F470657

General Info

Members Datasets Scaffolds Average Seq Length
628 511 1256 138

Family's Representative Sequence

Representative Sequence 3300035171|Ga0373946_0685994|Ga0373946_0685994_25_507
Length 160
Sequence MSDITIYHNPACGTSRNTLALIRHAGIEPVVIEYLKTPPSREKLRELIAAMGISARELVREKGTPYAGLGLDDASLSDEQLLDAMLAHPILINRPIVVARLGTKLCRPSEEVLELLPVPKLAPFTKEDGDVVADSGRRRDPGNGKLTLPGAARSARRAGP

Samples

Sample ID Description Type Environment
1 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
121 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
126 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
137 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
138 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
139 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
140 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
141 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
142 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
143 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
144 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
147 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
175 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
222 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
223 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
224 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
225 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
226 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
227 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
228 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 2509276019 Ensifer aridi TW10 Isolate Nodule
231 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
232 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
233 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
234 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
235 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
236 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
237 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
238 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
239 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
240 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
241 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
242 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
243 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
244 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
245 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
246 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
247 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
248 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
249 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
250 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
251 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
252 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
253 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
254 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
255 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
256 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
257 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
258 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
259 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
260 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
261 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
262 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
263 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
264 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
265 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
266 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
267 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
268 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
269 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
270 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
271 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
272 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
273 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
274 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
275 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
276 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
277 2818991450 Burkholderia sp. 604 Isolate Unclassified
278 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
279 2838048938 Rhizobium pisi 27/80 Isolate Nodule
280 2838061910 Rhizobium phaseoli L15 Isolate Nodule
281 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
282 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
283 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
284 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
285 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
286 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
287 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
288 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
289 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
290 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
291 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
292 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
293 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
294 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
295 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
296 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
297 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
298 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
299 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
300 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
301 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
302 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
303 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
304 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
305 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
306 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
307 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
308 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
309 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
310 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
311 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
312 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
313 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
314 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
315 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
316 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
317 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
318 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
319 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
320 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
321 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
322 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
323 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
324 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
325 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
326 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
327 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
328 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
329 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
330 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
331 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
332 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
