
148 3300050507 nmdc:mga05p37_174_c1 nmdc:mga05p37_174_c1_29201_30559 443
149 3300050510 nmdc:mga06r32_297470_c1 nmdc:mga06r32_297470_c1_218_1576 443
150 3300050511 nmdc:mga08y16_61461_c1 nmdc:mga08y16_61461_c1_2311_3669 443
151 3300005331 Ga0070670_100103477 Ga0070670_1001034772 444
152 3300005354 Ga0070675_100030848 Ga0070675_1000308481 444
153 3300005354 Ga0070675_100069557 Ga0070675_1000695572 444
154 3300005355 Ga0070671_100014812 Ga0070671_1000148122 444
155 3300005364 Ga0070673_100042176 Ga0070673_1000421763 444
156 3300005367 Ga0070667_100023967 Ga0070667_1000239674 444
157 3300005564 Ga0070664_100017862 Ga0070664_1000178622 444
158 3300006042 Ga0075368_10010990 Ga0075368_100109902 444
159 3300006042 Ga0075368_10029383 Ga0075368_100293832 444
160 3300006051 Ga0075364_10094940 Ga0075364_100949402 444
161 3300006178 Ga0075367_10042952 Ga0075367_100429523 444
162 3300006195 Ga0075366_10019318 Ga0075366_100193185 444
163 3300006353 Ga0075370_10006583 Ga0075370_100065835 444
164 3300025926 Ga0207659_10042679 Ga0207659_100426793 444
165 3300025941 Ga0207711_10207639 Ga0207711_102076391 444
166 3300026023 Ga0207677_10145233 Ga0207677_101452332 444
167 3300026067 Ga0207678_10181967 Ga0207678_101819672 444
168 3300026095 Ga0207676_10017193 Ga0207676_100171933 444
169 3300026118 Ga0207675_100085552 Ga0207675_1000855522 444
170 3300026121 Ga0207683_10030430 Ga0207683_100304302 444
171 3300027682 Ga0209971_1013155 Ga0209971_10131552 444
172 3300042125 Ga0450923_002608 Ga0450923_002608_561_1976 444
173 3300042184 Ga0450908_004137 Ga0450908_004137_1355_2770 444
174 3300048905 Ga0496102_0304985 Ga0496102_0304985_20_1375 444
175 3300050491 nmdc:mga00v17_28120_c1 nmdc:mga00v17_28120_c1_523_1938 444
176 3300050491 nmdc:mga00v17_48985_c1 nmdc:mga00v17_48985_c1_305_1702 444
177 3300050493 nmdc:mga0k408_2125_c1 nmdc:mga0k408_2125_c1_7734_9149 444
178 3300050493 nmdc:mga0k408_4013_c1 nmdc:mga0k408_4013_c1_4240_5637 444
179 3300050494 nmdc:mga06z11_7360_c1 nmdc:mga06z11_7360_c1_2278_3675 444
180 3300050496 nmdc:mga07m45_3761_c1 nmdc:mga07m45_3761_c1_2579_3994 444
181 3300050511 nmdc:mga08y16_22244_c1 nmdc:mga08y16_22244_c1_5200_6549 444
182 3300061734 Ga0530510_0003022 Ga0530510_0003022_7819_9165 444
183 3300005293 Ga0065715_10000948 Ga0065715_100009482 445
184 3300005295 Ga0065707_10001756 Ga0065707_100017568 445
185 3300005457 Ga0070662_100156363 Ga0070662_1001563632 445
186 3300005545 Ga0070695_100011283 Ga0070695_1000112831 445
187 3300005549 Ga0070704_100008602 Ga0070704_1000086021 445
188 3300005617 Ga0068859_100012501 Ga0068859_1000125017 445
189 3300005719 Ga0068861_100044855 Ga0068861_1000448553 445
190 3300005842 Ga0068858_100001750 Ga0068858_1000017507 445
191 3300005844 Ga0068862_100032463 Ga0068862_1000324635 445
192 3300005844 Ga0068862_100069193 Ga0068862_1000691933 445
193 3300006051 Ga0075364_10012231 Ga0075364_100122313 445
194 3300006178 Ga0075367_10021992 Ga0075367_100219922 445
195 3300006178 Ga0075367_10047619 Ga0075367_100476193 445
196 3300006844 Ga0075428_100000017 Ga0075428_10000001732 445
197 3300006931 Ga0097620_100012502 Ga0097620_1000125027 445
198 3300009094 Ga0111539_10000002 Ga0111539_10000002406 445
199 3300009553 Ga0105249_10040966 Ga0105249_100409663 445
200 3300014326 Ga0157380_10011831 Ga0157380_100118315 445
201 3300014326 Ga0157380_10012730 Ga0157380_100127303 445
202 3300014968 Ga0157379_10006964 Ga0157379_100069643 445
203 3300025908 Ga0207643_10037681 Ga0207643_100376813 445
204 3300026035 Ga0207703_10003700 Ga0207703_1000370012 445
205 3300027907 Ga0207428_10000004 Ga0207428_10000004250 445
206 3300028380 Ga0268265_10049460 Ga0268265_100494602 445
207 3300028666 Ga0265336_10008570 Ga0265336_100085703 445
208 3300031548 Ga0307408_100114902 Ga0307408_1001149022 445
209 3300042876 Ga0451577_0030159 Ga0451577_0030159_3329_4672 445
210 3300048919 Ga0496116_0000815 Ga0496116_0000815_35447_36784 445
211 3300048925 Ga0496122_0000349 Ga0496122_0000349_30025_31365 445
212 3300048926 Ga0496123_0024362 Ga0496123_0024362_2682_4022 445
213 3300048928 Ga0496125_0039832 Ga0496125_0039832_1294_2634 445
214 3300048929 Ga0496126_0000424 Ga0496126_0000424_33515_34855 445
215 3300049572 Ga0501036_0126719 Ga0501036_0126719_610_1959 445
216 3300049575 Ga0501039_0018193 Ga0501039_0018193_37_1386 445
