F470677

General Info

Members Datasets Scaffolds Average Seq Length
628 247 612 332

Family's Representative Sequence

Representative Sequence 3300048904|Ga0496101_0095289|Ga0496101_0095289_754_1905
Length 383
Sequence MLLIAKMKSSNSLQNRDFYTQSMLAGGVAGRHSISHRRDIGAAHQGHSKQMAAQNNAPLPEGLNVAGYRIVRKIAAGGFSIVYLAQDDEGKPVAIKEYLPSSLALRKSGELAPLVAPENLPVFRIGLKCFFEEGRALARINHPNVVSVQNFFRAHDTVYMVMAYEHGRSLQDHILRRRERGEKPLVSERFIRKMFSQVMQGLREVHASKLLHLDLKPANIYLRQDGTPILLDFGAARQTLRADLPKLYPMYTPGFAPPELYTRGGSLGPWSDIYSIGASMFACMVGAPPQPADQRLKNDRMEHHYDKLHGVYSPELIEVIRWCLLTDPLRRPQSVFALQKALRQELQEPAPAPDLLTRMKRQLRAMLGTKREPDPDTIQENTR

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
3 2643221645 Massilia sp. Root351 Isolate Unclassified
4 2643221664 Massilia sp. Root418 Isolate Unclassified
5 2643221684 Massilia sp. Root133 Isolate Unclassified
6 2738541280 Massilia sp. GV090 Isolate Unclassified
7 2738541300 Massilia sp. GV016 Isolate Unclassified
8 2738541357 Duganella sp. GV053 Isolate Unclassified
9 2738543003 Duganella sp. GV066 Isolate Unclassified
10 2738543018 Massilia sp. GV045 Isolate Unclassified
11 2738543026 Duganella sp. GV089 Isolate Unclassified
12 2738543029 Duganella sp. GV039 Isolate Unclassified
13 2738543030 Massilia sp. GV097 Isolate Unclassified
14 2818991436 Collimonas arenae 515 Isolate Unclassified
15 2842711865 Duganella sp. R-73148 Isolate Unclassified
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
18 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
25 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
89 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
100 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
101 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
102 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
121 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
195 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
202 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
221 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
226 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
230 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
231 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
234 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
240 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
241 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
242 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
243 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
244 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
247 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 0.32
Isolates 2.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.55
Nodule 0.32
Rhizoplane 4.62
Rhizosphere 79.78
Stem 0
Stem Tuber 0
Unclassified 5.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000142 3300002737 Bacteria 77413
2 JGI25164J39214_1005747 3300002772 Bacteria 1331
3 JGI25150J39212_1003312 3300002774 Bacteria 3794
4 JGI25165J46597_1000064 3300003214 Bacteria 199878
5 JGI25153J46596_10012733 3300003215 Bacteria 3604
6 rootL2_10020589 3300003322 Bacteria 3300
7 Ga0055538_1000031 3300003751 Bacteria 199878
8 Ga0055539_1000041 3300003752 Bacteria 199878
9 Ga0055533_1000051 3300003756 Bacteria 199878