333 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
334 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
335 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
336 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
337 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
338 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
339 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
340 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
341 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
342 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
343 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
344 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
345 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
346 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
347 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
348 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
349 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
350 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
351 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
352 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
353 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
354 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
355 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
356 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
357 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
358 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
359 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
360 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
361 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
362 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
363 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
364 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
365 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
366 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
367 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
368 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
369 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
370 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
371 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
372 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
373 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
374 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
375 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
376 2933599457 Rhizobium phaseoli M3 Isolate Nodule
377 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
378 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
379 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
380 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
381 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
382 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
383 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
384 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
385 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
386 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
387 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
388 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
389 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
390 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
391 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
392 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
393 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
394 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
395 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
396 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
397 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
398 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
399 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
400 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
401 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
402 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
403 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
404 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
405 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
406 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
407 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
408 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
409 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
410 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
411 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
412 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
413 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
414 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
415 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
416 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
417 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
418 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
419 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
420 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
421 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
422 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
423 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
424 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
425 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
426 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
427 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
428 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
429 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
430 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
431 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
432 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
433 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
434 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
435 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
436 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
437 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
438 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
439 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
440 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
441 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
442 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
443 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
444 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
445 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
446 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
447 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
448 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
449 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
450 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
451 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
452 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
453 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
454 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
455 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
456 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
457 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
458 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
459 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
460 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
461 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
462 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
463 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