217 3300049576 Ga0501040_0045941 Ga0501040_0045941_932_2284 445
218 3300049577 Ga0501041_0149784 Ga0501041_0149784_48_1397 445
219 3300049587 Ga0501071_0019912 Ga0501071_0019912_30_1379 445
220 3300049588 Ga0501072_0099199 Ga0501072_0099199_13_1362 445
221 3300049592 Ga0501076_0138260 Ga0501076_0138260_181_1530 445
222 3300049822 Ga0501035_0143590 Ga0501035_0143590_592_1941 445
223 3300049824 Ga0501045_0018171 Ga0501045_0018171_1289_2638 445
224 3300050492 nmdc:mga0yw44_107822_c1 nmdc:mga0yw44_107822_c1_269_1627 445
225 3300050493 nmdc:mga0k408_42982_c1 nmdc:mga0k408_42982_c1_488_1846 445
226 3300050511 nmdc:mga08y16_2_c1 nmdc:mga08y16_2_c1_506751_508091 445
227 3300053103 Ga0500555_000499 Ga0500555_000499_11089_12441 445
228 3300053139 Ga0500568_0003412 Ga0500568_0003412_5352_6710 445
229 3300053730 Ga0500645_001011 Ga0500645_001011_12702_14054 445
230 3300059421 Ga0590071_001237 Ga0590071_001237_4328_5677 445
231 3300059423 Ga0590074_001098 Ga0590074_001098_308_1657 445
232 3300060353 Ga0501082_0119482 Ga0501082_0119482_36_1385 445
233 3300061734 Ga0530510_0044052 Ga0530510_0044052_1609_2949 445
234 3300061734 Ga0530510_0094472 Ga0530510_0094472_137_1486 445
235 3300005518 Ga0070699_100001694 Ga0070699_10000169423 446
236 3300006847 Ga0075431_100031118 Ga0075431_1000311182 446
237 3300006852 Ga0075433_10026586 Ga0075433_100265861 446
238 3300006880 Ga0075429_100112902 Ga0075429_1001129021 446
239 3300006914 Ga0075436_100027279 Ga0075436_1000272791 446
240 3300009147 Ga0114129_10058610 Ga0114129_100586102 446
241 3300009177 Ga0105248_10184596 Ga0105248_101845962 446
242 3300014326 Ga0157380_10063406 Ga0157380_100634062 446
243 3300014969 Ga0157376_10172096 Ga0157376_101720962 446
244 3300026075 Ga0207708_10033577 Ga0207708_100335772 446
245 3300027907 Ga0207428_10024129 Ga0207428_100241293 446
246 3300031852 Ga0307410_10104215 Ga0307410_101042152 446
247 3300041999 Ga0439433_0016785 Ga0439433_0016785_199_1560 446
248 3300048905 Ga0496102_0094309 Ga0496102_0094309_1361_2707 446
249 3300049572 Ga0501036_0016338 Ga0501036_0016338_2704_4059 446
250 3300049576 Ga0501040_0004136 Ga0501040_0004136_4061_5416 446
251 3300049577 Ga0501041_0022760 Ga0501041_0022760_1346_2701 446
252 3300049578 Ga0501042_0001424 Ga0501042_0001424_5938_7293 446
253 3300049578 Ga0501042_0086827 Ga0501042_0086827_148_1518 446
254 3300049579 Ga0501043_0039369 Ga0501043_0039369_1021_2376 446
255 3300049580 Ga0501046_0002275 Ga0501046_0002275_12835_14190 446
256 3300049582 Ga0501048_0003455 Ga0501048_0003455_4189_5544 446
257 3300049584 Ga0501068_0004277 Ga0501068_0004277_2654_4009 446
258 3300049587 Ga0501071_0016306 Ga0501071_0016306_3175_4530 446
259 3300049588 Ga0501072_0061899 Ga0501072_0061899_1196_2551 446
260 3300049589 Ga0501073_0007964 Ga0501073_0007964_4957_6330 446
261 3300049591 Ga0501075_0001274 Ga0501075_0001274_9729_11084 446
262 3300049592 Ga0501076_0065901 Ga0501076_0065901_452_1807 446
263 3300049593 Ga0501077_0015655 Ga0501077_0015655_1292_2647 446
264 3300049741 Ga0501079_0001902 Ga0501079_0001902_1083_2438 446
265 3300049743 Ga0501081_0001000 Ga0501081_0001000_10913_12268 446
266 3300049824 Ga0501045_0001367 Ga0501045_0001367_8048_9403 446
267 3300050507 nmdc:mga05p37_211412_c1 nmdc:mga05p37_211412_c1_864_2207 446
268 3300050507 nmdc:mga05p37_79286_c1 nmdc:mga05p37_79286_c1_407_1777 446
269 3300050508 nmdc:mga09592_147875_c1 nmdc:mga09592_147875_c1_553_1920 446
270 3300050510 nmdc:mga06r32_25841_c1 nmdc:mga06r32_25841_c1_4113_5456 446
271 3300060353 Ga0501082_0003127 Ga0501082_0003127_11867_13222 446
272 3300005339 Ga0070660_100011435 Ga0070660_1000114358 447
273 3300005354 Ga0070675_100000126 Ga0070675_10000012639 447
274 3300005356 Ga0070674_100079368 Ga0070674_1000793682 447
275 3300005471 Ga0070698_100054713 Ga0070698_1000547132 447
276 3300005530 Ga0070679_100028072 Ga0070679_1000280727 447
277 3300005544 Ga0070686_100000486 Ga0070686_10000048615 447
278 3300005578 Ga0068854_100012140 Ga0068854_1000121404 447
279 3300005614 Ga0068856_100194009 Ga0068856_1001940092 447
280 3300005841 Ga0068863_100002641 Ga0068863_10000264123 447
281 3300005841 Ga0068863_100091208 Ga0068863_1000912084 447
282 3300005937 Ga0081455_10033236 Ga0081455_100332365 447
283 3300006237 Ga0097621_100223723 Ga0097621_1002237231 447
284 3300006358 Ga0068871_100037728 Ga0068871_1000377284 447
