F470620

General Info

Members Datasets Scaffolds Average Seq Length
628 391 1257 328

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100032492|Ga0070690_1000324925
Length 339
Sequence MKPHWSRTMFKGAVTGALCLAVIGSAGGQDAAANKDSAARPYPAKPVRIVVPYAAGGGTDALARFLAQGLERQLGQPFIIENRAGQGTATGGAYVARSAPDGYTLLAATSSTLAFNPSVYKKLPYDPLVDFSPISLVAAVPFVLVVNPSLPANSVSELVKLAKAKPGALSYASGGMGAPHHIYMELFKSMTGTDIRHIPYRGGGPALGDVVAGHVPIMFGDIGPVTGLVREGRVKALGVTVGKRVETIPEVPTLVEAGLAGYEANSWQSLVAPANVPSPIVTTLNKALTAFLAEPATRSHFLQLGMQPMSSTPQEFAVYLRAEIAKWAPIINAAGATED

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
78 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
109 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
114 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
116 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
169 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
170 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
179 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
180 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
181 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
182 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
183 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
198 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
199 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
200 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
201 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
215 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
216 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
217 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
218 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
219 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
220 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
221 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
222 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
223 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
224 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
227 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
228 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
229 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
230 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
231 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
232 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
233 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
234 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
235 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
236 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
237 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
238 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
239 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
240 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
252 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
253 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
254 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
255 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
256 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
259 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
260 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
261 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
262 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
263 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
267 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
268 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
274 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
275 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
282 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
299 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
300 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
304 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
314 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
315 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
318 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
329 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
332 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
333 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
334 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
335 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
336 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
337 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
338 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
339 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
340 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
341 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
342 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
343 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
344 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
345 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
346 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
347 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
348 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
349 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
350 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
351 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
352 2643221596 Acidovorax sp. Root70 Isolate Unclassified
353 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
354 2643221658 Variovorax sp. Root411 Isolate Unclassified
355 2643221672 Variovorax sp. Root434 Isolate Unclassified
356 2643221683 Variovorax sp. Root473 Isolate Unclassified
357 2721755523 Delftia sp. HK171 Isolate Unclassified
358 2738541277 Variovorax sp. GV051 Isolate Unclassified
359 2738541307 Variovorax sp. GV008 Isolate Unclassified
360 2738543013 Variovorax sp. BT01 Isolate Unclassified
361 2738543019 Variovorax sp. GV040 Isolate Unclassified
362 2818991446 Variovorax sp. 1180 Isolate Unclassified
363 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
364 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
365 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
366 2842677519 Variovorax sp. R-72495 Isolate Unclassified
367 2842733646 Variovorax sp. R-72446 Isolate Unclassified
368 2842747753 Variovorax sp. R-72060 Isolate Unclassified
369 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
370 2885198086 Variovorax sp. 679 Isolate Unclassified
371 2885211737 Variovorax sp. 553 Isolate Unclassified
372 2899924645 Variovorax sp. 369 Isolate Unclassified
373 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
374 2904456579 Variovorax sp. 2002 Isolate Unclassified
375 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