464 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
465 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
466 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
467 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
468 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
469 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
470 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
471 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
472 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
473 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
474 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
475 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
476 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
477 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
478 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
479 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
480 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
481 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
482 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
483 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
484 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
485 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
486 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
487 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
488 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
489 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
490 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
491 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
492 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
493 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
494 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
495 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
496 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
497 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
498 8005382845 Rhizobium sp. R634 Isolate Nodule
499 8005395548 Rhizobium sp. R339 Isolate Nodule
500 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
501 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
502 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
503 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
504 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
505 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
506 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
507 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
508 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
509 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
510 8024501048 Rhizobium sp. H4 Isolate Nodule
511 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.78
Metatranscriptomes 0
Isolates 45.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 13.54
Nodule 36.31
Rhizoplane 4.94
Rhizosphere 32.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373946_0685994 3300035171 Bacteria 535
2 SwRhRL2b_contig_1189119 2162886007 Bacteria 1364
3 JGI24737J22298_10039113 3300001990 Bacteria 1459
4 JGI24735J21928_10000694 3300002067 Bacteria 11946
5 JGI25151J46595_10002216 3300003187 Bacteria 12013
6 rootH2_10013979 3300003320 Bacteria 2350
7 rootH2_10020512 3300003320 Bacteria 1932
8 rootL2_10003492 3300003322 Bacteria 36420
9 rootL2_10014427 3300003322 Bacteria 9796
10 rootL2_10275712 3300003322 Bacteria 2488
11 rootH1_10005886 3300003323 Bacteria 9819
12 rootH1_10006122 3300003323 Bacteria 2617
13 rootH1_10030430 3300003323 Bacteria 6026
14 rootH1_10189449 3300003323 Bacteria 1365
15 Ga0055537_1000591 3300003773 Bacteria 20176
16 Ga0055537_1001007 3300003773 Bacteria 12764
17 Ga0055524_1026364 3300003775 Bacteria 1798
18 Ga0055534_1000129 3300003784 Bacteria 56688
19 Ga0055528_1000546 3300003790 Bacteria 28715
20 Ga0055530_10000834 3300003791 Bacteria 25475
21 Ga0055530_10083132 3300003791 Bacteria 669
22 Ga0055531_10002719 3300003794 Bacteria 11641
23 Ga0055531_10004707 3300003794 Bacteria 8164
24 Ga0065704_10080138 3300005289 Bacteria 4002
25 Ga0065715_10479805 3300005293 Bacteria 783
26 Ga0070658_11666947 3300005327 Bacteria 552
27 Ga0068869_100069327 3300005334 Bacteria 2607
28 Ga0070680_100131031 3300005336 Bacteria 2098
29 Ga0070682_100016576 3300005337 Bacteria 4287
30 Ga0070660_100196186 3300005339 Bacteria 1636
31 Ga0070691_10009447 3300005341 Bacteria 4450
32 Ga0070661_100245736 3300005344 Bacteria 1379
33 Ga0070668_102194678 3300005347 Bacteria 510
34 Ga0070659_100019285 3300005366 Bacteria 5165
35 Ga0070701_10520722 3300005438 Bacteria 775
36 Ga0070705_100102023 3300005440 Bacteria 1814
37 Ga0070694_100113675 3300005444 Bacteria 1932
38 Ga0070663_100011608 3300005455 Bacteria 5537
39 Ga0070678_100278059 3300005456 Bacteria 1414
40 Ga0070681_10071239 3300005458 Bacteria 3441
41 Ga0068867_100291237 3300005459 Bacteria 1342
42 Ga0070679_100027731 3300005530 Bacteria 5577
43 Ga0068853_100005835 3300005539 Bacteria 9697
44 Ga0070695_100068652 3300005545 Bacteria 2315
45 Ga0070693_100016157 3300005547 Bacteria 3858
46 Ga0070665_100124037 3300005548 Bacteria 2585
47 Ga0070664_100082956 3300005564 Bacteria 2764
48 Ga0068857_100073814 3300005577 Bacteria 3040
49 Ga0068854_100212820 3300005578 Bacteria 1526
50 Ga0070702_100528385 3300005615 Bacteria 871
51 Ga0068852_100009032 3300005616 Bacteria 7377
52 Ga0068852_100139501 3300005616 Bacteria 2242
53 Ga0068859_100282590 3300005617 Bacteria 1752
54 Ga0068859_101511826 3300005617 Bacteria 741
55 Ga0068864_100505416 3300005618 Bacteria 1163
56 Ga0068864_101070847 3300005618 Bacteria 801
57 Ga0068861_101152961 3300005719 Bacteria 747
58 Ga0068858_100724378 3300005842 Bacteria 968
59 Ga0068862_100976965 3300005844 Bacteria 836
60 Ga0075365_10391345 3300006038 Bacteria 981
61 Ga0075365_10436958 3300006038 Bacteria 924
62 Ga0075368_10000330 3300006042 Bacteria 13869
63 Ga0075368_10212567 3300006042 Bacteria 820
64 Ga0075364_10000022 3300006051 Bacteria 53466
65 Ga0075364_10002855 3300006051 Bacteria 9741
66 Ga0075364_10518298 3300006051 Bacteria 815
67 Ga0075367_10002007 3300006178 Bacteria 9075
68 Ga0075367_10085051 3300006178 Bacteria 1919
69 Ga0075367_10353709 3300006178 Bacteria 927
70 Ga0075367_10909487 3300006178 Bacteria 561
71 Ga0075369_10000533 3300006186 Bacteria 12019
72 Ga0075369_10002567 3300006186 Bacteria 6496
73 Ga0075366_10001429 3300006195 Bacteria 11908
74 Ga0075366_10005515 3300006195 Bacteria 6857
75 Ga0075366_10152647 3300006195 Bacteria 1399
76 Ga0075366_10249730 3300006195 Bacteria 1082
77 Ga0075366_10682106 3300006195 Bacteria 638
78 Ga0075370_10000054 3300006353 Bacteria 34222
79 Ga0075370_10114521 3300006353 Bacteria 1567
80 Ga0075370_10639923 3300006353 Bacteria 645
81 Ga0097620_100282590 3300006931 Bacteria 1752
82 Ga0097620_101511411 3300006931 Bacteria 741
83 Ga0079104_1004220 3300006946 Bacteria 6253
84 Ga0105251_10000029 3300009011 Bacteria 125097
85 Ga0105240_10348638 3300009093 Bacteria 1680
86 Ga0105243_10068610 3300009148 Bacteria 2858
87 Ga0105248_11437518 3300009177 Bacteria 780
88 Ga0105237_10036325 3300009545 Bacteria 4984
89 Ga0105238_10035562 3300009551 Bacteria 5064
90 Ga0105239_12543218 3300010375 Bacteria 597
91 Ga0157373_10136975 3300013100 Bacteria 1721
92 Ga0157370_10055090 3300013104 Bacteria 3790
93 Ga0157370_11219848 3300013104 Bacteria 678
94 Ga0157374_10195354 3300013296 Bacteria 1980
95 Ga0157378_10558321 3300013297 Bacteria 1151
96 Ga0163162_10366056 3300013306 Bacteria 1575
97 Ga0157372_10236779 3300013307 Bacteria 2117
98 Ga0157375_10103761 3300013308 Bacteria 2931