285 3300007076 Ga0075435_100001286 Ga0075435_1000012865 447
286 3300009093 Ga0105240_10105162 Ga0105240_101051625 447
287 3300009094 Ga0111539_10019212 Ga0111539_100192122 447
288 3300009147 Ga0114129_10054015 Ga0114129_100540154 447
289 3300009147 Ga0114129_10186842 Ga0114129_101868423 447
290 3300009177 Ga0105248_10102509 Ga0105248_101025092 447
291 3300013297 Ga0157378_10100195 Ga0157378_101001952 447
292 3300013308 Ga0157375_10382497 Ga0157375_103824971 447
293 3300014745 Ga0157377_10040929 Ga0157377_100409292 447
294 3300014969 Ga0157376_10008007 Ga0157376_100080073 447
295 3300025919 Ga0207657_10005005 Ga0207657_1000500510 447
296 3300025921 Ga0207652_10084407 Ga0207652_100844072 447
297 3300025926 Ga0207659_10000390 Ga0207659_100003907 447
298 3300025933 Ga0207706_10076550 Ga0207706_100765504 447
299 3300026088 Ga0207641_10012095 Ga0207641_100120955 447
300 3300026088 Ga0207641_10191323 Ga0207641_101913232 447
301 3300028381 Ga0268264_10229424 Ga0268264_102294242 447
302 3300034816 Ga0373930_0000441 Ga0373930_0000441_3916_5265 447
303 3300034817 Ga0373948_0000557 Ga0373948_0000557_987_2336 447
304 3300034819 Ga0373958_0000887 Ga0373958_0000887_127_1476 447
305 3300034957 Ga0373938_0001804 Ga0373938_0001804_1868_3217 447
306 3300035084 Ga0373928_0001759 Ga0373928_0001759_227_1576 447
307 3300035085 Ga0373929_0001613 Ga0373929_0001613_2623_3972 447
308 3300035088 Ga0373940_0008255 Ga0373940_0008255_203_1552 447
309 3300035091 Ga0373951_0000690 Ga0373951_0000690_733_2082 447
310 3300035092 Ga0373952_0001034 Ga0373952_0001034_2889_4238 447
311 3300035112 Ga0373932_0003685 Ga0373932_0003685_1497_2846 447
312 3300035114 Ga0373939_0001367 Ga0373939_0001367_2316_3665 447
313 3300035115 Ga0373941_0000981 Ga0373941_0000981_954_2303 447
314 3300035121 Ga0373960_0026152 Ga0373960_0026152_96_1445 447
315 3300035171 Ga0373946_0003457 Ga0373946_0003457_1270_2619 447
316 3300035207 Ga0373942_0001306 Ga0373942_0001306_5047_6396 447
317 3300035242 Ga0373962_0021961 Ga0373962_0021961_200_1549 447
318 3300035691 Ga0373931_0005785 Ga0373931_0005785_203_1552 447
319 3300035725 Ga0373947_0017466 Ga0373947_0017466_92_1441 447
320 3300036401 Ga0373937_0095858 Ga0373937_0095858_611_1960 447
321 3300037068 Ga0373925_0078527 Ga0373925_0078527_109_1458 447
322 3300042156 Ga0439446_0017105 Ga0439446_0017105_63_1424 447
323 3300045051 Ga0451576_0052316 Ga0451576_0052316_2754_4103 447
324 3300046454 Ga0495592_0064223 Ga0495592_0064223_376_1725 447
325 3300046491 Ga0495584_0099036 Ga0495584_0099036_23_1372 447
326 3300046511 Ga0495608_0051364 Ga0495608_0051364_484_1833 447
327 3300046516 Ga0495628_0044481 Ga0495628_0044481_387_1736 447
328 3300046517 Ga0495630_0009657 Ga0495630_0009657_4756_6105 447
329 3300046535 Ga0495586_0107331 Ga0495586_0107331_142_1491 447
330 3300046536 Ga0495587_0091378 Ga0495587_0091378_398_1747 447
331 3300046543 Ga0495645_0109708 Ga0495645_0109708_106_1455 447
332 3300046678 Ga0495599_0027828 Ga0495599_0027828_339_1688 447
333 3300046679 Ga0495623_0029105 Ga0495623_0029105_850_2199 447
334 3300046681 Ga0495647_0035491 Ga0495647_0035491_424_1773 447
335 3300046683 Ga0495658_0050694 Ga0495658_0050694_221_1570 447
336 3300046683 Ga0495658_0066925 Ga0495658_0066925_337_1686 447
337 3300046684 Ga0495669_0088007 Ga0495669_0088007_48_1397 447
338 3300046689 Ga0495613_0070257 Ga0495613_0070257_30_1379 447
339 3300046809 Ga0495600_0029435 Ga0495600_0029435_611_1960 447
340 3300047317 Ga0495604_0063069 Ga0495604_0063069_391_1740 447
341 3300047319 Ga0495674_0071787 Ga0495674_0071787_1186_2535 447
342 3300047471 Ga0495684_0003170 Ga0495684_0003170_3840_5189 447
343 3300049569 Ga0501032_0004704 Ga0501032_0004704_1077_2450 447
344 3300049570 Ga0501033_0045609 Ga0501033_0045609_1077_2450 447
345 3300049571 Ga0501034_0013896 Ga0501034_0013896_292_1662 447
346 3300049571 Ga0501034_0015056 Ga0501034_0015056_440_1813 447
347 3300049572 Ga0501036_0009593 Ga0501036_0009593_3782_5155 447
348 3300049572 Ga0501036_0124735 Ga0501036_0124735_249_1619 447
349 3300049573 Ga0501037_0002266 Ga0501037_0002266_8846_10219 447
350 3300049573 Ga0501037_0002567 Ga0501037_0002567_11003_12373 447
351 3300049574 Ga0501038_0005902 Ga0501038_0005902_1077_2450 447
352 3300049578 Ga0501042_0002431 Ga0501042_0002431_6390_7763 447
353 3300049579 Ga0501043_0003546 Ga0501043_0003546_953_2323 447