376 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
377 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
378 2928037797 Variovorax sp. 1126 Isolate Unclassified
379 2928044640 Variovorax sp. 1128 Isolate Unclassified
380 2928051484 Variovorax sp. 1133 Isolate Unclassified
381 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
382 2928070936 Variovorax gossypii 1167 Isolate Unclassified
383 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
384 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
385 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
386 2929520902 Variovorax beijingensis 502 Isolate Unclassified
387 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
388 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
389 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
390 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
391 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.2
Metatranscriptomes 0.64
Isolates 7.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.09
Nodule 0.8
Rhizoplane 8.12
Rhizosphere 58.92
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100032492 3300005330 Bacteria 3260
2 JGI24740J21852_10010974 3300001979 Bacteria 3463
3 JGI24739J22299_10007760 3300001989 Bacteria 4014
4 JGI25158J39367_1003048 3300002739 Bacteria 2633
5 JGI25152J39213_1006691 3300002773 Bacteria 3082
6 JGI25152J39213_1008722 3300002773 Bacteria 2486
7 JGI25150J39212_1004531 3300002774 Bacteria 3082
8 JGI25150J39212_1010911 3300002774 Bacteria 1669
9 JGI25151J46595_10002088 3300003187 Bacteria 12454
10 JGI25151J46595_10002647 3300003187 Bacteria 10533
11 JGI25151J46595_10017691 3300003187 Bacteria 3082
12 JGI25151J46595_10024221 3300003187 Bacteria 2486
13 JGI25153J46596_10015630 3300003215 Bacteria 3082
14 JGI25153J46596_10020618 3300003215 Bacteria 2486
15 rootH1_10087128 3300003316 Bacteria 4365
16 rootH1_10087128 3300003323 Bacteria 1090
17 rootL2_10042833 3300003322 Bacteria 3328
18 rootH1_10058608 3300003323 Bacteria 1917
19 JGI25160J50197_1006224 3300003354 Bacteria 4855
20 JGI25160J50197_1029031 3300003354 Bacteria 1472
21 JGI25161J50226_1002618 3300003374 Bacteria 4517
22 Ga0006562J51391_1111110 3300003578 Bacteria 4710
23 Ga0006562J51391_1111112 3300003578 Bacteria 4340
24 Ga0006562J51391_1118898 3300003578 Bacteria 4320
25 Ga0055532_1006285 3300003758 Bacteria 1598
26 Ga0055535_1000260 3300003761 Bacteria 55578
27 Ga0055542_1000013 3300003762 Bacteria 387560
28 Ga0055526_1015335 3300003771 Bacteria 3082
29 Ga0055526_1015337 3300003771 Bacteria 3082
30 Ga0055537_1000214 3300003773 Bacteria 42837
31 Ga0055537_1000922 3300003773 Bacteria 13775
32 Ga0055537_1006186 3300003773 Bacteria 3082
33 Ga0055537_1010496 3300003773 Bacteria 1949
34 Ga0055524_1013461 3300003775 Bacteria 3082
35 Ga0055524_1013465 3300003775 Bacteria 3082
36 Ga0055536_1011933 3300003781 Bacteria 3274
37 Ga0055536_1012926 3300003781 Bacteria 3053
38 Ga0055536_1016483 3300003781 Bacteria 2469
39 Ga0055536_1027591 3300003781 Bacteria 1565
40 Ga0055534_1000138 3300003784 Bacteria 54891
41 Ga0055534_1000653 3300003784 Bacteria 17589
42 Ga0055534_1006402 3300003784 Bacteria 2969
43 Ga0055534_1007300 3300003784 Bacteria 2652
44 Ga0055528_1013545 3300003790 Bacteria 3082
45 Ga0055528_1022651 3300003790 Bacteria 1949
46 Ga0055530_10000932 3300003791 Bacteria 23978
47 Ga0055530_10014220 3300003791 Bacteria 2664
48 Ga0055540_1001842 3300003792 Bacteria 11954
49 Ga0055540_1002855 3300003792 Bacteria 8790
50 Ga0055540_1003745 3300003792 Bacteria 7187
51 Ga0055540_1005051 3300003792 Bacteria 5713
52 Ga0055540_1007182 3300003792 Bacteria 4259
53 Ga0055531_10002636 3300003794 Bacteria 11867
54 Ga0055531_10009787 3300003794 Bacteria 4860
55 Ga0055531_10017855 3300003794 Bacteria 2966
56 Ga0055543_1002039 3300004625 Bacteria 7094
57 Ga0065165_1032824 3300005262 Bacteria 1623
58 Ga0065165_1037439 3300005262 Bacteria 1470
59 Ga0070670_100063103 3300005331 Bacteria 3180
60 Ga0070670_100138445 3300005331 Bacteria 2104
61 Ga0070660_100063053 3300005339 Bacteria 2881
62 Ga0070692_10065442 3300005345 Bacteria 1924
63 Ga0070668_100026762 3300005347 Bacteria 4378
64 Ga0070669_100003252 3300005353 Bacteria 11674
65 Ga0070675_100010617 3300005354 Bacteria 7199
66 Ga0070675_100205197 3300005354 Bacteria 1712
67 Ga0070674_100071730 3300005356 Bacteria 2451
68 Ga0070688_100007369 3300005365 Bacteria 5928
69 Ga0070659_100069857 3300005366 Bacteria 2789
70 Ga0070667_100021288 3300005367 Bacteria 5387
71 Ga0070713_100083181 3300005436 Bacteria 2735
72 Ga0070700_100132754 3300005441 Bacteria 1682
73 Ga0070708_100227941 3300005445 Unclassified 1748
74 Ga0070663_100103896 3300005455 Bacteria 2124
75 Ga0070663_100244991 3300005455 Bacteria 1416
76 Ga0070678_100042325 3300005456 Bacteria 3236
77 Ga0070678_100148649 3300005456 Bacteria 1884
78 Ga0070678_100215952 3300005456 Bacteria 1592
79 Ga0070678_100424428 3300005456 Bacteria 1160
80 Ga0070662_100045620 3300005457 Bacteria 3146
81 Ga0070662_100118628 3300005457 Bacteria 2025
82 Ga0068867_100036170 3300005459 Bacteria 3583
83 Ga0068867_100101215 3300005459 Bacteria 2201
84 Ga0070672_100001013 3300005543 Bacteria 17057
85 Ga0070704_100219729 3300005549 Bacteria 1544
86 Ga0068855_100563039 3300005563 Bacteria 1233
87 Ga0070664_100013080 3300005564 Bacteria 6754
88 Ga0068857_100275848 3300005577 Bacteria 1546
89 Ga0068857_100354136 3300005577 Bacteria 1360
90 Ga0068854_100370463 3300005578 Bacteria 1177
91 Ga0068856_100443579 3300005614 Bacteria 1319
92 Ga0068852_100047421 3300005616 Bacteria 3665
93 Ga0068852_100330206 3300005616 Bacteria 1484
94 Ga0068864_100058738 3300005618 Bacteria 3325
95 Ga0068861_100006192 3300005719 Bacteria 8142
96 Ga0068870_10013816 3300005840 Bacteria 3802
97 Ga0068863_100031656 3300005841 Bacteria 5047
98 Ga0068863_100060953 3300005841 Bacteria 3567
99 Ga0068860_100038485 3300005843 Bacteria 4575
100 Ga0068862_100108243 3300005844 Bacteria 2437
101 Ga0081455_10008039 3300005937 Bacteria 11017
102 Ga0081455_10038420 3300005937 Bacteria 4240
103 Ga0081455_10043089 3300005937 Bacteria 3953
104 Ga0081455_10077142 3300005937 Bacteria 2742
105 Ga0081538_10015393 3300005981 Bacteria 5922
106 Ga0081540_1019915 3300005983 Bacteria 4055
107 Ga0075368_10008448 3300006042 Bacteria 3669
108 Ga0075363_100085459 3300006048 Bacteria 1731
109 Ga0075363_100105819 3300006048 Bacteria 1560
110 Ga0075364_10041689 3300006051 Bacteria 2981
111 Ga0075432_10049997 3300006058 Bacteria 1474
112 Ga0075362_10000355 3300006177 Bacteria 13170
113 Ga0075367_10113717 3300006178 Bacteria 1663
114 Ga0075367_10157237 3300006178 Bacteria 1413
115 Ga0075369_10064295 3300006186 Bacteria 1606