99 Ga0157375_10313638 3300013308 Bacteria 1733
100 Ga0157375_11796607 3300013308 Bacteria 727
101 Ga0157380_10054256 3300014326 Bacteria 3180
102 Ga0157379_10247189 3300014968 Bacteria 1619
103 Ga0157379_10900668 3300014968 Bacteria 839
104 Ga0157376_10354427 3300014969 Bacteria 1405
105 Ga0182006_1191339 3300015261 Bacteria 680
106 Ga0182007_10000788 3300015262 Bacteria 17720
107 Ga0163161_10074887 3300017792 Bacteria 2483
108 Ga0163161_10092094 3300017792 Bacteria 2244
109 Ga0163161_10545236 3300017792 Bacteria 950
110 Ga0214543_1000003 3300021327 Bacteria 692327
111 Ga0207425_1048308 3300025245 Bacteria 786
112 Ga0209565_1000050 3300025263 Bacteria 213856
113 Ga0209565_1028375 3300025263 Bacteria 1106
114 Ga0209673_1000859 3300025273 Bacteria 39489
115 Ga0209673_1033792 3300025273 Bacteria 1553
116 Ga0209675_1000007 3300025291 Bacteria 683430
117 Ga0209676_1000018 3300025292 Bacteria 631385
118 Ga0209676_1000716 3300025292 Bacteria 45721
119 Ga0209676_1104216 3300025292 Bacteria 598
120 Ga0209025_1000062 3300025294 Bacteria 304236
121 Ga0209564_1000061 3300025295 Bacteria 322795
122 Ga0209564_1011921 3300025295 Bacteria 3841
123 Ga0209050_1000562 3300025298 Bacteria 60493
124 Ga0209050_1022022 3300025298 Bacteria 2299
125 Ga0209050_1065007 3300025298 Bacteria 843
126 Ga0209256_1003428 3300025299 Bacteria 11139
127 Ga0209256_1016947 3300025299 Bacteria 2451
128 Ga0209051_1007254 3300025303 Bacteria 6093
129 Ga0209257_1000035 3300025304 Bacteria 631463
130 Ga0209257_1001300 3300025304 Bacteria 30429
131 Ga0209257_1002553 3300025304 Bacteria 17757
132 Ga0209257_1020575 3300025304 Bacteria 2432
133 Ga0207713_1000112 3300025735 Bacteria 133341
134 Ga0207682_10001290 3300025893 Bacteria 11504
135 Ga0207682_10031052 3300025893 Bacteria 2143
136 Ga0207680_10183602 3300025903 Bacteria 1416
137 Ga0207647_10004846 3300025904 Bacteria 9952
138 Ga0207645_10585311 3300025907 Bacteria 757
139 Ga0207707_10060781 3300025912 Bacteria 3287
140 Ga0207695_10049462 3300025913 Bacteria 4430
141 Ga0207695_10245490 3300025913 Bacteria 1690
142 Ga0207671_10163468 3300025914 Bacteria 1725
143 Ga0207660_10078141 3300025917 Bacteria 2424
144 Ga0207662_10790432 3300025918 Bacteria 668
145 Ga0207657_10207932 3300025919 Bacteria 1572
146 Ga0207649_10170107 3300025920 Bacteria 1517
147 Ga0207652_10214136 3300025921 Bacteria 1735
148 Ga0207644_10120861 3300025931 Bacteria 1994
149 Ga0207709_10128260 3300025935 Bacteria 1724
150 Ga0207709_10647484 3300025935 Bacteria 841
151 Ga0207711_10285980 3300025941 Bacteria 1519
152 Ga0207689_10114665 3300025942 Bacteria 2215
153 Ga0207679_10390098 3300025945 Bacteria 1223
154 Ga0207679_10492717 3300025945 Bacteria 1092
155 Ga0207667_10982150 3300025949 Bacteria 832
156 Ga0207668_11697237 3300025972 Bacteria 570
157 Ga0207658_10061941 3300025986 Bacteria 2798
158 Ga0207677_10402120 3300026023 Bacteria 1162
159 Ga0207703_10165825 3300026035 Bacteria 1938
160 Ga0207639_10035093 3300026041 Bacteria 3710
161 Ga0207678_10001716 3300026067 Bacteria 20067
162 Ga0207702_10236738 3300026078 Bacteria 1709
163 Ga0207648_10243037 3300026089 Bacteria 1603
164 Ga0207676_10500380 3300026095 Bacteria 1154
165 Ga0207676_11193615 3300026095 Bacteria 754
166 Ga0207674_10082431 3300026116 Bacteria 3217
167 Ga0207675_100162321 3300026118 Bacteria 2132
168 Ga0207675_100382843 3300026118 Bacteria 1384
169 Ga0207683_10009322 3300026121 Bacteria 8362
170 Ga0209281_1000332 3300027111 Bacteria 81534
171 Ga0209371_1001542 3300027312 Bacteria 15243
172 Ga0209813_10000092 3300027866 Bacteria 33357
173 Ga0209974_10023613 3300027876 Bacteria 2035
174 Ga0268266_10171365 3300028379 Bacteria 1970
175 Ga0268266_12363389 3300028379 Bacteria 502
176 Ga0268256_1031220 3300030500 Bacteria 1281
177 Ga0265328_10007359 3300031239 Bacteria 4592
178 Ga0265327_10000147 3300031251 Bacteria 153254
179 Ga0307513_10030116 3300031456 Bacteria 6171
180 Ga0307513_10506407 3300031456 Bacteria 924
181 Ga0307405_10000918 3300031731 Bacteria 11737
182 Ga0307409_100930960 3300031995 Bacteria 884
183 Ga0307409_101207978 3300031995 Bacteria 780
184 Ga0307416_100548068 3300032002 Bacteria 1229
185 Ga0307414_10181354 3300032004 Bacteria 1694
186 Ga0307411_10279734 3300032005 Bacteria 1327
187 Ga0373935_0982501 3300035692 Bacteria 627
188 Ga0395898_0052130 3300037466 Bacteria 3997
189 Ga0439465_0235346 3300041413 Bacteria 674
190 Ga0451797_0542997 3300041453 Bacteria 2315
191 Ga0451804_0477314 3300041463 Bacteria 520
192 Ga0451833_0114529 3300041491 Bacteria 573
193 Ga0451837_0097586 3300041494 Bacteria 1008
194 Ga0451837_0313458 3300041494 Bacteria 733
195 Ga0451839_0447087 3300041496 Bacteria 674
196 Ga0451843_1531609 3300041509 Bacteria 1767
197 Ga0439433_0049165 3300041999 Bacteria 992
198 Ga0439432_000838 3300042006 Bacteria 11493
199 Ga0439449_0004268 3300042007 Bacteria 5523
200 Ga0450915_016376 3300042119 Bacteria 564
201 Ga0439459_0016280 3300042438 Bacteria 1373
202 Ga0466963_0000912 3300044694 Bacteria 15041
203 Ga0466964_0185865 3300044706 Bacteria 988
204 Ga0453684_0511605 3300044712 Bacteria 1328
205 Ga0466970_0102844 3300044765 Bacteria 1556
206 Ga0466959_0277801 3300045049 Bacteria 1150
207 Ga0466958_0101421 3300045836 Bacteria 1790
208 Ga0466967_0131623 3300045976 Bacteria 2323
209 Ga0495627_176446 3300046453 Bacteria 592
210 Ga0495650_0001132 3300046471 Bacteria 28975
211 Ga0495650_0034519 3300046471 Bacteria 2238
212 Ga0495607_0100318 3300046501 Bacteria 1552
213 Ga0495583_0003433 3300046506 Bacteria 12061
214 Ga0495606_0080537 3300046507 Bacteria 2026
215 Ga0495606_0283420 3300046507 Bacteria 905
216 Ga0495610_0002834 3300046512 Bacteria 14106
217 Ga0495610_0002893 3300046512 Bacteria 13895
218 Ga0495616_0423507 3300046513 Bacteria 543
219 Ga0495620_0028628 3300046515 Bacteria 2588
220 Ga0495628_0091841 3300046516 Bacteria 2349
221 Ga0495643_0000509 3300046522 Bacteria 48505
222 Ga0495643_0051616 3300046522 Bacteria 2211
223 Ga0495663_0001346 3300046525 Bacteria 7766
224 Ga0495654_0000080 3300046530 Bacteria 109402
225 Ga0495667_0139561 3300046559 Bacteria 1562
226 Ga0495668_0318292 3300046616 Bacteria 853
227 Ga0495658_0147738 3300046683 Bacteria 1442
228 Ga0495670_0462939 3300046691 Bacteria 687
229 Ga0495671_0186115 3300046692 Bacteria 1008
230 Ga0495674_0053452 3300047319 Bacteria 3550
231 Ga0495672_0000002 3300047320 Bacteria 740116
232 Ga0495672_0000355 3300047320 Bacteria 58647
233 Ga0495672_0008236 3300047320 Bacteria 7727
234 Ga0495679_122940 3300047446 Bacteria 708
235 Ga0495673_0065076 3300047469 Bacteria 1549
236 Ga0495686_0000021 3300047472 Bacteria 426560
237 Ga0495686_0013246 3300047472 Bacteria 5729
238 Ga0496100_0261998 3300048903 Bacteria 1282
239 Ga0496100_0287351 3300048903 Bacteria 1228
240 Ga0496101_0059267 3300048904 Bacteria 2774
241 Ga0496101_0586597 3300048904 Bacteria 881
242 Ga0496102_0176911 3300048905 Bacteria 2009
243 Ga0496102_0365872 3300048905 Bacteria 1357
244 Ga0496102_0961633 3300048905 Bacteria 775
245 Ga0496103_0027051 3300048906 Bacteria 3473
246 Ga0496104_0081202 3300048907 Bacteria 3092
247 Ga0496104_0085211 3300048907 Bacteria 3016
248 Ga0496104_1073859 3300048907 Bacteria 709
249 Ga0496105_0047136 3300048908 Bacteria 3556
250 Ga0496105_0181176 3300048908 Bacteria 1725
251 Ga0496105_0389704 3300048908 Bacteria 1108
252 Ga0496105_0545405 3300048908 Bacteria 905
253 Ga0496106_0065006 3300048909 Bacteria 2776
254 Ga0496107_0055747 3300048910 Bacteria 2854
255 Ga0496107_0442638 3300048910 Bacteria 965
256 Ga0496108_0034345 3300048911 Bacteria 4214
257 Ga0496109_0153683 3300048912 Bacteria 2155