354 3300049579 Ga0501043_0031965 Ga0501043_0031965_568_1941 447
355 3300049580 Ga0501046_0054732 Ga0501046_0054732_423_1793 447
356 3300049580 Ga0501046_0063267 Ga0501046_0063267_949_2322 447
357 3300049580 Ga0501046_0070814 Ga0501046_0070814_228_1598 447
358 3300049581 Ga0501047_0030091 Ga0501047_0030091_2646_4016 447
359 3300049581 Ga0501047_0038630 Ga0501047_0038630_440_1813 447
360 3300049582 Ga0501048_0002414 Ga0501048_0002414_1691_3064 447
361 3300049582 Ga0501048_0045271 Ga0501048_0045271_1218_2588 447
362 3300049583 Ga0501067_0000782 Ga0501067_0000782_8877_10250 447
363 3300049585 Ga0501069_0002468 Ga0501069_0002468_4300_5673 447
364 3300049586 Ga0501070_0005948 Ga0501070_0005948_1836_3209 447
365 3300049587 Ga0501071_0006748 Ga0501071_0006748_4951_6324 447
366 3300049588 Ga0501072_0016341 Ga0501072_0016341_431_1804 447
367 3300049589 Ga0501073_0002917 Ga0501073_0002917_8775_10148 447
368 3300049589 Ga0501073_0005139 Ga0501073_0005139_6569_7939 447
369 3300049590 Ga0501074_0002067 Ga0501074_0002067_3624_4997 447
370 3300049592 Ga0501076_0089690 Ga0501076_0089690_365_1714 447
371 3300049742 Ga0501080_0015434 Ga0501080_0015434_1166_2539 447
372 3300049742 Ga0501080_0050302 Ga0501080_0050302_260_1630 447
373 3300049742 Ga0501080_0087756 Ga0501080_0087756_964_2334 447
374 3300049744 Ga0501083_0018618 Ga0501083_0018618_2250_3620 447
375 3300049744 Ga0501083_0098078 Ga0501083_0098078_37_1410 447
376 3300049822 Ga0501035_0019824 Ga0501035_0019824_4503_5876 447
377 3300049822 Ga0501035_0099096 Ga0501035_0099096_58_1428 447
378 3300049823 Ga0501044_0101794 Ga0501044_0101794_949_2322 447
379 3300049824 Ga0501045_0067868 Ga0501045_0067868_567_1940 447
380 3300050507 nmdc:mga05p37_28754_c1 nmdc:mga05p37_28754_c1_1693_3039 447
381 3300050512 nmdc:mga0n895_205450_c1 nmdc:mga0n895_205450_c1_279_1622 447
382 3300050512 nmdc:mga0n895_29979_c1 nmdc:mga0n895_29979_c1_276_1625 447
383 3300050512 nmdc:mga0n895_67811_c1 nmdc:mga0n895_67811_c1_626_1975 447
384 3300050513 nmdc:mga0rr50_50838_c1 nmdc:mga0rr50_50838_c1_790_2139 447
385 3300050515 nmdc:mga0a205_72618_c1 nmdc:mga0a205_72618_c1_1250_2599 447
386 3300053077 Ga0495601_0016819 Ga0495601_0016819_1209_2558 447
387 3300053085 Ga0495619_0017244 Ga0495619_0017244_789_2138 447
388 3300053085 Ga0495619_0031918 Ga0495619_0031918_1976_3337 447
389 3300053104 Ga0500556_0044243 Ga0500556_0044243_132_1490 447
390 3300054114 Ga0501084_0003838 Ga0501084_0003838_7140_8513 447
391 3300054114 Ga0501084_0019295 Ga0501084_0019295_325_1695 447
392 3300002459 JGI24751J29686_10011478 JGI24751J29686_100114782 448
393 3300005290 Ga0065712_10003788 Ga0065712_100037883 448
394 3300005290 Ga0065712_10070494 Ga0065712_100704942 448
395 3300005290 Ga0065712_10081865 Ga0065712_100818651 448
396 3300005293 Ga0065715_10095716 Ga0065715_100957165 448
397 3300005295 Ga0065707_10019567 Ga0065707_100195672 448
398 3300005295 Ga0065707_10099613 Ga0065707_100996134 448
399 3300005329 Ga0070683_100015813 Ga0070683_1000158132 448
400 3300005331 Ga0070670_100006909 Ga0070670_1000069097 448
401 3300005331 Ga0070670_100020449 Ga0070670_1000204497 448
402 3300005331 Ga0070670_100034099 Ga0070670_1000340991 448
403 3300005347 Ga0070668_100033204 Ga0070668_1000332043 448
404 3300005353 Ga0070669_100001826 Ga0070669_10000182615 448
405 3300005353 Ga0070669_100197626 Ga0070669_1001976261 448
406 3300005354 Ga0070675_100034056 Ga0070675_1000340565 448
407 3300005355 Ga0070671_100034791 Ga0070671_1000347911 448
408 3300005356 Ga0070674_100009134 Ga0070674_1000091348 448
409 3300005364 Ga0070673_100024733 Ga0070673_1000247332 448
410 3300005439 Ga0070711_100102635 Ga0070711_1001026352 448
411 3300005471 Ga0070698_100046350 Ga0070698_1000463502 448
412 3300005518 Ga0070699_100028109 Ga0070699_1000281096 448
413 3300005530 Ga0070679_100074307 Ga0070679_1000743073 448
414 3300005545 Ga0070695_100032173 Ga0070695_1000321732 448
415 3300005548 Ga0070665_100001142 Ga0070665_10000114225 448
416 3300005548 Ga0070665_100023391 Ga0070665_1000233913 448
417 3300005548 Ga0070665_100111511 Ga0070665_1001115112 448
418 3300005564 Ga0070664_100092357 Ga0070664_1000923572 448
419 3300005617 Ga0068859_100043379 Ga0068859_1000433796 448
420 3300005618 Ga0068864_100105780 Ga0068864_1001057802 448
421 3300005618 Ga0068864_100138272 Ga0068864_1001382722 448