116 Ga0097621_100190376 3300006237 Bacteria 1777
117 Ga0097621_100454893 3300006237 Bacteria 1154
118 Ga0075370_10004717 3300006353 Bacteria 6661
119 Ga0075370_10014006 3300006353 Bacteria 4270
120 Ga0075370_10097980 3300006353 Bacteria 1695
121 Ga0075428_100160641 3300006844 Bacteria 2439
122 Ga0075428_100247567 3300006844 Bacteria 1921
123 Ga0075428_100442299 3300006844 Bacteria 1392
124 Ga0075430_100056622 3300006846 Bacteria 3297
125 Ga0075430_100103444 3300006846 Bacteria 2377
126 Ga0075430_100191705 3300006846 Bacteria 1699
127 Ga0075431_100151169 3300006847 Bacteria 2390
128 Ga0075431_100187742 3300006847 Bacteria 2119
129 Ga0075433_10025352 3300006852 Bacteria 5011
130 Ga0075433_10143059 3300006852 Bacteria 2126
131 Ga0075434_100039061 3300006871 Bacteria 4703
132 Ga0075434_100245859 3300006871 Bacteria 1809
133 Ga0079104_1000098 3300006946 Bacteria 129064
134 Ga0099826_10006310 3300006948 Bacteria 8624
135 Ga0075435_100228498 3300007076 Bacteria 1581
136 Ga0099795_10008109 3300007788 Bacteria 2976
137 Ga0105244_10006597 3300009036 Bacteria 7480
138 Ga0105244_10020803 3300009036 Bacteria 3638
139 Ga0105250_10004309 3300009092 Bacteria 6569
140 Ga0111539_10035303 3300009094 Bacteria 6054
141 Ga0111539_10088305 3300009094 Bacteria 3642
142 Ga0111539_10292170 3300009094 Bacteria 1897
143 Ga0111539_10545157 3300009094 Bacteria 1351
144 Ga0105245_10174310 3300009098 Bacteria 2050
145 Ga0114129_10003347 3300009147 Bacteria 22518
146 Ga0114129_10194916 3300009147 Bacteria 2748
147 Ga0114129_10234637 3300009147 Bacteria 2469
148 Ga0114129_10487096 3300009147 Bacteria 1613
149 Ga0105243_10001568 3300009148 Bacteria 19974
150 Ga0105243_10001785 3300009148 Bacteria 18468
151 Ga0105243_10004514 3300009148 Bacteria 11003
152 Ga0105243_10060785 3300009148 Bacteria 3019
153 Ga0105243_10149623 3300009148 Bacteria 2001
154 Ga0105243_10423655 3300009148 Bacteria 1242
155 Ga0105242_10000434 3300009176 Bacteria 33374
156 Ga0105242_10159384 3300009176 Bacteria 1974
157 Ga0105248_10013097 3300009177 Bacteria 9132
158 Ga0105248_10107485 3300009177 Bacteria 3146
159 Ga0105237_10144063 3300009545 Bacteria 2377
160 Ga0105237_10289737 3300009545 Bacteria 1640
161 Ga0105238_10021551 3300009551 Bacteria 6563
162 Ga0105238_10034332 3300009551 Bacteria 5161
163 Ga0105238_10307745 3300009551 Bacteria 1569
164 Ga0105249_10461480 3300009553 Bacteria 1310
165 Ga0099796_10003648 3300010159 Bacteria 3607
166 Ga0105239_10345840 3300010375 Bacteria 1679
167 Ga0157373_10077034 3300013100 Bacteria 2352
168 Ga0157373_10112974 3300013100 Bacteria 1909
169 Ga0157370_10007331 3300013104 Bacteria 12037
170 Ga0157369_10004674 3300013105 Bacteria 16095
171 Ga0157374_10024400 3300013296 Bacteria 5422
172 Ga0163162_10044954 3300013306 Bacteria 4424
173 Ga0163162_10285196 3300013306 Bacteria 1783
174 Ga0157372_10089385 3300013307 Bacteria 3499
175 Ga0157375_10041222 3300013308 Bacteria 4456
176 Ga0157375_10095185 3300013308 Bacteria 3048
177 Ga0157380_10125123 3300014326 Bacteria 2184
178 Ga0182008_10000351 3300014497 Bacteria 35865
179 Ga0182008_10004684 3300014497 Bacteria 7943
180 Ga0182008_10061167 3300014497 Bacteria 1856
181 Ga0182008_10069596 3300014497 Bacteria 1731
182 Ga0157376_10009865 3300014969 Bacteria 6962
183 Ga0157376_10227236 3300014969 Bacteria 1732
184 Ga0182006_1004047 3300015261 Bacteria 7312
185 Ga0182007_10000359 3300015262 Bacteria 28779
186 Ga0182007_10002075 3300015262 Bacteria 10297
187 Ga0183362_10004 3300015683 Bacteria 569303
188 Ga0163161_10000792 3300017792 Bacteria 24778
189 Ga0163161_10020473 3300017792 Bacteria 4641
190 Ga0163161_10082843 3300017792 Bacteria 2364
191 Ga0224572_1000950 3300024225 Bacteria 3972
192 Ga0209436_102105 3300025208 Bacteria 6241
193 Ga0209672_104858 3300025228 Bacteria 2409
194 Ga0209147_100771 3300025229 Bacteria 15623
195 Ga0209258_100020 3300025242 Bacteria 565241
196 Ga0207425_1000286 3300025245 Bacteria 36973
197 Ga0207425_1004280 3300025245 Bacteria 4331
198 Ga0209148_1000031 3300025254 Bacteria 564601
199 Ga0209129_1000406 3300025258 Bacteria 33954
200 Ga0209129_1004202 3300025258 Bacteria 5776
201 Ga0209565_1000078 3300025263 Bacteria 160838
202 Ga0209565_1000181 3300025263 Bacteria 77793
203 Ga0209565_1002569 3300025263 Bacteria 6449
204 Ga0209673_1000442 3300025273 Bacteria 71413
205 Ga0209673_1001199 3300025273 Bacteria 27809
206 Ga0209673_1001899 3300025273 Bacteria 16769
207 Ga0209130_1000443 3300025284 Bacteria 43777
208 Ga0209130_1000673 3300025284 Bacteria 30982
209 Ga0209130_1010607 3300025284 Bacteria 2523
210 Ga0209675_1000055 3300025291 Bacteria 193129
211 Ga0209675_1000339 3300025291 Bacteria 40950
212 Ga0209675_1001290 3300025291 Bacteria 14889
213 Ga0209676_1000040 3300025292 Bacteria 438184
214 Ga0209676_1000312 3300025292 Bacteria 95234
215 Ga0209676_1000403 3300025292 Bacteria 78171
216 Ga0209676_1009376 3300025292 Bacteria 4228
217 Ga0209025_1000242 3300025294 Bacteria 128169
218 Ga0209025_1000512 3300025294 Bacteria 74071
219 Ga0209025_1001359 3300025294 Bacteria 32831
220 Ga0209025_1002674 3300025294 Bacteria 18190
221 Ga0209025_1018366 3300025294 Bacteria 3969
222 Ga0209025_1046830 3300025294 Bacteria 1773
223 Ga0209564_1000157 3300025295 Bacteria 164758
224 Ga0209564_1000806 3300025295 Bacteria 42875
225 Ga0209758_1000042 3300025297 Bacteria 407145
226 Ga0209758_1008849 3300025297 Bacteria 6405
227 Ga0209050_1000021 3300025298 Bacteria 574406
228 Ga0209050_1001095 3300025298 Bacteria 32903
229 Ga0209050_1023436 3300025298 Bacteria 2172
230 Ga0209256_1000056 3300025299 Bacteria 283044
231 Ga0209256_1000124 3300025299 Bacteria 165390
232 Ga0207426_1000055 3300025302 Bacteria 374450
233 Ga0207426_1000079 3300025302 Bacteria 314709
234 Ga0209051_1000111 3300025303 Bacteria 153024
235 Ga0209051_1000423 3300025303 Bacteria 58174
236 Ga0209051_1000436 3300025303 Bacteria 56547
237 Ga0209051_1001224 3300025303 Bacteria 23078
238 Ga0209051_1014394 3300025303 Bacteria 3695
239 Ga0209051_1020877 3300025303 Bacteria 2805
240 Ga0209257_1000043 3300025304 Bacteria 512127
241 Ga0209257_1000215 3300025304 Bacteria 136521
242 Ga0209257_1005662 3300025304 Bacteria 8625
243 Ga0209257_1010491 3300025304 Bacteria 4675
244 Ga0209257_1015852 3300025304 Bacteria 3095
245 Ga0207656_10042880 3300025321 Bacteria 1927
246 Ga0207655_1002888 3300025728 Bacteria 13260
247 Ga0207682_10034068 3300025893 Bacteria 2052
248 Ga0207688_10003647 3300025901 Bacteria 8410
249 Ga0207645_10004754 3300025907 Bacteria 9988
250 Ga0207643_10003457 3300025908 Bacteria 8500
251 Ga0207684_10147058 3300025910 Bacteria 2027
252 Ga0207671_10188697 3300025914 Bacteria 1607
253 Ga0207663_10103376 3300025916 Bacteria 1918