10 Ga0055525_1000061 3300003759 Bacteria 199878
11 Ga0055525_1000105 3300003759 Bacteria 134026
12 Ga0055529_1000185 3300003763 Bacteria 85584
13 Ga0055529_1000208 3300003763 Bacteria 77951
14 Ga0055526_1000077 3300003771 Bacteria 92111
15 Ga0055526_1000094 3300003771 Bacteria 80954
16 Ga0055537_1000072 3300003773 Bacteria 73276
17 Ga0055524_1000007 3300003775 Bacteria 298766
18 Ga0055524_1007445 3300003775 Bacteria 4645
19 Ga0055534_1000136 3300003784 Bacteria 55242
20 Ga0055528_1000444 3300003790 Bacteria 33075
21 Ga0055528_1013615 3300003790 Bacteria 3069
22 Ga0055541_1000028 3300003841 Bacteria 199878
23 Ga0065165_1000094 3300005262 Bacteria 146099
24 Ga0065165_1019534 3300005262 Bacteria 2414
25 Ga0070658_10247655 3300005327 Bacteria 1511
26 Ga0070661_100023134 3300005344 Bacteria 4452
27 Ga0070661_100256992 3300005344 Bacteria 1349
28 Ga0070659_100011305 3300005366 Bacteria 6599
29 Ga0070659_100059051 3300005366 Bacteria 3028
30 Ga0070659_100136553 3300005366 Bacteria 1994
31 Ga0070663_100260239 3300005455 Bacteria 1376
32 Ga0070662_100204216 3300005457 Bacteria 1569
33 Ga0070664_100025715 3300005564 Bacteria 4881
34 Ga0068851_10067893 3300005834 Bacteria 1840
35 Ga0099826_10000003 3300006948 Bacteria 1067817
36 Ga0105244_10000758 3300009036 Bacteria 27588
37 Ga0105243_10018589 3300009148 Bacteria 5267
38 Ga0105241_10081152 3300009174 Bacteria 2540
39 Ga0105242_10056058 3300009176 Bacteria 3225
40 Ga0105238_10124508 3300009551 Bacteria 2557
41 Ga0157374_10359510 3300013296 Bacteria 1448
42 Ga0157378_10114933 3300013297 Bacteria 2473
43 Ga0157372_10759683 3300013307 Bacteria 1127
44 Ga0182008_10015478 3300014497 Bacteria 3979
45 Ga0182008_10075216 3300014497 Bacteria 1662
46 Ga0182006_1010376 3300015261 Bacteria 4143
47 Ga0182007_10008464 3300015262 Bacteria 4224
48 Ga0182005_1000656 3300015265 Bacteria 16502
49 Ga0163161_10208808 3300017792 Bacteria 1508
50 Ga0213872_10000002 3300021361 Bacteria 554092
51 Ga0213872_10000290 3300021361 Bacteria 42933
52 Ga0213872_10000317 3300021361 Bacteria 41076
53 Ga0209760_101300 3300025207 Bacteria 2713
54 Ga0209784_100039 3300025224 Bacteria 232021
55 Ga0209566_100023 3300025225 Bacteria 396571
56 Ga0209674_100040 3300025226 Bacteria 396571
57 Ga0209563_100007 3300025230 Bacteria 1579402
58 Ga0209563_100072 3300025230 Bacteria 232021
59 Ga0207427_100911 3300025231 Bacteria 12741
60 Ga0209437_100097 3300025233 Bacteria 232021
61 Ga0207425_1000001 3300025245 Bacteria 2525432
62 Ga0207425_1000322 3300025245 Bacteria 34215
63 Ga0209646_1000028 3300025246 Bacteria 387986
64 Ga0209026_1001916 3300025250 Bacteria 8424
65 Ga0209026_1005238 3300025250 Bacteria 3540
66 Ga0209677_100041 3300025253 Bacteria 232021
67 Ga0209148_1000476 3300025254 Bacteria 42273
68 Ga0209129_1000001 3300025258 Bacteria 1452436
69 Ga0209233_1000122 3300025261 Bacteria 232021
70 Ga0209565_1000009 3300025263 Bacteria 751701
71 Ga0209565_1000705 3300025263 Bacteria 20479
72 Ga0209455_1000049 3300025272 Bacteria 374414
73 Ga0209673_1000036 3300025273 Bacteria 323162
74 Ga0209130_1000455 3300025284 Bacteria 43009
75 Ga0209675_1000013 3300025291 Bacteria 448220
76 Ga0209564_1000009 3300025295 Bacteria 950196
77 Ga0209564_1000045 3300025295 Bacteria 376549