422 3300005842 Ga0068858_100044229 Ga0068858_1000442292 448
423 3300005842 Ga0068858_100058941 Ga0068858_1000589412 448
424 3300005842 Ga0068858_100110332 Ga0068858_1001103322 448
425 3300005842 Ga0068858_100181638 Ga0068858_1001816381 448
426 3300005843 Ga0068860_100204813 Ga0068860_1002048132 448
427 3300005843 Ga0068860_100337354 Ga0068860_1003373542 448
428 3300005844 Ga0068862_100103821 Ga0068862_1001038211 448
429 3300005985 Ga0081539_10032414 Ga0081539_100324143 448
430 3300006038 Ga0075365_10023639 Ga0075365_100236393 448
431 3300006195 Ga0075366_10063890 Ga0075366_100638902 448
432 3300006237 Ga0097621_100001492 Ga0097621_10000149213 448
433 3300006237 Ga0097621_100002965 Ga0097621_1000029655 448
434 3300006237 Ga0097621_100028749 Ga0097621_1000287496 448
435 3300006237 Ga0097621_100054521 Ga0097621_1000545212 448
436 3300006358 Ga0068871_100007809 Ga0068871_1000078095 448
437 3300006358 Ga0068871_100060378 Ga0068871_1000603784 448
438 3300006358 Ga0068871_100085065 Ga0068871_1000850652 448
439 3300006358 Ga0068871_100131725 Ga0068871_1001317253 448
440 3300006358 Ga0068871_100172716 Ga0068871_1001727162 448
441 3300006844 Ga0075428_100003278 Ga0075428_10000327818 448
442 3300006844 Ga0075428_100036637 Ga0075428_1000366376 448
443 3300006846 Ga0075430_100005222 Ga0075430_1000052227 448
444 3300006846 Ga0075430_100055833 Ga0075430_1000558331 448
445 3300006852 Ga0075433_10138524 Ga0075433_101385242 448
446 3300006852 Ga0075433_10147817 Ga0075433_101478172 448
447 3300006852 Ga0075433_10200726 Ga0075433_102007261 448
448 3300006871 Ga0075434_100001891 Ga0075434_1000018913 448
449 3300006871 Ga0075434_100014324 Ga0075434_1000143243 448
450 3300006871 Ga0075434_100022053 Ga0075434_1000220538 448
451 3300006881 Ga0068865_100000768 Ga0068865_1000007688 448
452 3300006881 Ga0068865_100158979 Ga0068865_1001589791 448
453 3300006914 Ga0075436_100001121 Ga0075436_1000011213 448
454 3300006914 Ga0075436_100020929 Ga0075436_1000209296 448
455 3300006931 Ga0097620_100043380 Ga0097620_1000433802 448
456 3300007076 Ga0075435_100000342 Ga0075435_10000034219 448
457 3300007076 Ga0075435_100001999 Ga0075435_1000019998 448
458 3300007076 Ga0075435_100002624 Ga0075435_1000026245 448
459 3300007076 Ga0075435_100046688 Ga0075435_1000466883 448
460 3300009093 Ga0105240_10055960 Ga0105240_100559605 448
461 3300009094 Ga0111539_10007496 Ga0111539_100074967 448
462 3300009094 Ga0111539_10034772 Ga0111539_100347723 448
463 3300009098 Ga0105245_10059423 Ga0105245_100594234 448
464 3300009147 Ga0114129_10001667 Ga0114129_1000166720 448
465 3300009147 Ga0114129_10003035 Ga0114129_1000303523 448
466 3300009147 Ga0114129_10009415 Ga0114129_100094156 448
467 3300009147 Ga0114129_10009699 Ga0114129_100096992 448
468 3300009177 Ga0105248_10004266 Ga0105248_100042666 448
469 3300009177 Ga0105248_10024004 Ga0105248_100240042 448
470 3300009177 Ga0105248_10026969 Ga0105248_100269697 448
471 3300009177 Ga0105248_10138322 Ga0105248_101383223 448
472 3300009177 Ga0105248_10266326 Ga0105248_102663262 448
473 3300009553 Ga0105249_10005969 Ga0105249_100059697 448
474 3300009553 Ga0105249_10251709 Ga0105249_102517092 448
475 3300013296 Ga0157374_10058802 Ga0157374_100588024 448
476 3300013296 Ga0157374_10360290 Ga0157374_103602901 448
477 3300013306 Ga0163162_10012905 Ga0163162_100129059 448
478 3300013306 Ga0163162_10219281 Ga0163162_102192812 448
479 3300013308 Ga0157375_10167031 Ga0157375_101670311 448
480 3300014325 Ga0163163_10003727 Ga0163163_1000372713 448
481 3300014325 Ga0163163_10029039 Ga0163163_100290392 448
482 3300014326 Ga0157380_10050159 Ga0157380_100501592 448
483 3300014968 Ga0157379_10046448 Ga0157379_100464483 448
484 3300014968 Ga0157379_10050038 Ga0157379_100500384 448
485 3300014968 Ga0157379_10050918 Ga0157379_100509183 448
486 3300014968 Ga0157379_10084538 Ga0157379_100845382 448
487 3300014969 Ga0157376_10007845 Ga0157376_100078456 448
488 3300025901 Ga0207688_10028214 Ga0207688_100282145 448
489 3300025912 Ga0207707_10197614 Ga0207707_101976142 448
490 3300025913 Ga0207695_10039395 Ga0207695_100393953 448
491 3300025916 Ga0207663_10084762 Ga0207663_100847622 448
492 3300025918 Ga0207662_10018922 Ga0207662_100189226 448
493 3300025919 Ga0207657_10067902 Ga0207657_100679022 448
494 3300025921 Ga0207652_10022007 Ga0207652_100220072 448