254 Ga0207657_10079073 3300025919 Bacteria 2767
255 Ga0207657_10118615 3300025919 Bacteria 2178
256 Ga0207649_10161734 3300025920 Bacteria 1552
257 Ga0207681_10005798 3300025923 Bacteria 7579
258 Ga0207681_10107343 3300025923 Bacteria 2025
259 Ga0207681_10168195 3300025923 Bacteria 1659
260 Ga0207694_10020226 3300025924 Bacteria 5033
261 Ga0207694_10138182 3300025924 Bacteria 1958
262 Ga0207694_10283684 3300025924 Bacteria 1361
263 Ga0207650_10006667 3300025925 Bacteria 7878
264 Ga0207659_10006407 3300025926 Bacteria 7209
265 Ga0207659_10135677 3300025926 Bacteria 1904
266 Ga0207659_10388079 3300025926 Bacteria 1166
267 Ga0207690_10086805 3300025932 Bacteria 2200
268 Ga0207706_10024496 3300025933 Bacteria 5410
269 Ga0207706_10038781 3300025933 Bacteria 4225
270 Ga0207706_10073502 3300025933 Bacteria 3006
271 Ga0207686_10009208 3300025934 Bacteria 5355
272 Ga0207709_10000105 3300025935 Bacteria 130495
273 Ga0207709_10000394 3300025935 Bacteria 43194
274 Ga0207709_10002808 3300025935 Bacteria 10713
275 Ga0207709_10129724 3300025935 Bacteria 1716
276 Ga0207709_10203108 3300025935 Bacteria 1417
277 Ga0207670_10009663 3300025936 Bacteria 5515
278 Ga0207669_10063099 3300025937 Bacteria 2285
279 Ga0207669_10119543 3300025937 Bacteria 1785
280 Ga0207691_10001290 3300025940 Bacteria 24994
281 Ga0207691_10008342 3300025940 Bacteria 9950
282 Ga0207691_10201606 3300025940 Bacteria 1731
283 Ga0207711_10044962 3300025941 Bacteria 3772
284 Ga0207679_10025876 3300025945 Bacteria 4041
285 Ga0207667_10293247 3300025949 Bacteria 1662
286 Ga0207651_10284856 3300025960 Bacteria 1367
287 Ga0207712_10046451 3300025961 Bacteria 3011
288 Ga0207668_10145990 3300025972 Bacteria 1825
289 Ga0207640_10034736 3300025981 Bacteria 3149
290 Ga0207658_10018173 3300025986 Bacteria 4851
291 Ga0207658_10183400 3300025986 Bacteria 1734
292 Ga0207677_10021070 3300026023 Bacteria 3975
293 Ga0207639_10110252 3300026041 Bacteria 2241
294 Ga0207678_10014911 3300026067 Bacteria 6836
295 Ga0207678_10162662 3300026067 Bacteria 1906
296 Ga0207648_10006692 3300026089 Bacteria 11433
297 Ga0207648_10021402 3300026089 Bacteria 5813
298 Ga0207648_10369795 3300026089 Bacteria 1295
299 Ga0207648_10383264 3300026089 Bacteria 1271
300 Ga0207676_10037972 3300026095 Bacteria 3674
301 Ga0207674_10167834 3300026116 Bacteria 2148
302 Ga0207675_100012115 3300026118 Bacteria 8057
303 Ga0207683_10053075 3300026121 Bacteria 3553
304 Ga0207683_10074315 3300026121 Bacteria 3007
305 Ga0207683_10077652 3300026121 Bacteria 2941
306 Ga0207683_10262722 3300026121 Bacteria 1576
307 Ga0207698_10126388 3300026142 Bacteria 2175
308 Ga0207698_10153975 3300026142 Bacteria 2000
309 Ga0209281_1000002 3300027111 Bacteria 1924012
310 Ga0209282_1004597 3300027666 Bacteria 8342
311 Ga0209971_1002369 3300027682 Bacteria 4549
312 Ga0209966_1001059 3300027695 Bacteria 5061
313 Ga0207428_10141697 3300027907 Bacteria 1834
314 Ga0268266_10096354 3300028379 Bacteria 2600
315 Ga0268266_10164413 3300028379 Bacteria 2009
316 Ga0268265_10250209 3300028380 Bacteria 1569
317 Ga0268264_10041770 3300028381 Bacteria 3794
318 Ga0307515_10000322 3300028794 Bacteria 118563
319 Ga0307515_10000954 3300028794 Bacteria 66117
320 Ga0307515_10083140 3300028794 Bacteria 4130
321 Ga0265338_10006490 3300028800 Bacteria 14880
322 Ga0307512_10124144 3300030522 Bacteria 1646
323 Ga0316177_1065008 3300030731 Bacteria 1765
324 Ga0316183_1143356 3300030742 Bacteria 2724
325 Ga0316181_1084630 3300030744 Bacteria 2970
326 Ga0316182_1287196 3300030745 Bacteria 4181
327 Ga0265760_10012964 3300031090 Bacteria 2387
328 Ga0265325_10009456 3300031241 Bacteria 5687
329 Ga0265339_10005892 3300031249 Bacteria 8118
330 Ga0265327_10007110 3300031251 Bacteria 8739
331 Ga0307513_10023920 3300031456 Bacteria 7121
332 Ga0307513_10106246 3300031456 Bacteria 2814
333 Ga0307513_10194153 3300031456 Bacteria 1878
334 Ga0307513_10321564 3300031456 Bacteria 1305
335 Ga0307408_100007148 3300031548 Bacteria 7391
336 Ga0307408_100123890 3300031548 Bacteria 2006
337 Ga0307408_100303861 3300031548 Bacteria 1337
338 Ga0307514_10001349 3300031649 Bacteria 31116
339 Ga0307514_10009045 3300031649 Bacteria 8413
340 Ga0307405_10004135 3300031731 Bacteria 6821
341 Ga0307405_10007767 3300031731 Bacteria 5394
342 Ga0307413_10233170 3300031824 Bacteria 1353
343 Ga0307406_10000240 3300031901 Bacteria 33234
344 Ga0307412_10014399 3300031911 Bacteria 4663
345 Ga0307412_10064418 3300031911 Bacteria 2476
346 Ga0307412_10156496 3300031911 Bacteria 1687
347 Ga0307412_10236446 3300031911 Bacteria 1410
348 Ga0307409_100402640 3300031995 Bacteria 1308
349 Ga0307416_100008554 3300032002 Bacteria 6615
350 Ga0307414_10047810 3300032004 Bacteria 2947
351 Ga0307414_10161986 3300032004 Bacteria 1778
352 Ga0373929_0019309 3300035085 Bacteria 1364
353 Ga0373940_0020147 3300035088 Bacteria 1692
354 Ga0373939_0013398 3300035114 Bacteria 2109
355 Ga0373941_0007760 3300035115 Bacteria 2639
356 Ga0373960_0057419 3300035121 Bacteria 1172
357 Ga0373943_0080368 3300035170 Bacteria 1670
358 Ga0373946_0012981 3300035171 Bacteria 3124
359 Ga0373931_0043899 3300035691 Bacteria 2356
360 Ga0373927_0037475 3300035695 Bacteria 3151
361 Ga0373927_0132535 3300035695 Bacteria 1628
362 Ga0373947_0010864 3300035725 Bacteria 5224
363 Ga0373947_0101725 3300035725 Bacteria 1807
364 Ga0373925_0070373 3300037068 Bacteria 2644
365 Ga0395905_0164044 3300037471 Bacteria 2088
366 Ga0395901_0108388 3300038443 Bacteria 2916
367 Ga0395901_0436092 3300038443 Bacteria 1342
368 Ga0436365_1040453 3300039437 Bacteria 1795
369 Ga0436360_0836411 3300039438 Bacteria 1927
370 Ga0436361_0013452 3300039447 Bacteria 8627
371 Ga0436363_0349250 3300039450 Bacteria 951
372 Ga0439436_0001899 3300041404 Bacteria 6176
373 Ga0439439_0017595 3300041406 Bacteria 1759
374 Ga0439439_0020150 3300041406 Bacteria 1657
375 Ga0439447_023734 3300041407 Bacteria 1595
376 Ga0439447_024497 3300041407 Bacteria 1562
377 Ga0439466_0035467 3300041411 Bacteria 1687
378 Ga0439466_0048579 3300041411 Bacteria 1395
379 Ga0439465_0003830 3300041413 Bacteria 4909
380 Ga0451789_0376263 3300041443 Bacteria 1402
381 Ga0439431_0001450 3300041997 Bacteria 5240
382 Ga0439433_0006783 3300041999 Bacteria 2467
383 Ga0439441_017022 3300042001 Bacteria 1301
384 Ga0439445_0004265 3300042004 Bacteria 3234
385 Ga0439432_004915 3300042006 Bacteria 4842
386 Ga0439432_018327 3300042006 Bacteria 2340
387 Ga0439449_0003299 3300042007 Bacteria 6295
388 Ga0439452_005337 3300042010 Bacteria 4144
389 Ga0439452_015735 3300042010 Bacteria 2068
390 Ga0439456_006315 3300042013 Bacteria 2419
391 Ga0439457_032282 3300042014 Bacteria 1162
392 Ga0439462_0001218 3300042015 Bacteria 5633