78 Ga0209564_1000240 3300025295 Bacteria 118922
79 Ga0209758_1000230 3300025297 Bacteria 119426
80 Ga0209758_1000945 3300025297 Bacteria 39123
81 Ga0209256_1000005 3300025299 Bacteria 1315082
82 Ga0209256_1000052 3300025299 Bacteria 299374
83 Ga0209256_1000763 3300025299 Bacteria 41818
84 Ga0207426_1043432 3300025302 Bacteria 1381
85 Ga0209051_1025729 3300025303 Bacteria 2387
86 Ga0207655_1008380 3300025728 Bacteria 6571
87 Ga0207705_10017834 3300025909 Bacteria 5076
88 Ga0207657_10036548 3300025919 Bacteria 4395
89 Ga0207657_10036676 3300025919 Bacteria 4386
90 Ga0207690_10005549 3300025932 Bacteria 7448
91 Ga0207686_10061779 3300025934 Bacteria 2376
92 Ga0207709_10107360 3300025935 Bacteria 1859
93 Ga0207689_10098001 3300025942 Bacteria 2408
94 Ga0207667_10045284 3300025949 Bacteria 4661
95 Ga0209282_1000002 3300027666 Bacteria 1067825
96 Ga0316181_1218906 3300030744 Bacteria 3752
97 Ga0307408_100000182 3300031548 Bacteria 69692
98 Ga0307408_100000200 3300031548 Bacteria 65177
99 Ga0307408_100036740 3300031548 Bacteria 3445
100 Ga0265314_10089927 3300031711 Bacteria 2001
101 Ga0307416_100009909 3300032002 Bacteria 6267
102 Ga0395899_0000449 3300037312 Bacteria 47070
103 Ga0395899_0000473 3300037312 Bacteria 45449
104 Ga0395899_0001163 3300037312 Bacteria 23230
105 Ga0395899_0004316 3300037312 Bacteria 11101
106 Ga0395899_0120471 3300037312 Bacteria 1880
107 Ga0395899_0263643 3300037312 Bacteria 1177
108 Ga0395899_0280895 3300037312 Bacteria 1132
109 Ga0395900_0000928 3300037418 Bacteria 38433
110 Ga0395900_0009234 3300037418 Bacteria 10113
111 Ga0395900_0030934 3300037418 Bacteria 5498
112 Ga0395900_0047818 3300037418 Bacteria 4406
113 Ga0395900_0057430 3300037418 Bacteria 4006
114 Ga0395900_0141660 3300037418 Bacteria 2462
115 Ga0395898_0072224 3300037466 Bacteria 3334
116 Ga0395898_0126321 3300037466 Bacteria 2450
117 Ga0395898_0153570 3300037466 Bacteria 2202
118 Ga0395898_0424742 3300037466 Bacteria 1266
119 Ga0395905_0003794 3300037471 Bacteria 15978
120 Ga0395905_0005821 3300037471 Bacteria 12528
121 Ga0395905_0006637 3300037471 Bacteria 11602
122 Ga0395905_0133328 3300037471 Bacteria 2336
123 Ga0395905_0293611 3300037471 Bacteria 1512
124 Ga0395901_0000082 3300038443 Bacteria 130230
125 Ga0395901_0029900 3300038443 Bacteria 5611
126 Ga0436361_0570400 3300039447 Bacteria 111725
127 Ga0436361_0750950 3300039447 Bacteria 14740
128 Ga0436361_1079056 3300039447 Bacteria 2348
129 Ga0436361_1086294 3300039447 Bacteria 1204
130 Ga0439448_0000170 3300042005 Bacteria 13099
131 Ga0439449_0053711 3300042007 Bacteria 1489
132 Ga0439449_0067468 3300042007 Bacteria 1319
133 Ga0439450_006683 3300042008 Bacteria 2086
134 Ga0450904_000028 3300042139 Bacteria 33382
135 Ga0451577_0003395 3300042876 Bacteria 17797
136 Ga0451577_0008544 3300042876 Bacteria 9960
137 Ga0451577_0011087 3300042876 Bacteria 8555
138 Ga0466969_0116992 3300044656 Bacteria 1243
139 Ga0466972_0000005 3300044658 Bacteria 289640
140 Ga0466972_0016043 3300044658 Bacteria 3745
141 Ga0466965_0011911 3300044683 Bacteria 4082
142 Ga0466966_0007622 3300044684 Bacteria 7171
143 Ga0466966_0081906 3300044684 Bacteria 2008
144 Ga0466961_0042840 3300044693 Bacteria 2900
145 Ga0466963_0328852 3300044694 Bacteria 1076