258 Ga0496110_0417501 3300048913 Bacteria 1223
259 Ga0496111_0397228 3300048914 Bacteria 1019
260 Ga0496114_0064996 3300048917 Bacteria 3056
261 Ga0496114_0295223 3300048917 Bacteria 1430
262 Ga0496114_0359004 3300048917 Bacteria 1289
263 Ga0496115_0104349 3300048918 Bacteria 2326
264 Ga0496115_0273139 3300048918 Bacteria 1388
265 Ga0496116_0122568 3300048919 Bacteria 1501
266 Ga0496116_0158348 3300048919 Bacteria 1246
267 Ga0496117_0019831 3300048920 Bacteria 5507
268 Ga0496118_0000692 3300048921 Bacteria 54767
269 Ga0496118_0057336 3300048921 Bacteria 2920
270 Ga0496118_0070020 3300048921 Bacteria 2536
271 Ga0496121_0000190 3300048924 Bacteria 136607
272 Ga0496121_0007470 3300048924 Bacteria 13197
273 Ga0496121_0107254 3300048924 Bacteria 2139
274 Ga0496121_0159568 3300048924 Bacteria 1651
275 Ga0496121_0220269 3300048924 Bacteria 1337
276 Ga0496121_0339601 3300048924 Bacteria 1004
277 Ga0496122_0151578 3300048925 Bacteria 1430
278 Ga0496123_0059633 3300048926 Bacteria 2465
279 Ga0496123_0280741 3300048926 Bacteria 805
280 Ga0496124_0005662 3300048927 Bacteria 13938
281 Ga0496124_0093271 3300048927 Bacteria 2451
282 Ga0496124_0148735 3300048927 Bacteria 1840
283 Ga0496124_0220111 3300048927 Bacteria 1428
284 Ga0496125_0004808 3300048928 Bacteria 15356
285 Ga0496125_0153231 3300048928 Bacteria 1579
286 Ga0496126_0027270 3300048929 Bacteria 5458
287 Ga0496126_0064155 3300048929 Bacteria 3291
288 Ga0496126_0094332 3300048929 Bacteria 2626
289 Ga0496126_0166894 3300048929 Bacteria 1878
290 Ga0495678_025628 3300049459 Bacteria 2529
291 Ga0495678_116533 3300049459 Bacteria 903
292 Ga0501031_0422083 3300049568 Bacteria 862
293 Ga0501032_0816024 3300049569 Bacteria 589
294 Ga0501033_0005536 3300049570 Bacteria 9990
295 Ga0501034_0084714 3300049571 Bacteria 3171
296 Ga0501034_0113961 3300049571 Bacteria 2693
297 Ga0501034_0439655 3300049571 Bacteria 1223
298 Ga0501034_0905632 3300049571 Bacteria 770
299 Ga0501036_0331572 3300049572 Bacteria 1271
300 Ga0501043_0013507 3300049579 Bacteria 6389
301 Ga0501043_0134394 3300049579 Bacteria 1938
302 Ga0501043_0349780 3300049579 Bacteria 1123
303 Ga0501047_0010908 3300049581 Bacteria 8593
304 Ga0501047_0028286 3300049581 Bacteria 5404
305 Ga0501047_0627933 3300049581 Bacteria 895
306 Ga0501074_0217987 3300049590 Bacteria 1359
307 Ga0501238_009713 3300049671 Bacteria 1278
308 Ga0501080_0011592 3300049742 Bacteria 8072
309 Ga0501035_0006507 3300049822 Bacteria 10975
310 Ga0501044_0154031 3300049823 Bacteria 2279
311 Ga0501044_0170354 3300049823 Bacteria 2149
312 Ga0501044_0246972 3300049823 Bacteria 1727
313 nmdc:mga03683_1897_c2 3300050489 Bacteria 5857
314 nmdc:mga03n38_11652_c1 3300050490 Bacteria 3284
315 nmdc:mga03n38_854115_c1 3300050490 Bacteria 532
316 nmdc:mga00v17_214_c1 3300050491 Bacteria 34878
317 nmdc:mga00v17_91_c1 3300050491 Bacteria 53223
318 nmdc:mga0yw44_201841_c1 3300050492 Bacteria 1012
319 nmdc:mga0yw44_229367_c1 3300050492 Bacteria 1232
320 nmdc:mga0yw44_248657_c2 3300050492 Bacteria 859
321 nmdc:mga0yw44_727_c2 3300050492 Bacteria 11571
322 nmdc:mga0k408_566_c2 3300050493 Bacteria 13737
323 nmdc:mga0k408_79218_c1 3300050493 Bacteria 1922
324 nmdc:mga0k408_799742_c1 3300050493 Bacteria 549
325 nmdc:mga06z11_24916_c1 3300050494 Bacteria 2828
326 nmdc:mga06z11_48_c1 3300050494 Bacteria 51095
327 nmdc:mga06z11_62457_c1 3300050494 Bacteria 1946
328 nmdc:mga06z11_766419_c1 3300050494 Bacteria 588
329 nmdc:mga04h51_57_c1 3300050495 Bacteria 35214
330 nmdc:mga07m45_318_c1 3300050496 Bacteria 19459
331 nmdc:mga07m45_4447_c1 3300050496 Bacteria 6859
332 nmdc:mga07m45_77822_c1 3300050496 Bacteria 1892
333 nmdc:mga0sz30_34_c1 3300050516 Bacteria 53573
334 nmdc:mga0sz30_4012_c2 3300050516 Bacteria 4988
335 nmdc:mga0sz30_74976_c1 3300050516 Bacteria 1460
336 Ga0500583_0037433 3300053092 Bacteria 2179
337 Ga0500583_0050988 3300053092 Bacteria 1921
338 Ga0500595_085413 3300053119 Bacteria 919
339 Ga0500607_000293 3300053121 Bacteria 47399
340 Ga0500577_0167791 3300053142 Bacteria 938
341 Ga0500634_0009498 3300053161 Bacteria 4926
342 Ga0500645_028765 3300053730 Bacteria 1680
343 Ga0500565_012222 3300053734 Bacteria 909
344 Ga0466962_0085681 3300061719 Bacteria 1508
345 2509374507 2509276019 Bacteria 6802256
346 2510306599 2510065057 Bacteria 6649661
347 2511500962 2511231052 Bacteria 6974333
348 2513583500 2513237086 Bacteria 7265287
349 2513617651 2513237091 Bacteria 6900273
350 2513672509 2513237098 Bacteria 9902361
351 2513882713 2513237140 Bacteria 7076289
352 2513905258 2513237143 Bacteria 6664116
353 2516892243 2516653046 Bacteria 6989037
354 2537876750 2537561587 Bacteria 5425293
355 2551676422 2551306084 Bacteria 8942552
356 2551687221 2551306085 Bacteria 7347181
357 2551694403 2551306086 Bacteria 6843938
358 2551703176 2551306087 Bacteria 7351905
359 2551712363 2551306089 Bacteria 7162724
360 2551720684 2551306090 Bacteria 7953713
361 2551732606 2551306092 Bacteria 6992595
362 2551740392 2551306093 Bacteria 7064773
363 2558863534 2558860100 Bacteria 8458965
364 2574430553 2574179768 Bacteria 4907129
365 2585201048 2582581294 Bacteria 6626667
366 2585256173 2582581304 Bacteria 5831370
367 2585843947 2585427594 Bacteria 6180594
368 2616292272 2615840624 Bacteria 6557588
369 2644363004 2643221665 Bacteria 4699229
370 2650898988 2648501693 Bacteria 5069560
371 2671117984 2667528175 Bacteria 7532676
372 2686353372 2684622997 Bacteria 4624240
373 2692319446 2690316117 Bacteria 6800650
374 2719665791 2718217997 Bacteria 6740740
375 2720492211 2718218199 Bacteria 6740745
376 2720620351 2718218233 Bacteria 6662049
377 2720631775 2718218235 Bacteria 6630699
378 2720775503 2718218269 Bacteria 6906114
379 2723560734 2721755684 Bacteria 6859907
380 2723567322 2721755685 Bacteria 6704835
381 2724090110 2721755819 Bacteria 6906405
382 2724104587 2721755822 Bacteria 6726041
383 2724110388 2721755823 Bacteria 6752556
384 2739649609 2739367664 Bacteria 4114334
385 2740028082 2739367865 Bacteria 4114482
386 2747950689 2747842428 Bacteria 4689383
387 2765571604 2765235838 Bacteria 5445269
388 2778177100 2775507266 Bacteria 7392367
389 2809129384 2808606415 Bacteria 4576710
390 2809149561 2808606419 Bacteria 4576925
391 2819608624 2818991448 Bacteria 6772224
392 2819613680 2818991448 Bacteria 6772224
393 2819621290 2818991450 Bacteria 6962147
394 2838018020 2838016132 Bacteria 6577831
395 2838053552 2838048938 Bacteria 6044578
396 2838065618 2838061910 Bacteria 6794874
397 2838074333 2838068647 Bacteria 6208656
398 2838674422 2838668709 Bacteria 6671819
399 2838676367 2838675328 Bacteria 4909118
400 2838706950 2838701080 Bacteria 6669771
401 2838715250 2838714209 Bacteria 5525906
402 2838720950 2838719591 Bacteria 5523910
403 2838726008 2838724970 Bacteria 4908691
404 2839994920 2839993093 Bacteria 5512535
405 2841847908 2841846520 Bacteria 5345850
406 2841859567 2841859092 Bacteria 5436171
407 2842126062 2842124991 Bacteria 5346824
408 2842131261 2842130223 Bacteria 4909145
409 2842151478 2842146304 Bacteria 5957337
410 2842153569 2842152218 Bacteria 4908957
411 2842171493 2842170452 Bacteria 5525737
412 2842177189 2842175837 Bacteria 4908771
413 2842188358 2842187318 Bacteria 5524014
414 2842212669 2842211629 Bacteria 5523832
415 2842225712 2842224351 Bacteria 5524473
416 2842256616 2842250916 Bacteria 6579627
417 2842265854 2842264693 Bacteria 6472963
418 2842285946 2842285085 Bacteria 6011953
419 2842314427 2842311132 Bacteria 6616990
420 2842317726 2842317721 Bacteria 6793725
421 2842403305 2842402390 Bacteria 6681310
422 2842409322 2842409023 Bacteria 6687331
423 2842415975 2842415677 Bacteria 6596907