495 3300025923 Ga0207681_10014196 Ga0207681_100141962 448
496 3300025923 Ga0207681_10114895 Ga0207681_101148951 448
497 3300025925 Ga0207650_10003836 Ga0207650_100038366 448
498 3300025925 Ga0207650_10015514 Ga0207650_100155147 448
499 3300025926 Ga0207659_10107442 Ga0207659_101074421 448
500 3300025931 Ga0207644_10010148 Ga0207644_100101483 448
501 3300025933 Ga0207706_10019072 Ga0207706_100190723 448
502 3300025934 Ga0207686_10007943 Ga0207686_100079432 448
503 3300025937 Ga0207669_10016642 Ga0207669_100166424 448
504 3300025938 Ga0207704_10095550 Ga0207704_100955501 448
505 3300025940 Ga0207691_10053787 Ga0207691_100537873 448
506 3300025941 Ga0207711_10010209 Ga0207711_100102097 448
507 3300025941 Ga0207711_10019590 Ga0207711_100195902 448
508 3300025941 Ga0207711_10135936 Ga0207711_101359362 448
509 3300025941 Ga0207711_10287012 Ga0207711_102870121 448
510 3300025944 Ga0207661_10065930 Ga0207661_100659302 448
511 3300025944 Ga0207661_10124148 Ga0207661_101241482 448
512 3300025945 Ga0207679_10029861 Ga0207679_100298613 448
513 3300025960 Ga0207651_10082337 Ga0207651_100823372 448
514 3300025986 Ga0207658_10032627 Ga0207658_100326273 448
515 3300025986 Ga0207658_10051075 Ga0207658_100510752 448
516 3300026035 Ga0207703_10014502 Ga0207703_100145022 448
517 3300026035 Ga0207703_10159697 Ga0207703_101596971 448
518 3300026089 Ga0207648_10023964 Ga0207648_100239644 448
519 3300026089 Ga0207648_10042908 Ga0207648_100429081 448
520 3300026089 Ga0207648_10083579 Ga0207648_100835791 448
521 3300026089 Ga0207648_10141879 Ga0207648_101418792 448
522 3300026095 Ga0207676_10006796 Ga0207676_100067963 448
523 3300026095 Ga0207676_10155794 Ga0207676_101557942 448
524 3300026116 Ga0207674_10089536 Ga0207674_100895364 448
525 3300026118 Ga0207675_100009283 Ga0207675_1000092833 448
526 3300027907 Ga0207428_10036140 Ga0207428_100361402 448
527 3300028379 Ga0268266_10028632 Ga0268266_100286323 448
528 3300028379 Ga0268266_10033789 Ga0268266_100337896 448
529 3300028379 Ga0268266_10035948 Ga0268266_100359481 448
530 3300028380 Ga0268265_10001769 Ga0268265_100017697 448
531 3300028380 Ga0268265_10097487 Ga0268265_100974872 448
532 3300028381 Ga0268264_10211732 Ga0268264_102117322 448
533 3300031548 Ga0307408_100087751 Ga0307408_1000877513 448
534 3300031711 Ga0265314_10112931 Ga0265314_101129311 448
535 3300031731 Ga0307405_10040699 Ga0307405_100406992 448
536 3300031852 Ga0307410_10028237 Ga0307410_100282375 448
537 3300031911 Ga0307412_10061545 Ga0307412_100615452 448
538 3300031995 Ga0307409_100155745 Ga0307409_1001557452 448
539 3300032002 Ga0307416_100054406 Ga0307416_1000544061 448
540 3300032004 Ga0307414_10020289 Ga0307414_100202892 448
541 3300032005 Ga0307411_10016973 Ga0307411_100169732 448
542 3300032005 Ga0307411_10054969 Ga0307411_100549692 448
543 3300032126 Ga0307415_100057639 Ga0307415_1000576392 448
544 3300035089 Ga0373944_0016400 Ga0373944_0016400_522_1874 448
545 3300035111 Ga0373923_0061173 Ga0373923_0061173_47_1393 448
546 3300035242 Ga0373962_0024712 Ga0373962_0024712_81_1442 448
547 3300035692 Ga0373935_0079353 Ga0373935_0079353_43_1395 448
548 3300035725 Ga0373947_0043246 Ga0373947_0043246_87_1433 448
549 3300035725 Ga0373947_0073076 Ga0373947_0073076_661_2016 448
550 3300036401 Ga0373937_0005827 Ga0373937_0005827_9146_10507 448
551 3300036401 Ga0373937_0077236 Ga0373937_0077236_1016_2362 448
552 3300036401 Ga0373937_0300884 Ga0373937_0300884_77_1423 448
553 3300037068 Ga0373925_0003124 Ga0373925_0003124_7395_8756 448
554 3300039437 Ga0436365_0524534 Ga0436365_0524534_1030_2385 448
555 3300044712 Ga0453684_0076262 Ga0453684_0076262_1265_2620 448
556 3300046455 Ga0495603_0031140 Ga0495603_0031140_1429_2781 448
557 3300046543 Ga0495645_0001970 Ga0495645_0001970_1212_2564 448
558 3300048903 Ga0496100_0002904 Ga0496100_0002904_6655_8007 448
559 3300048905 Ga0496102_0012018 Ga0496102_0012018_3451_4803 448
560 3300048907 Ga0496104_0002167 Ga0496104_0002167_11635_12987 448
561 3300048907 Ga0496104_0003182 Ga0496104_0003182_6481_7836 448
562 3300048907 Ga0496104_0020436 Ga0496104_0020436_1853_3199 448
563 3300048907 Ga0496104_0319615 Ga0496104_0319615_70_1422 448
564 3300048908 Ga0496105_0043898 Ga0496105_0043898_858_2213 448
565 3300048908 Ga0496105_0065453 Ga0496105_0065453_504_1856 448