146 Ga0466964_0001134 3300044706 Bacteria 8977
147 Ga0466964_0003974 3300044706 Bacteria 5435
148 Ga0466964_0009763 3300044706 Bacteria 3616
149 Ga0466964_0019022 3300044706 Bacteria 2639
150 Ga0453684_0339964 3300044712 Bacteria 1695
151 Ga0466971_0066512 3300044719 Bacteria 1633
152 Ga0466968_0003420 3300044735 Bacteria 5870
153 Ga0466968_0120286 3300044735 Bacteria 1188
154 Ga0466957_0142951 3300044842 Bacteria 1542
155 Ga0466960_0031934 3300044901 Bacteria 2433
156 Ga0466959_0093824 3300045049 Bacteria 2153
157 Ga0451576_0012129 3300045051 Bacteria 9719
158 Ga0451576_0330678 3300045051 Bacteria 1595
159 Ga0466958_0048776 3300045836 Bacteria 2560
160 Ga0466967_0063852 3300045976 Bacteria 3273
161 Ga0466967_0116903 3300045976 Bacteria 2457
162 Ga0495617_000008 3300046452 Bacteria 340369
163 Ga0495627_000875 3300046453 Bacteria 21309
164 Ga0495627_005949 3300046453 Bacteria 4847
165 Ga0495592_0042886 3300046454 Bacteria 3387
166 Ga0495603_0004305 3300046455 Bacteria 8486
167 Ga0495603_0056221 3300046455 Bacteria 2330
168 Ga0495590_0000003 3300046457 Bacteria 478593
169 Ga0495590_0017832 3300046457 Bacteria 2547
170 Ga0495590_0021572 3300046457 Bacteria 2282
171 Ga0495629_0011641 3300046459 Bacteria 6386
172 Ga0495629_0157898 3300046459 Bacteria 1575
173 Ga0495638_0000118 3300046460 Bacteria 127657
174 Ga0495638_0009676 3300046460 Bacteria 6739
175 Ga0495638_0046754 3300046460 Bacteria 2717
176 Ga0495638_0061139 3300046460 Bacteria 2328
177 Ga0495638_0186030 3300046460 Bacteria 1181
178 Ga0495651_0190560 3300046462 Bacteria 1443
179 Ga0495653_0005746 3300046463 Bacteria 10149
180 Ga0495653_0026978 3300046463 Bacteria 4600
181 Ga0495653_0026997 3300046463 Bacteria 4597
182 Ga0495653_0069337 3300046463 Bacteria 2642
183 Ga0495650_0000015 3300046471 Bacteria 557595
184 Ga0495650_0000131 3300046471 Bacteria 174698
185 Ga0495650_0000147 3300046471 Bacteria 160862
186 Ga0495650_0000195 3300046471 Bacteria 131338
187 Ga0495650_0000235 3300046471 Bacteria 111830
188 Ga0495650_0000544 3300046471 Bacteria 53879
189 Ga0495650_0019508 3300046471 Bacteria 3333
190 Ga0495650_0026734 3300046471 Bacteria 2677
191 Ga0495580_0123057 3300046472 Bacteria 1800
192 Ga0495582_0018513 3300046473 Bacteria 3808
193 Ga0495582_0056565 3300046473 Bacteria 2162
194 Ga0495605_0000003 3300046474 Bacteria 491502
195 Ga0495605_0000083 3300046474 Bacteria 124953
196 Ga0495605_0000217 3300046474 Bacteria 71011
197 Ga0495605_0021532 3300046474 Bacteria 3413
198 Ga0495605_0057093 3300046474 Bacteria 1880
199 Ga0495605_0105844 3300046474 Bacteria 1288
200 Ga0495584_0000342 3300046491 Bacteria 32246
201 Ga0495584_0004000 3300046491 Bacteria 7954
202 Ga0495584_0009374 3300046491 Bacteria 5042
203 Ga0495584_0017257 3300046491 Bacteria 3677
204 Ga0495584_0024923 3300046491 Bacteria 3033
205 Ga0495584_0028659 3300046491 Bacteria 2822
206 Ga0495584_0042297 3300046491 Bacteria 2299
207 Ga0495584_0049555 3300046491 Bacteria 2116
208 Ga0495584_0051070 3300046491 Bacteria 2082
209 Ga0495584_0098128 3300046491 Bacteria 1480
210 Ga0495585_0000528 3300046492 Bacteria 36112
211 Ga0495585_0000632 3300046492 Bacteria 32470
212 Ga0495585_0002112 3300046492 Bacteria 14531
213 Ga0495585_0008887 3300046492 Bacteria 6061