424 2842427552 2842422224 Bacteria 6239196
425 2842429509 2842428310 Bacteria 6767288
426 2842436122 2842434925 Bacteria 6502746
427 2842442469 2842441272 Bacteria 6769273
428 2842450762 2842447887 Bacteria 6754142
429 2842463930 2842462802 Bacteria 6588055
430 2842470451 2842469257 Bacteria 6752936
431 2842486142 2842482326 Bacteria 7212537
432 2842490216 2842489311 Bacteria 6620893
433 2842516352 2842515876 Bacteria 5436280
434 2842760514 2842757796 Bacteria 3981385
435 2847422052 2847417321 Bacteria 6913799
436 2847799849 2847797336 Bacteria 5176640
437 2848997030 2848992105 Bacteria 6810864
438 2850080427 2850079185 Bacteria 6848280
439 2852388203 2852387548 Bacteria 8025568
440 2852619712 2852618963 Bacteria 4577824
441 2852656982 2852653556 Bacteria 4050083
442 2855831313 2855825444 Bacteria 6785811
443 2855840438 2855839649 Bacteria 7135830
444 2858800966 2858800743 Bacteria 6603254
445 2885433086 2885429604 Bacteria 3642894
446 2891373984 2891373044 Bacteria 5202277
447 2894656382 2894652903 Bacteria 4587256
448 2903775978 2903768456 Bacteria 9749579
449 2915990904 2915986958 Bacteria 6739310
450 2915996270 2915993759 Bacteria 7016183
451 2916005748 2916000859 Bacteria 6865702
452 2916010917 2916007675 Bacteria 6898660
453 2916016554 2916014648 Bacteria 6946486
454 2916024753 2916021584 Bacteria 6854472
455 2916038155 2916035215 Bacteria 6755766
456 2916047917 2916041962 Bacteria 6820487
457 2916054362 2916048683 Bacteria 6543552
458 2916055367 2916055098 Bacteria 6758838
459 2916073449 2916068649 Bacteria 6943657
460 2916078177 2916076590 Bacteria 6596108
461 2919708917 2919704043 Bacteria 5560311
462 2920761572 2920760137 Bacteria 7427611
463 2921204931 2921201388 Bacteria 6926299
464 2921213521 2921208531 Bacteria 6745326
465 2921241613 2921237296 Bacteria 6876710
466 2921247525 2921244191 Bacteria 6568419
467 2921261600 2921257292 Bacteria 6808382
468 2921264244 2921263974 Bacteria 6864552
469 2921282759 2921282425 Bacteria 6826397
470 2921290139 2921289301 Bacteria 7316391
471 2921303398 2921296804 Bacteria 7176999
472 2924145609 2924144063 Bacteria 6883928
473 2924157261 2924150972 Bacteria 7169444
474 2924160564 2924158325 Bacteria 7188855
475 2924168160 2924165586 Bacteria 7260590
476 2924173407 2924172951 Bacteria 6749356
477 2924186323 2924179722 Bacteria 6843264
478 2924189503 2924186466 Bacteria 6876637
479 2924198239 2924193448 Bacteria 6955718
480 2924204068 2924200457 Bacteria 6757188
481 2924209900 2924207177 Bacteria 6917007
482 2924215185 2924214083 Bacteria 7080103
483 2924226238 2924221636 Bacteria 7113495
484 2924234925 2924228884 Bacteria 6633132
485 2926756388 2926754445 Bacteria 5964435
486 2928109198 2928108538 Bacteria 7360024
487 2928136421 2928135762 Bacteria 7259641
488 2928503798 2928503688 Bacteria 7268108
489 2928522018 2928521798 Bacteria 4960112
490 2933008212 2933006813 Bacteria 4912075
491 2933013007 2933011516 Bacteria 5439334
492 2933604790 2933599457 Bacteria 5858799
493 2937009523 2937002841 Bacteria 6934057
494 2937010877 2937009748 Bacteria 6746052
495 2937018994 2937016420 Bacteria 6782579
496 2937027934 2937023124 Bacteria 6815156
497 2937048980 2937042894 Bacteria 6741576
498 2937056293 2937049772 Bacteria 6757901
499 2937063364 2937056579 Bacteria 7107896
500 2937070634 2937063883 Bacteria 7199456
501 2937072168 2937071275 Bacteria 6984483
502 2937095580 2937091812 Bacteria 6979387
503 2937103644 2937098957 Bacteria 7249374
504 2937112553 2937106411 Bacteria 6947143
505 2937118183 2937113482 Bacteria 6505872
506 2937121176 2937119839 Bacteria 6597547
507 2937129810 2937126314 Bacteria 6771275
508 2941493736 2941489479 Bacteria 6313767
509 2954014623 2954011201 Bacteria 4762601
510 2957385078 2957382221 Bacteria 6737050
511 2957389141 2957388812 Bacteria 6778072
512 2957396397 2957395598 Bacteria 6822399
513 2957405457 2957402308 Bacteria 6741770
514 2957413260 2957408893 Bacteria 6558585
515 2957419189 2957415311 Bacteria 6991633
516 2957427724 2957422303 Bacteria 7172205
517 2957431100 2957430029 Bacteria 7022557
518 2957446663 2957443900 Bacteria 6869977
519 2957454181 2957450854 Bacteria 6765715
520 2957457612 2957457609 Bacteria 6967680
521 2957467757 2957464669 Bacteria 6568877
522 2957477799 2957471148 Bacteria 6797643
523 2957480637 2957478035 Bacteria 6756658
524 2957485799 2957484790 Bacteria 6703082
525 2957495985 2957491536 Bacteria 6695180
526 2957501027 2957498199 Bacteria 7126688
527 2957509583 2957505466 Bacteria 7253085
528 2960586635 2960584000 Bacteria 6864594
529 2960600584 2960597568 Bacteria 6550735
530 2960609484 2960603979 Bacteria 6898737
531 2960616720 2960610863 Bacteria 6691244
532 2960617694 2960617483 Bacteria 6727748
533 2960629777 2960624210 Bacteria 6875384
534 2960640198 2960637947 Bacteria 7296468
535 2960648737 2960645483 Bacteria 7211087
536 2960659495 2960652885 Bacteria 7083688
537 2960666395 2960660292 Bacteria 7041660
538 2960673916 2960667422 Bacteria 6763020
539 2960678823 2960674078 Bacteria 6609048
540 2960692070 2960687367 Bacteria 6535474
541 2961067309 2961064222 Bacteria 4749990
542 2964609721 2964607997 Bacteria 7101408
543 2964620710 2964615318 Bacteria 6809089
544 2964627798 2964621998 Bacteria 6834995
545 2964633126 2964628898 Bacteria 7083044
546 2964637206 2964636051 Bacteria 7091832
547 2964646152 2964643177 Bacteria 6820887
548 2964653094 2964649959 Bacteria 6675118
549 2964661893 2964656573 Bacteria 7100150
550 2964665981 2964663802 Bacteria 7019362
551 2964671695 2964670856 Bacteria 6851364
552 2964678978 2964678106 Bacteria 6792020
553 2964688099 2964685014 Bacteria 6839111
554 2964695832 2964691889 Bacteria 6802758
555 2964703604 2964698721 Bacteria 6765331
556 2964706165 2964705432 Bacteria 7114648
557 2964716290 2964712639 Bacteria 6695970
558 2964726466 2964719344 Bacteria 7286602
559 2967667362 2967664464 Bacteria 6948836
560 2967672153 2967671571 Bacteria 7021409
561 2967678916 2967678726 Bacteria 7264382
562 2967693236 2967693043 Bacteria 6804451
563 2967704249 2967699805 Bacteria 6854538
564 2967712939 2967706974 Bacteria 7186053
565 2967716538 2967714385 Bacteria 7000047
566 2967724577 2967721400 Bacteria 7073753
567 2967737589 2967735183 Bacteria 6827012
568 2967747864 2967742019 Bacteria 6794534
569 2967752114 2967748971 Bacteria 6733771
570 2967757725 2967755722 Bacteria 6814706
571 2967763810 2967762386 Bacteria 6923502
572 2967770783 2967769361 Bacteria 6587838
573 2967782168 2967775926 Bacteria 6738189
574 2970026062 2970019648 Bacteria 7072033
575 2970037793 2970033650 Bacteria 7118744
576 2970043294 2970040964 Bacteria 6731123
577 2970049929 2970047711 Bacteria 7088379
578 2970059617 2970054988 Bacteria 6611507
579 2970065303 2970061556 Bacteria 7099761
580 2970075674 2970068827 Bacteria 7123112
581 2970076978 2970076120 Bacteria 6697332
582 2970085657 2970082768 Bacteria 6183754
583 2970093299 2970088815 Bacteria 6933825
584 2970096804 2970095765 Bacteria 6936963
585 2970108555 2970102677 Bacteria 6812532
586 2970109828 2970109326 Bacteria 6863976
587 2970117977 2970116247 Bacteria 6501857
588 2970129509 2970129317 Bacteria 6806560
589 2970143159 2970136068 Bacteria 7207982
590 2970153823 2970149975 Bacteria 6779706
591 2970162815 2970156795 Bacteria 7168044
592 2970167495 2970164137 Bacteria 6861252
593 2970171785 2970170962 Bacteria 6876229
594 2970184113 2970177841 Bacteria 6768001
595 2970185135 2970184632 Bacteria 7054431
596 2970198333 2970191845 Bacteria 7032787
597 2974307367 2974307012 Bacteria 4172388
598 2977242959 2977240413 Bacteria 3191065