393 Ga0450911_000250 3300042115 Bacteria 20305
394 Ga0450920_012533 3300042122 Bacteria 1591
395 Ga0450890_005516 3300042127 Bacteria 1625
396 Ga0450894_006219 3300042131 Bacteria 1541
397 Ga0450896_007638 3300042133 Bacteria 1491
398 Ga0450899_001665 3300042135 Bacteria 2455
399 Ga0450906_007149 3300042145 Bacteria 2215
400 Ga0450909_011477 3300042185 Bacteria 1298
401 Ga0439434_0004378 3300042435 Bacteria 4129
402 Ga0439460_0006153 3300042461 Bacteria 2966
403 Ga0450918_000332 3300042531 Bacteria 10578
404 Ga0466959_0003224 3300045049 Bacteria 10612
405 Ga0495627_011437 3300046453 Bacteria 3184
406 Ga0495603_0051680 3300046455 Bacteria 2441
407 Ga0495629_0165262 3300046459 Bacteria 1537
408 Ga0495638_0045892 3300046460 Bacteria 2747
409 Ga0495641_0085430 3300046461 Bacteria 1412
410 Ga0495582_0018349 3300046473 Bacteria 3827
411 Ga0495639_0031305 3300046475 Bacteria 2367
412 Ga0495639_0033235 3300046475 Bacteria 2303
413 Ga0495584_0011597 3300046491 Bacteria 4515
414 Ga0495584_0020711 3300046491 Bacteria 3340
415 Ga0495584_0083135 3300046491 Bacteria 1612
416 Ga0495585_0012816 3300046492 Bacteria 4931
417 Ga0495610_0069783 3300046512 Bacteria 1643
418 Ga0495616_0009256 3300046513 Bacteria 5775
419 Ga0495637_0005904 3300046520 Bacteria 6189
420 Ga0495637_0055519 3300046520 Bacteria 1642
421 Ga0495644_0015263 3300046523 Bacteria 2942
422 Ga0495663_0029035 3300046525 Bacteria 1631
423 Ga0495642_0040501 3300046528 Bacteria 1892
424 Ga0495652_0419974 3300046529 Bacteria 943
425 Ga0495598_0010278 3300046537 Bacteria 2238
426 Ga0495621_0009192 3300046539 Bacteria 2992
427 Ga0495597_0001190 3300046542 Bacteria 19496
428 Ga0495633_0129052 3300046558 Bacteria 1170
429 Ga0495656_0000344 3300046615 Bacteria 15772
430 Ga0495656_0013050 3300046615 Bacteria 3081
431 Ga0495656_0030457 3300046615 Bacteria 2181
432 Ga0495668_0100782 3300046616 Bacteria 1580
433 Ga0495634_0151625 3300046642 Bacteria 1466
434 Ga0495634_0156860 3300046642 Bacteria 1437
435 Ga0495625_0000206 3300046660 Bacteria 94070
436 Ga0495659_0045060 3300046664 Bacteria 1588
437 Ga0495661_0125045 3300046665 Bacteria 1416
438 Ga0495588_0035082 3300046674 Bacteria 2540
439 Ga0495588_0124429 3300046674 Bacteria 1359
440 Ga0495658_0035153 3300046683 Bacteria 2755
441 Ga0495658_0312973 3300046683 Bacteria 994
442 Ga0495669_0032358 3300046684 Bacteria 2299
443 Ga0495613_0270568 3300046689 Bacteria 1182
444 Ga0495624_0083324 3300046690 Bacteria 1978
445 Ga0495670_0159545 3300046691 Bacteria 1184
446 Ga0495671_0001944 3300046692 Bacteria 13254
447 Ga0495671_0066358 3300046692 Bacteria 1776
448 Ga0495660_0033900 3300046810 Bacteria 2860
449 Ga0495674_0183994 3300047319 Bacteria 1739
450 Ga0495676_0047509 3300047321 Bacteria 3469
451 Ga0495676_0069039 3300047321 Bacteria 2728
452 Ga0495676_0159986 3300047321 Bacteria 1594
453 Ga0495680_0187038 3300047322 Bacteria 1492
454 Ga0495684_0087515 3300047471 Bacteria 2361
455 Ga0495593_0091680 3300047673 Bacteria 1564
456 Ga0495614_0030177 3300048089 Bacteria 2333
457 Ga0495615_0012407 3300048090 Bacteria 1755
458 Ga0496101_0001978 3300048904 Bacteria 12427
459 Ga0496101_0120815 3300048904 Bacteria 1980
460 Ga0496101_0429878 3300048904 Bacteria 1041
461 Ga0496102_0002447 3300048905 Bacteria 15843
462 Ga0496102_0013607 3300048905 Bacteria 7051
463 Ga0496103_0064391 3300048906 Bacteria 2285
464 Ga0496104_0005792 3300048907 Bacteria 10817
465 Ga0496104_0045277 3300048907 Bacteria 4137
466 Ga0496104_0052112 3300048907 Bacteria 3864
467 Ga0496104_0107478 3300048907 Bacteria 2673
468 Ga0496105_0005298 3300048908 Bacteria 9775
469 Ga0496105_0015407 3300048908 Bacteria 6093
470 Ga0496105_0028492 3300048908 Bacteria 4566
471 Ga0496105_0032958 3300048908 Bacteria 4253
472 Ga0496105_0036312 3300048908 Bacteria 4059
473 Ga0496105_0400773 3300048908 Bacteria 1089
474 Ga0496106_0032099 3300048909 Bacteria 3914
475 Ga0496106_0101887 3300048909 Bacteria 2227
476 Ga0496106_0108150 3300048909 Bacteria 2163
477 Ga0496106_0429830 3300048909 Bacteria 1061
478 Ga0496107_0040911 3300048910 Bacteria 3328
479 Ga0496107_0068411 3300048910 Bacteria 2577
480 Ga0496107_0179468 3300048910 Bacteria 1572
481 Ga0496107_0232663 3300048910 Bacteria 1371
482 Ga0496108_0091454 3300048911 Bacteria 2586
483 Ga0496108_0113446 3300048911 Bacteria 2319
484 Ga0496109_0015484 3300048912 Bacteria 6647
485 Ga0496109_0058953 3300048912 Bacteria 3507
486 Ga0496109_0110157 3300048912 Bacteria 2560
487 Ga0496109_0287588 3300048912 Bacteria 1549
488 Ga0496109_0331533 3300048912 Bacteria 1437
489 Ga0496110_0003026 3300048913 Bacteria 12758
490 Ga0496110_0036920 3300048913 Bacteria 4245
491 Ga0496110_0064825 3300048913 Bacteria 3229
492 Ga0496110_0185131 3300048913 Bacteria 1891
493 Ga0496110_0277813 3300048913 Bacteria 1525
494 Ga0496111_0016540 3300048914 Bacteria 5084
495 Ga0496111_0153350 3300048914 Bacteria 1709
496 Ga0496111_0343276 3300048914 Bacteria 1105
497 Ga0496112_0001894 3300048915 Bacteria 16508
498 Ga0496112_0198259 3300048915 Bacteria 1967
499 Ga0496113_0000652 3300048916 Bacteria 17514
500 Ga0496113_0175803 3300048916 Bacteria 1696
501 Ga0496113_0366532 3300048916 Bacteria 1156
502 Ga0496114_0196897 3300048917 Bacteria 1764
503 Ga0496115_0032491 3300048918 Bacteria 4116
504 Ga0496115_0109331 3300048918 Bacteria 2270
505 Ga0496116_0016524 3300048919 Bacteria 5769
506 Ga0496117_0052193 3300048920 Bacteria 2882
507 Ga0496117_0088684 3300048920 Bacteria 2000
508 Ga0496118_0018486 3300048921 Bacteria 6287
509 Ga0496118_0056908 3300048921 Bacteria 2935
510 Ga0496122_0001442 3300048925 Bacteria 38469
511 Ga0496123_0000124 3300048926 Bacteria 158327
512 Ga0496123_0140866 3300048926 Bacteria 1319
513 Ga0496125_0010895 3300048928 Bacteria 9143
514 Ga0496125_0033174 3300048928 Bacteria 4574
515 Ga0496125_0061551 3300048928 Bacteria 3009
516 Ga0496125_0163176 3300048928 Bacteria 1510
517 Ga0496126_0274493 3300048929 Bacteria 1398
518 Ga0496126_0275547 3300048929 Bacteria 1395
519 Ga0501034_0199547 3300049571 Bacteria 1959
520 Ga0501068_0050028 3300049584 Bacteria 2526
521 Ga0501070_0133089 3300049586 Bacteria 2053
522 Ga0501074_0138933 3300049590 Bacteria 1738
523 Ga0501249_007158 3300049679 Bacteria 2302
524 Ga0501080_0184204 3300049742 Bacteria 1920
525 Ga0501262_000470 3300049759 Bacteria 4809
526 Ga0501035_0406530 3300049822 Bacteria 1132
527 nmdc:mga03683_19251_c1 3300050489 Bacteria 2604
528 nmdc:mga03683_26429_c1 3300050489 Bacteria 2290
529 nmdc:mga03n38_18233_c2 3300050490 Bacteria 1976
530 nmdc:mga0yw44_180577_c1 3300050492 Bacteria 1389
531 nmdc:mga0yw44_27198_c1 3300050492 Bacteria 3274
532 nmdc:mga0k408_36428_c1 3300050493 Bacteria 2824
533 nmdc:mga0k408_8429_c1 3300050493 Bacteria 5532