566 3300048908 Ga0496105_0080185 Ga0496105_0080185_1208_2554 448
567 3300048911 Ga0496108_0004769 Ga0496108_0004769_2299_3648 448
568 3300048911 Ga0496108_0046024 Ga0496108_0046024_271_1626 448
569 3300048911 Ga0496108_0155789 Ga0496108_0155789_600_1955 448
570 3300048912 Ga0496109_0000869 Ga0496109_0000869_16433_17788 448
571 3300048912 Ga0496109_0012600 Ga0496109_0012600_3184_4533 448
572 3300048913 Ga0496110_0009331 Ga0496110_0009331_5122_6477 448
573 3300048913 Ga0496110_0065613 Ga0496110_0065613_609_1955 448
574 3300048915 Ga0496112_0000918 Ga0496112_0000918_859_2214 448
575 3300048915 Ga0496112_0006389 Ga0496112_0006389_4217_5566 448
576 3300048915 Ga0496112_0039457 Ga0496112_0039457_389_1750 448
577 3300048915 Ga0496112_0088413 Ga0496112_0088413_1073_2479 448
578 3300048916 Ga0496113_0038387 Ga0496113_0038387_20_1369 448
579 3300048917 Ga0496114_0000494 Ga0496114_0000494_26150_27502 448
580 3300048917 Ga0496114_0195861 Ga0496114_0195861_331_1686 448
581 3300048917 Ga0496114_0273397 Ga0496114_0273397_90_1445 448
582 3300049571 Ga0501034_0013282 Ga0501034_0013282_5646_7010 448
583 3300049571 Ga0501034_0032055 Ga0501034_0032055_206_1573 448
584 3300049572 Ga0501036_0101653 Ga0501036_0101653_964_2325 448
585 3300049576 Ga0501040_0006238 Ga0501040_0006238_151_1512 448
586 3300049577 Ga0501041_0010308 Ga0501041_0010308_1087_2448 448
587 3300049582 Ga0501048_0052050 Ga0501048_0052050_1009_2370 448
588 3300049583 Ga0501067_0070322 Ga0501067_0070322_358_1713 448
589 3300049585 Ga0501069_0038187 Ga0501069_0038187_566_1921 448
590 3300049587 Ga0501071_0067647 Ga0501071_0067647_51_1412 448
591 3300049591 Ga0501075_0007335 Ga0501075_0007335_5885_7246 448
592 3300049592 Ga0501076_0158808 Ga0501076_0158808_54_1415 448
593 3300049741 Ga0501079_0050762 Ga0501079_0050762_1562_2923 448
594 3300049741 Ga0501079_0177126 Ga0501079_0177126_165_1517 448
595 3300049743 Ga0501081_0052995 Ga0501081_0052995_435_1796 448
596 3300049744 Ga0501083_0085637 Ga0501083_0085637_564_1916 448
597 3300049824 Ga0501045_0090057 Ga0501045_0090057_583_1944 448
598 3300050489 nmdc:mga03683_26814_c1 nmdc:mga03683_26814_c1_834_2195 448
599 3300050491 nmdc:mga00v17_5561_c1 nmdc:mga00v17_5561_c1_49_1410 448
600 3300050492 nmdc:mga0yw44_22581_c1 nmdc:mga0yw44_22581_c1_2011_3375 448
601 3300050494 nmdc:mga06z11_76999_c1 nmdc:mga06z11_76999_c1_246_1607 448
602 3300050507 nmdc:mga05p37_1991_c1 nmdc:mga05p37_1991_c1_22329_23681 448
603 3300050507 nmdc:mga05p37_25037_c1 nmdc:mga05p37_25037_c1_1921_3273 448
604 3300050507 nmdc:mga05p37_90050_c1 nmdc:mga05p37_90050_c1_2323_3678 448
605 3300050508 nmdc:mga09592_36441_c1 nmdc:mga09592_36441_c1_1707_3059 448
606 3300050509 nmdc:mga0qj67_23016_c1 nmdc:mga0qj67_23016_c1_3024_4376 448
607 3300050509 nmdc:mga0qj67_41323_c1 nmdc:mga0qj67_41323_c1_135_1487 448
608 3300050511 nmdc:mga08y16_141291_c1 nmdc:mga08y16_141291_c1_568_1920 448
609 3300050511 nmdc:mga08y16_33801_c1 nmdc:mga08y16_33801_c1_1038_2390 448
610 3300050511 nmdc:mga08y16_7358_c1 nmdc:mga08y16_7358_c1_2295_3650 448
611 3300050511 nmdc:mga08y16_8235_c1 nmdc:mga08y16_8235_c1_453_1805 448
612 3300050512 nmdc:mga0n895_13885_c1 nmdc:mga0n895_13885_c1_1867_3222 448
613 3300050512 nmdc:mga0n895_139476_c1 nmdc:mga0n895_139476_c1_544_1893 448
614 3300050512 nmdc:mga0n895_227_c1 nmdc:mga0n895_227_c1_17823_19175 448
615 3300050512 nmdc:mga0n895_281415_c1 nmdc:mga0n895_281415_c1_44_1459 448
616 3300050512 nmdc:mga0n895_3182_c1 nmdc:mga0n895_3182_c1_8576_9928 448
617 3300050513 nmdc:mga0rr50_132_c1 nmdc:mga0rr50_132_c1_28365_29717 448
618 3300050513 nmdc:mga0rr50_145140_c1 nmdc:mga0rr50_145140_c1_390_1742 448
619 3300050513 nmdc:mga0rr50_175_c1 nmdc:mga0rr50_175_c1_13045_14397 448
620 3300050513 nmdc:mga0rr50_75340_c1 nmdc:mga0rr50_75340_c1_1132_2481 448
621 3300050514 nmdc:mga08x19_954_c1 nmdc:mga08x19_954_c1_533_1885 448
622 3300050515 nmdc:mga0a205_203574_c1 nmdc:mga0a205_203574_c1_507_1859 448
623 3300050515 nmdc:mga0a205_43843_c1 nmdc:mga0a205_43843_c1_1363_2718 448
624 3300050515 nmdc:mga0a205_81626_c1 nmdc:mga0a205_81626_c1_173_1525 448
625 3300053085 Ga0495619_0030649 Ga0495619_0030649_747_2093 448
626 3300054114 Ga0501084_0018012 Ga0501084_0018012_3519_4880 448
627 3300060353 Ga0501082_0007448 Ga0501082_0007448_7505_8866 448
628 3300061734 Ga0530510_0001585 Ga0530510_0001585_3803_5164 448