599 2977248117 2977247770 Bacteria 4160543
600 2977523658 2977516862 Bacteria 6940108
601 2977527646 2977523885 Bacteria 6960446
602 2977537980 2977537788 Bacteria 6929320
603 2977551978 2977551784 Bacteria 7125765
604 2977561681 2977558990 Bacteria 6863948
605 2977568973 2977565890 Bacteria 6901543
606 2977578970 2977572785 Bacteria 6763888
607 2977581503 2977579622 Bacteria 6772100
608 2984496660 2984494565 Bacteria 5000175
609 2984517430 2984514374 Bacteria 4172479
610 2990262077 2990261002 Bacteria 4919493
611 648736357 648276728 Bacteria 6968865
612 8003992935 8003992118 Bacteria 7266902
613 8005285300 8005282627 Bacteria 6675747
614 8005385432 8005382845 Bacteria 6732062
615 8005396576 8005395548 Bacteria 6806915
616 8005431733 8005430974 Bacteria 6689030
617 8005484727 8005484373 Bacteria 6297373
618 8005500523 8005497431 Bacteria 6477605
619 8005621901 8005619151 Bacteria 7030230
620 8005627143 8005626139 Bacteria 6534237
621 8005646142 8005645114 Bacteria 6950293
622 8005649420 8005645114 Bacteria 6950293
623 8005662721 8005658619 Bacteria 4500593
624 8005671941 8005668836 Bacteria 6953162
625 8018130108 8018127388 Bacteria 7351159
626 8018151047 8018150411 Bacteria 5549903
627 8024501450 8024501048 Bacteria 6427847
628 8056388035 8056382006 Bacteria 6408074
629 Ga0373946_0685994
630 SwRhRL2b_contig_1189119
631 JGI24737J22298_10039113
632 JGI24735J21928_10000694
633 JGI25151J46595_10002216
634 rootH2_10013979
635 rootH2_10020512
636 rootL2_10003492
637 rootL2_10014427
638 rootL2_10275712
639 rootH1_10005886
640 rootH1_10006122
641 rootH1_10030430
642 rootH1_10189449
643 Ga0055537_1000591
644 Ga0055537_1001007
645 Ga0055524_1026364
646 Ga0055534_1000129
647 Ga0055528_1000546
648 Ga0055530_10000834
649 Ga0055530_10083132
650 Ga0055531_10002719
651 Ga0055531_10004707
652 Ga0065704_10080138
653 Ga0065715_10479805
654 Ga0070658_11666947
655 Ga0068869_100069327
656 Ga0070680_100131031
657 Ga0070682_100016576
658 Ga0070660_100196186
659 Ga0070691_10009447
660 Ga0070661_100245736
661 Ga0070668_102194678
662 Ga0070659_100019285
663 Ga0070701_10520722
664 Ga0070705_100102023
665 Ga0070694_100113675
666 Ga0070663_100011608
667 Ga0070678_100278059
668 Ga0070681_10071239
669 Ga0068867_100291237
670 Ga0070679_100027731
671 Ga0068853_100005835
672 Ga0070695_100068652
673 Ga0070693_100016157
674 Ga0070665_100124037
675 Ga0070664_100082956
676 Ga0068857_100073814
677 Ga0068854_100212820
678 Ga0070702_100528385
679 Ga0068852_100009032
680 Ga0068852_100139501
681 Ga0068859_100282590
682 Ga0068859_101511826
683 Ga0068864_100505416
684 Ga0068864_101070847
685 Ga0068861_101152961
686 Ga0068858_100724378
687 Ga0068862_100976965
688 Ga0075365_10391345
689 Ga0075365_10436958
690 Ga0075368_10000330
691 Ga0075368_10212567
692 Ga0075364_10000022
693 Ga0075364_10002855
694 Ga0075364_10518298
695 Ga0075367_10002007
696 Ga0075367_10085051
697 Ga0075367_10353709
698 Ga0075367_10909487
699 Ga0075369_10000533
700 Ga0075369_10002567
701 Ga0075366_10001429
702 Ga0075366_10005515
703 Ga0075366_10152647
704 Ga0075366_10249730
705 Ga0075366_10682106
706 Ga0075370_10000054
707 Ga0075370_10114521
708 Ga0075370_10639923
709 Ga0097620_100282590
710 Ga0097620_101511411
711 Ga0079104_1004220
712 Ga0105251_10000029
713 Ga0105240_10348638
714 Ga0105243_10068610
715 Ga0105248_11437518
716 Ga0105237_10036325
717 Ga0105238_10035562
718 Ga0105239_12543218
719 Ga0157373_10136975
720 Ga0157370_10055090
721 Ga0157370_11219848
722 Ga0157374_10195354
723 Ga0157378_10558321
724 Ga0163162_10366056
725 Ga0157372_10236779
726 Ga0157375_10103761
727 Ga0157375_10313638
728 Ga0157375_11796607
729 Ga0157380_10054256
730 Ga0157379_10247189
731 Ga0157379_10900668
732 Ga0157376_10354427
733 Ga0182006_1191339
734 Ga0182007_10000788
735 Ga0163161_10074887
736 Ga0163161_10092094
737 Ga0163161_10545236
738 Ga0214543_1000003
739 Ga0207425_1048308
740 Ga0209565_1000050
741 Ga0209565_1028375
742 Ga0209673_1000859
743 Ga0209673_1033792
744 Ga0209675_1000007
745 Ga0209676_1000018
746 Ga0209676_1000716
747 Ga0209676_1104216
748 Ga0209025_1000062
749 Ga0209564_1000061
750 Ga0209564_1011921
751 Ga0209050_1000562
752 Ga0209050_1022022
753 Ga0209050_1065007
754 Ga0209256_1003428
755 Ga0209256_1016947
756 Ga0209051_1007254
757 Ga0209257_1000035
758 Ga0209257_1001300
759 Ga0209257_1002553
760 Ga0209257_1020575
761 Ga0207713_1000112
762 Ga0207682_10001290
763 Ga0207682_10031052
764 Ga0207680_10183602
765 Ga0207647_10004846
766 Ga0207645_10585311
767 Ga0207707_10060781
768 Ga0207695_10049462
769 Ga0207695_10245490
770 Ga0207671_10163468
771 Ga0207660_10078141
772 Ga0207662_10790432
773 Ga0207657_10207932
774 Ga0207649_10170107
775 Ga0207652_10214136
776 Ga0207644_10120861
777 Ga0207709_10128260
778 Ga0207709_10647484
779 Ga0207711_10285980
780 Ga0207689_10114665
781 Ga0207679_10390098
782 Ga0207679_10492717
783 Ga0207667_10982150
784 Ga0207668_11697237
785 Ga0207658_10061941
786 Ga0207677_10402120
787 Ga0207703_10165825
788 Ga0207639_10035093
789 Ga0207678_10001716
790 Ga0207702_10236738
791 Ga0207648_10243037
792 Ga0207676_10500380
793 Ga0207676_11193615
794 Ga0207674_10082431
795 Ga0207675_100162321
796 Ga0207675_100382843
797 Ga0207683_10009322
798 Ga0209281_1000332
799 Ga0209371_1001542
800 Ga0209813_10000092
801 Ga0209974_10023613
802 Ga0268266_10171365
803 Ga0268266_12363389
804 Ga0268256_1031220
805 Ga0265328_10007359
806 Ga0265327_10000147
807 Ga0307513_10030116
808 Ga0307513_10506407
809 Ga0307405_10000918
810 Ga0307409_100930960
811 Ga0307409_101207978
812 Ga0307416_100548068
813 Ga0307414_10181354
814 Ga0307411_10279734
815 Ga0373935_0982501
816 Ga0395898_0052130
817 Ga0439465_0235346
818 Ga0451797_0542997
819 Ga0451804_0477314
820 Ga0451833_0114529
821 Ga0451837_0097586
822 Ga0451837_0313458
823 Ga0451839_0447087
824 Ga0451843_1531609
825 Ga0439433_0049165
826 Ga0439432_000838
827 Ga0439449_0004268
828 Ga0450915_016376
829 Ga0439459_0016280
830 Ga0466963_0000912
831 Ga0466964_0185865
832 Ga0453684_0511605
833 Ga0466970_0102844
834 Ga0466959_0277801
835 Ga0466958_0101421
836 Ga0466967_0131623
837 Ga0495627_176446
838 Ga0495650_0001132
839 Ga0495650_0034519
840 Ga0495607_0100318
841 Ga0495583_0003433
842 Ga0495606_0080537
843 Ga0495606_0283420
844 Ga0495610_0002834
845 Ga0495610_0002893
846 Ga0495616_0423507
847 Ga0495620_0028628
848 Ga0495628_0091841
849 Ga0495643_0000509
850 Ga0495643_0051616
851 Ga0495663_0001346
852 Ga0495654_0000080
853 Ga0495667_0139561
854 Ga0495668_0318292
855 Ga0495658_0147738
856 Ga0495670_0462939
857 Ga0495671_0186115
858 Ga0495674_0053452
859 Ga0495672_0000002
860 Ga0495672_0000355
861 Ga0495672_0008236
862 Ga0495679_122940
863 Ga0495673_0065076
864 Ga0495686_0000021
865 Ga0495686_0013246
866 Ga0496100_0261998
867 Ga0496100_0287351
868 Ga0496101_0059267
869 Ga0496101_0586597
870 Ga0496102_0176911
871 Ga0496102_0365872
872 Ga0496102_0961633
873 Ga0496103_0027051
874 Ga0496104_0081202
875 Ga0496104_0085211
876 Ga0496104_1073859
877 Ga0496105_0047136
878 Ga0496105_0181176
879 Ga0496105_0389704
880 Ga0496105_0545405
881 Ga0496106_0065006
882 Ga0496107_0055747
883 Ga0496107_0442638
884 Ga0496108_0034345
885 Ga0496109_0153683
886 Ga0496110_0417501
887 Ga0496111_0397228
888 Ga0496114_0064996
889 Ga0496114_0295223
890 Ga0496114_0359004
891 Ga0496115_0104349
892 Ga0496115_0273139
893 Ga0496116_0122568
894 Ga0496116_0158348
895 Ga0496117_0019831
896 Ga0496118_0000692
897 Ga0496118_0057336
898 Ga0496118_0070020
899 Ga0496121_0000190
900 Ga0496121_0007470
901 Ga0496121_0107254
902 Ga0496121_0159568
903 Ga0496121_0220269
904 Ga0496121_0339601
905 Ga0496122_0151578