534 nmdc:mga04h51_49513_c1 3300050495 Bacteria 1404
535 nmdc:mga07m45_109935_c1 3300050496 Bacteria 1587
536 nmdc:mga07m45_11742_c1 3300050496 Bacteria 4609
537 nmdc:mga07m45_13759_c1 3300050496 Bacteria 4297
538 nmdc:mga07m45_482_c1 3300050496 Bacteria 16838
539 nmdc:mga07m45_93292_c1 3300050496 Bacteria 1726
540 nmdc:mga05p37_173614_c1 3300050507 Bacteria 2627
541 nmdc:mga05p37_186928_c1 3300050507 Bacteria 2518
542 nmdc:mga05p37_304485_c1 3300050507 Bacteria 1892
543 nmdc:mga05p37_4262_c1 3300050507 Bacteria 16709
544 nmdc:mga09592_239042_c1 3300050508 Bacteria 1574
545 nmdc:mga09592_446236_c1 3300050508 Bacteria 1116
546 nmdc:mga0qj67_12428_c1 3300050509 Bacteria 6414
547 nmdc:mga0qj67_30661_c1 3300050509 Bacteria 4187
548 nmdc:mga0qj67_85452_c1 3300050509 Bacteria 2530
549 nmdc:mga06r32_150915_c1 3300050510 Bacteria 2302
550 nmdc:mga06r32_158840_c1 3300050510 Bacteria 2243
551 nmdc:mga06r32_395822_c1 3300050510 Unclassified 1364
552 nmdc:mga08y16_106665_c1 3300050511 Bacteria 2916
553 nmdc:mga08y16_236262_c1 3300050511 Bacteria 1890
554 nmdc:mga08y16_246902_c1 3300050511 Bacteria 1844
555 nmdc:mga0n895_52125_c1 3300050512 Bacteria 4015
556 nmdc:mga0n895_6291_c1 3300050512 Bacteria 10065
557 nmdc:mga0rr50_211151_c1 3300050513 Bacteria 1599
558 nmdc:mga0a205_19348_c2 3300050515 Bacteria 5383
559 nmdc:mga0a205_475039_c1 3300050515 Bacteria 1109
560 Ga0495601_0018426 3300053077 Bacteria 4250
561 Ga0495601_0036655 3300053077 Bacteria 3064
562 Ga0500610_0021663 3300053079 Bacteria 3158
563 Ga0500610_0029879 3300053079 Bacteria 2756
564 Ga0495655_0038917 3300053083 Bacteria 1202
565 Ga0495619_0035199 3300053085 Bacteria 3257
566 Ga0495619_0045609 3300053085 Bacteria 2880
567 Ga0500644_0011501 3300053088 Bacteria 2420
568 Ga0500651_0000467 3300053093 Bacteria 21391
569 Ga0500571_000307 3300053110 Bacteria 19171
570 Ga0500594_0012192 3300053118 Bacteria 2021
571 Ga0500607_001064 3300053121 Bacteria 25861
572 Ga0500658_0002234 3300053134 Bacteria 7509
573 Ga0500559_0004856 3300053136 Bacteria 6273
574 Ga0500559_0067515 3300053136 Bacteria 1605
575 Ga0500568_0000624 3300053139 Bacteria 25510
576 Ga0500573_0105715 3300053140 Bacteria 1580
577 Ga0500574_000734 3300053141 Bacteria 4352
578 Ga0500586_009287 3300053145 Bacteria 2722
579 Ga0500622_0000943 3300053156 Bacteria 24724
580 Ga0500627_0000293 3300053158 Bacteria 13978
581 Ga0500634_0034760 3300053161 Bacteria 2746
582 Ga0500634_0041197 3300053161 Bacteria 2508
583 Ga0500636_0096074 3300053177 Bacteria 1691
584 Ga0501084_0151820 3300054114 Bacteria 1953
585 2513228408 2513020051 Bacteria 6053213
586 2599622479 2599185214 Bacteria 8209958
587 2599674429 2599185226 Bacteria 8233575
588 2599680114 2599185227 Bacteria 8246414
589 2599692130 2599185229 Bacteria 8216126
590 2643992008 2643221596 Bacteria 5006805
591 2644160821 2643221628 Bacteria 5745828
592 2644326585 2643221658 Bacteria 6064537
593 2644396934 2643221672 Bacteria 6322190
594 2644469390 2643221683 Bacteria 5749203
595 2722884865 2721755523 Bacteria 6430384
596 2738719271 2738541277 Bacteria 7458140
597 2738883382 2738541307 Bacteria 8606193
598 2739247404 2738543013 Bacteria 5618633
599 2739282998 2738543019 Bacteria 7459457
600 2819599180 2818991446 Bacteria 7757362
601 2831270960 2831265667 Bacteria 7184833
602 2838059008 2838054893 Bacteria 7451788
603 2839138555 2839138175 Bacteria 6549354
604 2842679319 2842677519 Bacteria 5615038
605 2842738312 2842733646 Bacteria 5716726
606 2842750691 2842747753 Bacteria 5578255
607 2885194686 2885192300 Bacteria 5882526
608 2885202221 2885198086 Bacteria 7212419
609 2885215874 2885211737 Bacteria 7212420
610 2899930003 2899924645 Bacteria 7487985
611 2904451588 2904449895 Bacteria 6927402
612 2904461923 2904456579 Bacteria 6819253
613 2904482980 2904479285 Bacteria 5073931
614 2904543249 2904541872 Bacteria 8915136
615 2919464453 2919462493 Bacteria 5817112
616 2928043539 2928037797 Bacteria 7273642
617 2928049831 2928044640 Bacteria 7271509
618 2928054406 2928051484 Bacteria 7773759
619 2928069992 2928064002 Bacteria 7419480
620 2928074388 2928070936 Bacteria 8062541
621 2928086623 2928084124 Bacteria 7159212
622 2928116759 2928115317 Bacteria 6477646
623 2929160483 2929160207 Bacteria 9075316
624 2929526506 2929520902 Bacteria 6765052
625 2945915482 2945909444 Bacteria 7065066
626 2945950488 2945945610 Bacteria 5951079
627 2945974868 2945972063 Bacteria 6086495
628 2945989118 2945984333 Bacteria 7358892
629 2954770073 2954767861 Bacteria 5535784
630 Ga0070690_100032492
631 JGI24740J21852_10010974
632 JGI24739J22299_10007760
633 JGI25158J39367_1003048
634 JGI25152J39213_1006691
635 JGI25152J39213_1008722
636 JGI25150J39212_1004531
637 JGI25150J39212_1010911
638 JGI25151J46595_10002088
639 JGI25151J46595_10002647
640 JGI25151J46595_10017691
641 JGI25151J46595_10024221
642 JGI25153J46596_10015630
643 JGI25153J46596_10020618
644 rootH1_10087128
645 rootL2_10042833
646 rootH1_10058608
647 JGI25160J50197_1006224
648 JGI25160J50197_1029031
649 JGI25161J50226_1002618
650 Ga0006562J51391_1111110
651 Ga0006562J51391_1111112
652 Ga0006562J51391_1118898
653 Ga0055532_1006285
654 Ga0055535_1000260
655 Ga0055542_1000013
656 Ga0055526_1015335
657 Ga0055526_1015337
658 Ga0055537_1000214
659 Ga0055537_1000922
660 Ga0055537_1006186
661 Ga0055537_1010496
662 Ga0055524_1013461
663 Ga0055524_1013465
664 Ga0055536_1011933
665 Ga0055536_1012926
666 Ga0055536_1016483
667 Ga0055536_1027591
668 Ga0055534_1000138
669 Ga0055534_1000653
670 Ga0055534_1006402
671 Ga0055534_1007300
672 Ga0055528_1013545
673 Ga0055528_1022651
674 Ga0055530_10000932
675 Ga0055530_10014220
676 Ga0055540_1001842
677 Ga0055540_1002855
678 Ga0055540_1003745
679 Ga0055540_1005051
680 Ga0055540_1007182
681 Ga0055531_10002636
682 Ga0055531_10009787
683 Ga0055531_10017855
684 Ga0055543_1002039
685 Ga0065165_1032824
686 Ga0065165_1037439
687 Ga0070670_100063103
688 Ga0070670_100138445
689 Ga0070660_100063053
690 Ga0070692_10065442
691 Ga0070668_100026762
692 Ga0070669_100003252
693 Ga0070675_100010617
694 Ga0070675_100205197
695 Ga0070674_100071730
696 Ga0070688_100007369
697 Ga0070659_100069857
698 Ga0070667_100021288
699 Ga0070713_100083181
700 Ga0070700_100132754
701 Ga0070708_100227941
702 Ga0070663_100103896
703 Ga0070663_100244991
704 Ga0070678_100042325
705 Ga0070678_100148649
706 Ga0070678_100215952
707 Ga0070678_100424428
708 Ga0070662_100045620
709 Ga0070662_100118628
710 Ga0068867_100036170
711 Ga0068867_100101215
712 Ga0070672_100001013
713 Ga0070704_100219729
714 Ga0068855_100563039
715 Ga0070664_100013080
716 Ga0068857_100275848
717 Ga0068857_100354136
718 Ga0068854_100370463
719 Ga0068856_100443579