214 Ga0495585_0010467 3300046492 Bacteria 5516
215 Ga0495585_0080828 3300046492 Bacteria 1761
216 Ga0495585_0105500 3300046492 Bacteria 1503
217 Ga0495594_0007123 3300046499 Bacteria 5752
218 Ga0495594_0036485 3300046499 Bacteria 2680
219 Ga0495594_0039696 3300046499 Bacteria 2574
220 Ga0495594_0092277 3300046499 Bacteria 1697
221 Ga0495596_0001508 3300046500 Bacteria 13314
222 Ga0495596_0018135 3300046500 Bacteria 2904
223 Ga0495596_0018406 3300046500 Bacteria 2879
224 Ga0495596_0021114 3300046500 Bacteria 2660
225 Ga0495596_0022613 3300046500 Bacteria 2559
226 Ga0495596_0033426 3300046500 Bacteria 2046
227 Ga0495607_0003020 3300046501 Bacteria 13134
228 Ga0495607_0003492 3300046501 Bacteria 12024
229 Ga0495607_0006266 3300046501 Bacteria 8388
230 Ga0495607_0013880 3300046501 Bacteria 5264
231 Ga0495607_0030707 3300046501 Bacteria 3296
232 Ga0495607_0044573 3300046501 Bacteria 2614
233 Ga0495607_0044638 3300046501 Bacteria 2612
234 Ga0495607_0088126 3300046501 Bacteria 1687
235 Ga0495607_0162938 3300046501 Bacteria 1131
236 Ga0495583_0000049 3300046506 Bacteria 216069
237 Ga0495583_0000079 3300046506 Bacteria 169681
238 Ga0495583_0000165 3300046506 Bacteria 111940
239 Ga0495583_0006440 3300046506 Bacteria 7677
240 Ga0495583_0009396 3300046506 Bacteria 5846
241 Ga0495583_0010706 3300046506 Bacteria 5324
242 Ga0495583_0024874 3300046506 Bacteria 3000
243 Ga0495583_0104143 3300046506 Bacteria 1208
244 Ga0495606_0000185 3300046507 Bacteria 109977
245 Ga0495606_0000284 3300046507 Bacteria 88119
246 Ga0495606_0000345 3300046507 Bacteria 79767
247 Ga0495606_0000420 3300046507 Bacteria 70941
248 Ga0495606_0001704 3300046507 Bacteria 28383
249 Ga0495606_0005995 3300046507 Bacteria 11391
250 Ga0495606_0008707 3300046507 Bacteria 8739
251 Ga0495606_0014205 3300046507 Bacteria 6231
252 Ga0495606_0061536 3300046507 Bacteria 2400
253 Ga0495606_0073284 3300046507 Bacteria 2149
254 Ga0495606_0105644 3300046507 Bacteria 1706
255 Ga0495608_0003435 3300046511 Bacteria 11346
256 Ga0495610_0000004 3300046512 Bacteria 1006135
257 Ga0495610_0008234 3300046512 Bacteria 6791
258 Ga0495610_0038196 3300046512 Bacteria 2438
259 Ga0495616_0000050 3300046513 Bacteria 108049
260 Ga0495616_0001970 3300046513 Bacteria 13823
261 Ga0495616_0005062 3300046513 Bacteria 8201
262 Ga0495616_0006157 3300046513 Bacteria 7307
263 Ga0495616_0008372 3300046513 Bacteria 6134
264 Ga0495616_0037179 3300046513 Bacteria 2506
265 Ga0495618_0014933 3300046514 Bacteria 4736
266 Ga0495628_0002806 3300046516 Bacteria 15641
267 Ga0495630_0005242 3300046517 Bacteria 9139
268 Ga0495630_0057447 3300046517 Bacteria 2916
269 Ga0495631_0000987 3300046518 Bacteria 17648
270 Ga0495631_0006001 3300046518 Bacteria 6316
271 Ga0495631_0007504 3300046518 Bacteria 5545
272 Ga0495631_0011111 3300046518 Bacteria 4438
273 Ga0495631_0014350 3300046518 Bacteria 3826
274 Ga0495631_0019461 3300046518 Bacteria 3183
275 Ga0495631_0046675 3300046518 Bacteria 1903
276 Ga0495631_0062996 3300046518 Bacteria 1606
277 Ga0495632_0000366 3300046519 Bacteria 43010
278 Ga0495632_0003798 3300046519 Bacteria 10539
279 Ga0495632_0077163 3300046519 Bacteria 1593
280 Ga0495637_0002176 3300046520 Bacteria 10961