906 Ga0496123_0059633
907 Ga0496123_0280741
908 Ga0496124_0005662
909 Ga0496124_0093271
910 Ga0496124_0148735
911 Ga0496124_0220111
912 Ga0496125_0004808
913 Ga0496125_0153231
914 Ga0496126_0027270
915 Ga0496126_0064155
916 Ga0496126_0094332
917 Ga0496126_0166894
918 Ga0495678_025628
919 Ga0495678_116533
920 Ga0501031_0422083
921 Ga0501032_0816024
922 Ga0501033_0005536
923 Ga0501034_0084714
924 Ga0501034_0113961
925 Ga0501034_0439655
926 Ga0501034_0905632
927 Ga0501036_0331572
928 Ga0501043_0013507
929 Ga0501043_0134394
930 Ga0501043_0349780
931 Ga0501047_0010908
932 Ga0501047_0028286
933 Ga0501047_0627933
934 Ga0501074_0217987
935 Ga0501238_009713
936 Ga0501080_0011592
937 Ga0501035_0006507
938 Ga0501044_0154031
939 Ga0501044_0170354
940 Ga0501044_0246972
941 nmdc:mga03683_1897_c2
942 nmdc:mga03n38_11652_c1
943 nmdc:mga03n38_854115_c1
944 nmdc:mga00v17_214_c1
945 nmdc:mga00v17_91_c1
946 nmdc:mga0yw44_201841_c1
947 nmdc:mga0yw44_229367_c1
948 nmdc:mga0yw44_248657_c2
949 nmdc:mga0yw44_727_c2
950 nmdc:mga0k408_566_c2
951 nmdc:mga0k408_79218_c1
952 nmdc:mga0k408_799742_c1
953 nmdc:mga06z11_24916_c1
954 nmdc:mga06z11_48_c1
955 nmdc:mga06z11_62457_c1
956 nmdc:mga06z11_766419_c1
957 nmdc:mga04h51_57_c1
958 nmdc:mga07m45_318_c1
959 nmdc:mga07m45_4447_c1
960 nmdc:mga07m45_77822_c1
961 nmdc:mga0sz30_34_c1
962 nmdc:mga0sz30_4012_c2
963 nmdc:mga0sz30_74976_c1
964 Ga0500583_0037433
965 Ga0500583_0050988
966 Ga0500595_085413
967 Ga0500607_000293
968 Ga0500577_0167791
969 Ga0500634_0009498
970 Ga0500645_028765
971 Ga0500565_012222
972 Ga0466962_0085681
973 2509374507
974 2510306599
975 2511500962
976 2513583500
977 2513617651
978 2513672509
979 2513882713
980 2513905258
981 2516892243
982 2537876750
983 2551676422
984 2551687221
985 2551694403
986 2551703176
987 2551712363
988 2551720684
989 2551732606
990 2551740392
991 2558863534
992 2574430553
993 2585201048
994 2585256173
995 2585843947
996 2616292272
997 2644363004
998 2650898988
999 2671117984
1000 2686353372
1001 2692319446
1002 2719665791
1003 2720492211
1004 2720620351
1005 2720631775
1006 2720775503
1007 2723560734
1008 2723567322
1009 2724090110
1010 2724104587
1011 2724110388
1012 2739649609
1013 2740028082
1014 2747950689
1015 2765571604
1016 2778177100
1017 2809129384
1018 2809149561
1019 2819608624
1020 2819613680
1021 2819621290
1022 2838018020
1023 2838053552
1024 2838065618
1025 2838074333
1026 2838674422
1027 2838676367
1028 2838706950
1029 2838715250
1030 2838720950
1031 2838726008
1032 2839994920
1033 2841847908
1034 2841859567
1035 2842126062
1036 2842131261
1037 2842151478
1038 2842153569
1039 2842171493
1040 2842177189
1041 2842188358
1042 2842212669
1043 2842225712
1044 2842256616
1045 2842265854
1046 2842285946
1047 2842314427
1048 2842317726
1049 2842403305
1050 2842409322
1051 2842415975
1052 2842427552
1053 2842429509
1054 2842436122
1055 2842442469
1056 2842450762
1057 2842463930
1058 2842470451
1059 2842486142
1060 2842490216
1061 2842516352
1062 2842760514
1063 2847422052
1064 2847799849
1065 2848997030
1066 2850080427
1067 2852388203
1068 2852619712
1069 2852656982
1070 2855831313
1071 2855840438
1072 2858800966
1073 2885433086
1074 2891373984
1075 2894656382
1076 2903775978
1077 2915990904
1078 2915996270
1079 2916005748
1080 2916010917
1081 2916016554
1082 2916024753
1083 2916038155
1084 2916047917
1085 2916054362
1086 2916055367
1087 2916073449
1088 2916078177
1089 2919708917
1090 2920761572
1091 2921204931
1092 2921213521
1093 2921241613
1094 2921247525
1095 2921261600
1096 2921264244
1097 2921282759
1098 2921290139
1099 2921303398
1100 2924145609
1101 2924157261
1102 2924160564
1103 2924168160
1104 2924173407
1105 2924186323
1106 2924189503
1107 2924198239
1108 2924204068
1109 2924209900
1110 2924215185
1111 2924226238
1112 2924234925
1113 2926756388
1114 2928109198
1115 2928136421
1116 2928503798
1117 2928522018
1118 2933008212
1119 2933013007
1120 2933604790
1121 2937009523
1122 2937010877
1123 2937018994
1124 2937027934
1125 2937048980
1126 2937056293
1127 2937063364
1128 2937070634
1129 2937072168
1130 2937095580
1131 2937103644
1132 2937112553
1133 2937118183
1134 2937121176
1135 2937129810
1136 2941493736
1137 2954014623
1138 2957385078
1139 2957389141
1140 2957396397
1141 2957405457
1142 2957413260
1143 2957419189
1144 2957427724
1145 2957431100
1146 2957446663
1147 2957454181
1148 2957457612
1149 2957467757
1150 2957477799
1151 2957480637
1152 2957485799
1153 2957495985
1154 2957501027
1155 2957509583
1156 2960586635
1157 2960600584
1158 2960609484
1159 2960616720
1160 2960617694
1161 2960629777
1162 2960640198
1163 2960648737
1164 2960659495
1165 2960666395
1166 2960673916
1167 2960678823
1168 2960692070
1169 2961067309
1170 2964609721
1171 2964620710
1172 2964627798
1173 2964633126
1174 2964637206
1175 2964646152
1176 2964653094
1177 2964661893
1178 2964665981
1179 2964671695
1180 2964678978
1181 2964688099
1182 2964695832
1183 2964703604
1184 2964706165
1185 2964716290
1186 2964726466
1187 2967667362
1188 2967672153
1189 2967678916
1190 2967693236
1191 2967704249
1192 2967712939
1193 2967716538
1194 2967724577
1195 2967737589
1196 2967747864
1197 2967752114
1198 2967757725
1199 2967763810
1200 2967770783
1201 2967782168
1202 2970026062
1203 2970037793
1204 2970043294
1205 2970049929
1206 2970059617
1207 2970065303
1208 2970075674
1209 2970076978
1210 2970085657
1211 2970093299
1212 2970096804
1213 2970108555
1214 2970109828
1215 2970117977
1216 2970129509
1217 2970143159
1218 2970153823
1219 2970162815
1220 2970167495
1221 2970171785
1222 2970184113
1223 2970185135
1224 2970198333
1225 2974307367
1226 2977242959
1227 2977248117
1228 2977523658
1229 2977527646
1230 2977537980
1231 2977551978
1232 2977561681
1233 2977568973
1234 2977578970
1235 2977581503
1236 2984496660
1237 2984517430
1238 2990262077
1239 648736357
1240 8003992935
1241 8005285300
1242 8005385432
1243 8005396576
1244 8005431733
1245 8005484727
1246 8005500523
1247 8005621901
1248 8005627143
1249 8005646142
1250 8005649420
1251 8005662721
1252 8005671941
1253 8018130108
1254 8018151047
1255 8024501450
1256 8056388035

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

7

115

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i9d-assembly1.cif.gz_A arsenate reductase from e. coli 0.981 4 138
1sd8-assembly1.cif.gz_A arsenate reductase r60k mutant from e. coli 0.9803 4 138
1s3d-assembly1.cif.gz_A arsenate reductase r60a mutant from e. coli 0.9799 4 138
1s3c-assembly1.cif.gz_A arsenate reductase c12s mutant from e. coli 0.9794 4 138
1sjz-assembly1.cif.gz_A arsenate reductase r60k mutant +0.4m arsenite from e. coli 0.9725 4 138
ID Description Score Start End Superfamily
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.971 4 138 3.40.30.10
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9502 4 138 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9381 4 112 3.40.30.10
af_O45352_10_98_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.9054 4 33 3.80.10.10
3zmkC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9 4 32 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6M5JE52-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.003 3 113 GO:0008794
GO:0046685
AF-A0A4Q0GRZ3-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.002 1 140 GO:0008794
GO:0046685
AF-A0A659UVR1-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.001 4 116 GO:0008794
GO:0046685
AF-N0BHG6-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1 4 116 GO:0008794
GO:0046685
AF-A0A527ZCM3-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9998 4 115 GO:0008794
GO:0046685

Map