720 Ga0068852_100047421
721 Ga0068852_100330206
722 Ga0068864_100058738
723 Ga0068861_100006192
724 Ga0068870_10013816
725 Ga0068863_100031656
726 Ga0068863_100060953
727 Ga0068860_100038485
728 Ga0068862_100108243
729 Ga0081455_10008039
730 Ga0081455_10038420
731 Ga0081455_10043089
732 Ga0081455_10077142
733 Ga0081538_10015393
734 Ga0081540_1019915
735 Ga0075368_10008448
736 Ga0075363_100085459
737 Ga0075363_100105819
738 Ga0075364_10041689
739 Ga0075432_10049997
740 Ga0075362_10000355
741 Ga0075367_10113717
742 Ga0075367_10157237
743 Ga0075369_10064295
744 Ga0097621_100190376
745 Ga0097621_100454893
746 Ga0075370_10004717
747 Ga0075370_10014006
748 Ga0075370_10097980
749 Ga0075428_100160641
750 Ga0075428_100247567
751 Ga0075428_100442299
752 Ga0075430_100056622
753 Ga0075430_100103444
754 Ga0075430_100191705
755 Ga0075431_100151169
756 Ga0075431_100187742
757 Ga0075433_10025352
758 Ga0075433_10143059
759 Ga0075434_100039061
760 Ga0075434_100245859
761 Ga0079104_1000098
762 Ga0099826_10006310
763 Ga0075435_100228498
764 Ga0099795_10008109
765 Ga0105244_10006597
766 Ga0105244_10020803
767 Ga0105250_10004309
768 Ga0111539_10035303
769 Ga0111539_10088305
770 Ga0111539_10292170
771 Ga0111539_10545157
772 Ga0105245_10174310
773 Ga0114129_10003347
774 Ga0114129_10194916
775 Ga0114129_10234637
776 Ga0114129_10487096
777 Ga0105243_10001568
778 Ga0105243_10001785
779 Ga0105243_10004514
780 Ga0105243_10060785
781 Ga0105243_10149623
782 Ga0105243_10423655
783 Ga0105242_10000434
784 Ga0105242_10159384
785 Ga0105248_10013097
786 Ga0105248_10107485
787 Ga0105237_10144063
788 Ga0105237_10289737
789 Ga0105238_10021551
790 Ga0105238_10034332
791 Ga0105238_10307745
792 Ga0105249_10461480
793 Ga0099796_10003648
794 Ga0105239_10345840
795 Ga0157373_10077034
796 Ga0157373_10112974
797 Ga0157370_10007331
798 Ga0157369_10004674
799 Ga0157374_10024400
800 Ga0163162_10044954
801 Ga0163162_10285196
802 Ga0157372_10089385
803 Ga0157375_10041222
804 Ga0157375_10095185
805 Ga0157380_10125123
806 Ga0182008_10000351
807 Ga0182008_10004684
808 Ga0182008_10061167
809 Ga0182008_10069596
810 Ga0157376_10009865
811 Ga0157376_10227236
812 Ga0182006_1004047
813 Ga0182007_10000359
814 Ga0182007_10002075
815 Ga0183362_10004
816 Ga0163161_10000792
817 Ga0163161_10020473
818 Ga0163161_10082843
819 Ga0224572_1000950
820 Ga0209436_102105
821 Ga0209672_104858
822 Ga0209147_100771
823 Ga0209258_100020
824 Ga0207425_1000286
825 Ga0207425_1004280
826 Ga0209148_1000031
827 Ga0209129_1000406
828 Ga0209129_1004202
829 Ga0209565_1000078
830 Ga0209565_1000181
831 Ga0209565_1002569
832 Ga0209673_1000442
833 Ga0209673_1001199
834 Ga0209673_1001899
835 Ga0209130_1000443
836 Ga0209130_1000673
837 Ga0209130_1010607
838 Ga0209675_1000055
839 Ga0209675_1000339
840 Ga0209675_1001290
841 Ga0209676_1000040
842 Ga0209676_1000312
843 Ga0209676_1000403
844 Ga0209676_1009376
845 Ga0209025_1000242
846 Ga0209025_1000512
847 Ga0209025_1001359
848 Ga0209025_1002674
849 Ga0209025_1018366
850 Ga0209025_1046830
851 Ga0209564_1000157
852 Ga0209564_1000806
853 Ga0209758_1000042
854 Ga0209758_1008849
855 Ga0209050_1000021
856 Ga0209050_1001095
857 Ga0209050_1023436
858 Ga0209256_1000056
859 Ga0209256_1000124
860 Ga0207426_1000055
861 Ga0207426_1000079
862 Ga0209051_1000111
863 Ga0209051_1000423
864 Ga0209051_1000436
865 Ga0209051_1001224
866 Ga0209051_1014394
867 Ga0209051_1020877
868 Ga0209257_1000043
869 Ga0209257_1000215
870 Ga0209257_1005662
871 Ga0209257_1010491
872 Ga0209257_1015852
873 Ga0207656_10042880
874 Ga0207655_1002888
875 Ga0207682_10034068
876 Ga0207688_10003647
877 Ga0207645_10004754
878 Ga0207643_10003457
879 Ga0207684_10147058
880 Ga0207671_10188697
881 Ga0207663_10103376
882 Ga0207657_10079073
883 Ga0207657_10118615
884 Ga0207649_10161734
885 Ga0207681_10005798
886 Ga0207681_10107343
887 Ga0207681_10168195
888 Ga0207694_10020226
889 Ga0207694_10138182
890 Ga0207694_10283684
891 Ga0207650_10006667
892 Ga0207659_10006407
893 Ga0207659_10135677
894 Ga0207659_10388079
895 Ga0207690_10086805
896 Ga0207706_10024496
897 Ga0207706_10038781
898 Ga0207706_10073502
899 Ga0207686_10009208
900 Ga0207709_10000105
901 Ga0207709_10000394
902 Ga0207709_10002808
903 Ga0207709_10129724
904 Ga0207709_10203108
905 Ga0207670_10009663
906 Ga0207669_10063099
907 Ga0207669_10119543
908 Ga0207691_10001290
909 Ga0207691_10008342
910 Ga0207691_10201606
911 Ga0207711_10044962
912 Ga0207679_10025876
913 Ga0207667_10293247
914 Ga0207651_10284856
915 Ga0207712_10046451
916 Ga0207668_10145990
917 Ga0207640_10034736
918 Ga0207658_10018173
919 Ga0207658_10183400
920 Ga0207677_10021070
921 Ga0207639_10110252
922 Ga0207678_10014911
923 Ga0207678_10162662
924 Ga0207648_10006692
925 Ga0207648_10021402
926 Ga0207648_10369795
927 Ga0207648_10383264
928 Ga0207676_10037972
929 Ga0207674_10167834
930 Ga0207675_100012115
931 Ga0207683_10053075
932 Ga0207683_10074315
933 Ga0207683_10077652
934 Ga0207683_10262722
935 Ga0207698_10126388
936 Ga0207698_10153975
937 Ga0209281_1000002
938 Ga0209282_1004597
939 Ga0209971_1002369
940 Ga0209966_1001059
941 Ga0207428_10141697
942 Ga0268266_10096354
943 Ga0268266_10164413
944 Ga0268265_10250209
945 Ga0268264_10041770
946 Ga0307515_10000322
947 Ga0307515_10000954
948 Ga0307515_10083140
949 Ga0265338_10006490
950 Ga0307512_10124144
951 Ga0316177_1065008
952 Ga0316183_1143356
953 Ga0316181_1084630
954 Ga0316182_1287196
955 Ga0265760_10012964
956 Ga0265325_10009456
957 Ga0265339_10005892
958 Ga0265327_10007110
959 Ga0307513_10023920
960 Ga0307513_10106246
961 Ga0307513_10194153
962 Ga0307513_10321564
963 Ga0307408_100007148
964 Ga0307408_100123890
965 Ga0307408_100303861
966 Ga0307514_10001349
967 Ga0307514_10009045
968 Ga0307405_10004135
969 Ga0307405_10007767
970 Ga0307413_10233170
971 Ga0307406_10000240
972 Ga0307412_10014399
973 Ga0307412_10064418
974 Ga0307412_10156496
975 Ga0307412_10236446
976 Ga0307409_100402640
977 Ga0307416_100008554
978 Ga0307414_10047810
979 Ga0307414_10161986
980 Ga0373929_0019309
981 Ga0373940_0020147
982 Ga0373939_0013398
983 Ga0373941_0007760
984 Ga0373960_0057419
985 Ga0373943_0080368
986 Ga0373946_0012981
987 Ga0373931_0043899
988 Ga0373927_0037475
989 Ga0373927_0132535
990 Ga0373947_0010864
991 Ga0373947_0101725
992 Ga0373925_0070373
993 Ga0395905_0164044
994 Ga0395901_0108388
995 Ga0395901_0436092
996 Ga0436365_1040453
997 Ga0436360_0836411
998 Ga0436361_0013452
999 Ga0436363_0349250
1000 Ga0439436_0001899
1001 Ga0439439_0017595
1002 Ga0439439_0020150
1003 Ga0439447_023734
1004 Ga0439447_024497
1005 Ga0439466_0035467
1006 Ga0439466_0048579
1007 Ga0439465_0003830
1008 Ga0451789_0376263
1009 Ga0439431_0001450
1010 Ga0439433_0006783