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00772

DnaB

DnaB-like helicase N terminal domain

42

144

0.99

PF03796

DnaB_C

DnaB-like helicase C terminal domain

218

477

0.96

PF13481

AAA_25

AAA domain

225

400

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jwe-assembly1.cif.gz_A nmr structure of the n-terminal domain of e. coli dnab helicase 0.9576 8 119
1b79-assembly2.cif.gz_B n-terminal domain of dna replication protein dnab 0.9546 11 110
2r5u-assembly1.cif.gz_F crystal structure of the n-terminal domain of dnab helicase from mycobacterium tuberculosis 0.9477 9 148
2r5u-assembly1.cif.gz_E crystal structure of the n-terminal domain of dnab helicase from mycobacterium tuberculosis 0.9395 9 150
2r5u-assembly1.cif.gz_C crystal structure of the n-terminal domain of dnab helicase from mycobacterium tuberculosis 0.9388 9 149
ID Description Score Start End Superfamily
4esvC01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.9752 8 130 1.10.860.10
4esvI01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.9747 9 130 1.10.860.10
2r6dE01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.9708 11 130 1.10.860.10
4esvC01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.9675 8 130 1.10.860.10
2vyfB01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.9642 8 130 1.10.860.10
ID Description Score Start End GO Terms
AF-A0A5J4P5R4-F1-model_v4 Replicative DNA helicase (EC 3.6.4.12) 0.9757 185 358 GO:0005524
GO:0005829
GO:0006268
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518
AF-A0A358M8H0-F1-model_v4 Replicative DNA helicase 0.9745 206 445 GO:0003678
GO:0005524
GO:0005829
GO:0006268
AF-X1VAQ0-F1-model_v4 DNA 5'-3' helicase (EC 5.6.2.3) 0.9688 185 404 GO:0003678
GO:0005524
GO:0005829
GO:0006268
GO:0006269
GO:0016887
GO:1990077
AF-A0A2V6KQZ5-F1-model_v4 DNA 5'-3' helicase (EC 5.6.2.3) 0.9681 196 445 GO:0003678
GO:0005524
GO:0005829
GO:0006268
GO:0006269
GO:0016887
GO:1990077
AF-R7N0Z2-F1-model_v4 Replicative DNA helicase (EC 5.6.2.3) 0.9654 200 446 GO:0003677
GO:0003689
GO:0005524
GO:0005829
GO:0006268
GO:0006269
GO:0009378
GO:0016887
GO:0036121
GO:0061749
GO:0061775
GO:0140584
GO:0140665
GO:0140849
GO:1990077
GO:1990518

Feature Viewer

pLDDT pTM Quality
88.02 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map