281 Ga0495637_0003764 3300046520 Bacteria 8004
282 Ga0495637_0011742 3300046520 Bacteria 4201
283 Ga0495643_0000505 3300046522 Bacteria 48848
284 Ga0495643_0001311 3300046522 Bacteria 23623
285 Ga0495643_0005672 3300046522 Bacteria 8365
286 Ga0495643_0007665 3300046522 Bacteria 6923
287 Ga0495643_0010359 3300046522 Bacteria 5741
288 Ga0495643_0020093 3300046522 Bacteria 3857
289 Ga0495643_0024033 3300046522 Bacteria 3459
290 Ga0495643_0064122 3300046522 Bacteria 1941
291 Ga0495643_0067657 3300046522 Bacteria 1881
292 Ga0495643_0124407 3300046522 Bacteria 1300
293 Ga0495644_0000141 3300046523 Bacteria 34630
294 Ga0495644_0011914 3300046523 Bacteria 3343
295 Ga0495644_0021457 3300046523 Bacteria 2464
296 Ga0495644_0054740 3300046523 Bacteria 1498
297 Ga0495644_0086800 3300046523 Bacteria 1179
298 Ga0495644_0106684 3300046523 Bacteria 1061
299 Ga0495648_0000070 3300046524 Bacteria 136680
300 Ga0495648_0001095 3300046524 Bacteria 27577
301 Ga0495648_0002247 3300046524 Bacteria 18047
302 Ga0495648_0002560 3300046524 Bacteria 16660
303 Ga0495648_0009431 3300046524 Bacteria 7570
304 Ga0495648_0021695 3300046524 Bacteria 4444
305 Ga0495648_0057304 3300046524 Bacteria 2338
306 Ga0495663_0003031 3300046525 Bacteria 4928
307 Ga0495663_0003777 3300046525 Bacteria 4321
308 Ga0495663_0063848 3300046525 Bacteria 1161
309 Ga0495666_0018734 3300046526 Bacteria 3440
310 Ga0495666_0029943 3300046526 Bacteria 2674
311 Ga0495666_0069554 3300046526 Bacteria 1675
312 Ga0495642_0007840 3300046528 Bacteria 4092
313 Ga0495642_0007957 3300046528 Bacteria 4055
314 Ga0495642_0011303 3300046528 Bacteria 3427
315 Ga0495642_0022150 3300046528 Bacteria 2502
316 Ga0495642_0030756 3300046528 Bacteria 2149
317 Ga0495642_0038403 3300046528 Bacteria 1940
318 Ga0495642_0094045 3300046528 Bacteria 1271
319 Ga0495654_0000035 3300046530 Bacteria 192768
320 Ga0495654_0003954 3300046530 Bacteria 8943
321 Ga0495654_0026016 3300046530 Bacteria 3012
322 Ga0495665_0006877 3300046531 Bacteria 6139
323 Ga0495665_0014000 3300046531 Bacteria 4332
324 Ga0495665_0052946 3300046531 Bacteria 2147
325 Ga0495587_0009735 3300046536 Bacteria 6144
326 Ga0495587_0050061 3300046536 Bacteria 2472
327 Ga0495609_0000002 3300046538 Bacteria 739816
328 Ga0495609_0001001 3300046538 Bacteria 20074
329 Ga0495609_0001049 3300046538 Bacteria 19390
330 Ga0495609_0001257 3300046538 Bacteria 17406
331 Ga0495609_0005797 3300046538 Bacteria 6411
332 Ga0495609_0008596 3300046538 Bacteria 4986
333 Ga0495609_0011972 3300046538 Bacteria 4120
334 Ga0495609_0017829 3300046538 Bacteria 3295
335 Ga0495597_0000206 3300046542 Bacteria 53783
336 Ga0495597_0000336 3300046542 Bacteria 42095
337 Ga0495597_0000583 3300046542 Bacteria 30220
338 Ga0495597_0001302 3300046542 Bacteria 18321
339 Ga0495597_0001581 3300046542 Bacteria 16005
340 Ga0495597_0012832 3300046542 Bacteria 4033
341 Ga0495597_0018668 3300046542 Bacteria 3252
342 Ga0495645_0013625 3300046543 Bacteria 5758
343 Ga0495645_0019063 3300046543 Bacteria 4939
344 Ga0495645_0061147 3300046543 Bacteria 2729
345 Ga0495645_0181590 3300046543 Bacteria 1441
346 Ga0495622_0000004 3300046557 Bacteria 258984
347 Ga0495622_0000439 3300046557 Bacteria 26982
348 Ga0495622_0007502 3300046557 Bacteria 5061