1011 Ga0439441_017022
1012 Ga0439445_0004265
1013 Ga0439432_004915
1014 Ga0439432_018327
1015 Ga0439449_0003299
1016 Ga0439452_005337
1017 Ga0439452_015735
1018 Ga0439456_006315
1019 Ga0439457_032282
1020 Ga0439462_0001218
1021 Ga0450911_000250
1022 Ga0450920_012533
1023 Ga0450890_005516
1024 Ga0450894_006219
1025 Ga0450896_007638
1026 Ga0450899_001665
1027 Ga0450906_007149
1028 Ga0450909_011477
1029 Ga0439434_0004378
1030 Ga0439460_0006153
1031 Ga0450918_000332
1032 Ga0466959_0003224
1033 Ga0495627_011437
1034 Ga0495603_0051680
1035 Ga0495629_0165262
1036 Ga0495638_0045892
1037 Ga0495641_0085430
1038 Ga0495582_0018349
1039 Ga0495639_0031305
1040 Ga0495639_0033235
1041 Ga0495584_0011597
1042 Ga0495584_0020711
1043 Ga0495584_0083135
1044 Ga0495585_0012816
1045 Ga0495610_0069783
1046 Ga0495616_0009256
1047 Ga0495637_0005904
1048 Ga0495637_0055519
1049 Ga0495644_0015263
1050 Ga0495663_0029035
1051 Ga0495642_0040501
1052 Ga0495652_0419974
1053 Ga0495598_0010278
1054 Ga0495621_0009192
1055 Ga0495597_0001190
1056 Ga0495633_0129052
1057 Ga0495656_0000344
1058 Ga0495656_0013050
1059 Ga0495656_0030457
1060 Ga0495668_0100782
1061 Ga0495634_0151625
1062 Ga0495634_0156860
1063 Ga0495625_0000206
1064 Ga0495659_0045060
1065 Ga0495661_0125045
1066 Ga0495588_0035082
1067 Ga0495588_0124429
1068 Ga0495658_0035153
1069 Ga0495658_0312973
1070 Ga0495669_0032358
1071 Ga0495613_0270568
1072 Ga0495624_0083324
1073 Ga0495670_0159545
1074 Ga0495671_0001944
1075 Ga0495671_0066358
1076 Ga0495660_0033900
1077 Ga0495674_0183994
1078 Ga0495676_0047509
1079 Ga0495676_0069039
1080 Ga0495676_0159986
1081 Ga0495680_0187038
1082 Ga0495684_0087515
1083 Ga0495593_0091680
1084 Ga0495614_0030177
1085 Ga0495615_0012407
1086 Ga0496101_0001978
1087 Ga0496101_0120815
1088 Ga0496101_0429878
1089 Ga0496102_0002447
1090 Ga0496102_0013607
1091 Ga0496103_0064391
1092 Ga0496104_0005792
1093 Ga0496104_0045277
1094 Ga0496104_0052112
1095 Ga0496104_0107478
1096 Ga0496105_0005298
1097 Ga0496105_0015407
1098 Ga0496105_0028492
1099 Ga0496105_0032958
1100 Ga0496105_0036312
1101 Ga0496105_0400773
1102 Ga0496106_0032099
1103 Ga0496106_0101887
1104 Ga0496106_0108150
1105 Ga0496106_0429830
1106 Ga0496107_0040911
1107 Ga0496107_0068411
1108 Ga0496107_0179468
1109 Ga0496107_0232663
1110 Ga0496108_0091454
1111 Ga0496108_0113446
1112 Ga0496109_0015484
1113 Ga0496109_0058953
1114 Ga0496109_0110157
1115 Ga0496109_0287588
1116 Ga0496109_0331533
1117 Ga0496110_0003026
1118 Ga0496110_0036920
1119 Ga0496110_0064825
1120 Ga0496110_0185131
1121 Ga0496110_0277813
1122 Ga0496111_0016540
1123 Ga0496111_0153350
1124 Ga0496111_0343276
1125 Ga0496112_0001894
1126 Ga0496112_0198259
1127 Ga0496113_0000652
1128 Ga0496113_0175803
1129 Ga0496113_0366532
1130 Ga0496114_0196897
1131 Ga0496115_0032491
1132 Ga0496115_0109331
1133 Ga0496116_0016524
1134 Ga0496117_0052193
1135 Ga0496117_0088684
1136 Ga0496118_0018486
1137 Ga0496118_0056908
1138 Ga0496122_0001442
1139 Ga0496123_0000124
1140 Ga0496123_0140866
1141 Ga0496125_0010895
1142 Ga0496125_0033174
1143 Ga0496125_0061551
1144 Ga0496125_0163176
1145 Ga0496126_0274493
1146 Ga0496126_0275547
1147 Ga0501034_0199547
1148 Ga0501068_0050028
1149 Ga0501070_0133089
1150 Ga0501074_0138933
1151 Ga0501249_007158
1152 Ga0501080_0184204
1153 Ga0501262_000470
1154 Ga0501035_0406530
1155 nmdc:mga03683_19251_c1
1156 nmdc:mga03683_26429_c1
1157 nmdc:mga03n38_18233_c2
1158 nmdc:mga0yw44_180577_c1
1159 nmdc:mga0yw44_27198_c1
1160 nmdc:mga0k408_36428_c1
1161 nmdc:mga0k408_8429_c1
1162 nmdc:mga04h51_49513_c1
1163 nmdc:mga07m45_109935_c1
1164 nmdc:mga07m45_11742_c1
1165 nmdc:mga07m45_13759_c1
1166 nmdc:mga07m45_482_c1
1167 nmdc:mga07m45_93292_c1
1168 nmdc:mga05p37_173614_c1
1169 nmdc:mga05p37_186928_c1
1170 nmdc:mga05p37_304485_c1
1171 nmdc:mga05p37_4262_c1
1172 nmdc:mga09592_239042_c1
1173 nmdc:mga09592_446236_c1
1174 nmdc:mga0qj67_12428_c1
1175 nmdc:mga0qj67_30661_c1
1176 nmdc:mga0qj67_85452_c1
1177 nmdc:mga06r32_150915_c1
1178 nmdc:mga06r32_158840_c1
1179 nmdc:mga06r32_395822_c1
1180 nmdc:mga08y16_106665_c1
1181 nmdc:mga08y16_236262_c1
1182 nmdc:mga08y16_246902_c1
1183 nmdc:mga0n895_52125_c1
1184 nmdc:mga0n895_6291_c1
1185 nmdc:mga0rr50_211151_c1
1186 nmdc:mga0a205_19348_c2
1187 nmdc:mga0a205_475039_c1
1188 Ga0495601_0018426
1189 Ga0495601_0036655
1190 Ga0500610_0021663
1191 Ga0500610_0029879
1192 Ga0495655_0038917
1193 Ga0495619_0035199
1194 Ga0495619_0045609
1195 Ga0500644_0011501
1196 Ga0500651_0000467
1197 Ga0500571_000307
1198 Ga0500594_0012192
1199 Ga0500607_001064
1200 Ga0500658_0002234
1201 Ga0500559_0004856
1202 Ga0500559_0067515
1203 Ga0500568_0000624
1204 Ga0500573_0105715
1205 Ga0500574_000734
1206 Ga0500586_009287
1207 Ga0500622_0000943
1208 Ga0500627_0000293
1209 Ga0500634_0034760
1210 Ga0500634_0041197
1211 Ga0500636_0096074
1212 Ga0501084_0151820
1213 2513228408
1214 2599622479
1215 2599674429
1216 2599680114
1217 2599692130
1218 2643992008
1219 2644160821
1220 2644326585
1221 2644396934
1222 2644469390
1223 2722884865
1224 2738719271
1225 2738883382
1226 2739247404
1227 2739282998
1228 2819599180
1229 2831270960
1230 2838059008
1231 2839138555
1232 2842679319
1233 2842738312
1234 2842750691
1235 2885194686
1236 2885202221
1237 2885215874
1238 2899930003
1239 2904451588
1240 2904461923
1241 2904482980
1242 2904543249
1243 2919464453
1244 2928043539
1245 2928049831
1246 2928054406
1247 2928069992
1248 2928074388
1249 2928086623
1250 2928116759
1251 2929160483
1252 2929526506
1253 2945915482
1254 2945950488
1255 2945974868
1256 2945989118
1257 2954770073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

62

336

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.956 32 328
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9494 32 328
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9375 34 328
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9341 32 328
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9284 32 328
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9162 131 251 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9014 131 250 3.40.190.10
4x9tA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.8962 34 324 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.896 32 330 3.40.190.150
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8908 131 255 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A537SLD6-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.969 34 330
AF-A0A366FWJ4-F1-model_v4 deleted 0.9664 32 330
AF-A0A537DML3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9664 39 330
AF-A0A7W0X4R0-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9624 34 330
AF-A0A845H406-F1-model_v4 deleted 0.9608 34 325

Map