349 Ga0495622_0019018 3300046557 Bacteria 3200
350 Ga0495622_0045492 3300046557 Bacteria 2039
351 Ga0495622_0074729 3300046557 Bacteria 1562
352 Ga0495622_0098601 3300046557 Bacteria 1340
353 Ga0495633_0000164 3300046558 Bacteria 87086
354 Ga0495633_0000543 3300046558 Bacteria 37615
355 Ga0495633_0000586 3300046558 Bacteria 35284
356 Ga0495633_0015637 3300046558 Bacteria 3933
357 Ga0495633_0016589 3300046558 Bacteria 3792
358 Ga0495633_0016848 3300046558 Bacteria 3752
359 Ga0495633_0019156 3300046558 Bacteria 3463
360 Ga0495633_0068731 3300046558 Bacteria 1653
361 Ga0495656_0007797 3300046615 Bacteria 3801
362 Ga0495656_0028796 3300046615 Bacteria 2230
363 Ga0495668_0000094 3300046616 Bacteria 141412
364 Ga0495668_0000168 3300046616 Bacteria 97230
365 Ga0495668_0000817 3300046616 Bacteria 35718
366 Ga0495668_0001384 3300046616 Bacteria 23652
367 Ga0495668_0004225 3300046616 Bacteria 10342
368 Ga0495668_0004743 3300046616 Bacteria 9520
369 Ga0495668_0007391 3300046616 Bacteria 7032
370 Ga0495668_0007896 3300046616 Bacteria 6721
371 Ga0495668_0008044 3300046616 Bacteria 6640
372 Ga0495668_0070132 3300046616 Bacteria 1926
373 Ga0495634_0004336 3300046642 Bacteria 11179
374 Ga0495611_0006398 3300046648 Bacteria 5019
375 Ga0495611_0019321 3300046648 Bacteria 2925
376 Ga0495611_0053112 3300046648 Bacteria 1829
377 Ga0495611_0093532 3300046648 Bacteria 1390
378 Ga0495611_0102177 3300046648 Bacteria 1332
379 Ga0495611_0120758 3300046648 Bacteria 1222
380 Ga0495625_0000038 3300046660 Bacteria 211808
381 Ga0495625_0000916 3300046660 Bacteria 39677
382 Ga0495625_0002151 3300046660 Bacteria 21922
383 Ga0495625_0005938 3300046660 Bacteria 10987
384 Ga0495625_0007321 3300046660 Bacteria 9641
385 Ga0495625_0009931 3300046660 Bacteria 7915
386 Ga0495635_0027357 3300046663 Bacteria 3967
387 Ga0495659_0000031 3300046664 Bacteria 65868
388 Ga0495659_0000720 3300046664 Bacteria 11881
389 Ga0495659_0002794 3300046664 Bacteria 5607
390 Ga0495661_0000364 3300046665 Bacteria 49059
391 Ga0495661_0001138 3300046665 Bacteria 23241
392 Ga0495661_0001818 3300046665 Bacteria 17111
393 Ga0495661_0004336 3300046665 Bacteria 10266
394 Ga0495661_0009595 3300046665 Bacteria 6632
395 Ga0495661_0021194 3300046665 Bacteria 4238
396 Ga0495661_0035837 3300046665 Bacteria 3111
397 Ga0495661_0056331 3300046665 Bacteria 2352
398 Ga0495588_0000067 3300046674 Bacteria 238958
399 Ga0495588_0006100 3300046674 Bacteria 5410
400 Ga0495588_0009883 3300046674 Bacteria 4423
401 Ga0495588_0014112 3300046674 Bacteria 3819
402 Ga0495588_0038366 3300046674 Bacteria 2436
403 Ga0495588_0054963 3300046674 Bacteria 2054
404 Ga0495588_0161848 3300046674 Bacteria 1183
405 Ga0495599_0039513 3300046678 Bacteria 2964
406 Ga0495599_0094709 3300046678 Bacteria 1863
407 Ga0495646_0010988 3300046680 Bacteria 5752
408 Ga0495646_0017130 3300046680 Bacteria 4599
409 Ga0495669_0003891 3300046684 Bacteria 6142
410 Ga0495669_0011457 3300046684 Bacteria 3764
411 Ga0495669_0023817 3300046684 Bacteria 2667
412 Ga0495613_0184507 3300046689 Bacteria 1476
413 Ga0495624_0007465 3300046690 Bacteria 7672
414 Ga0495624_0010581 3300046690 Bacteria 6356
415 Ga0495670_0002112 3300046691 Bacteria 9811
416 Ga0495670_0007570 3300046691 Bacteria 5337
417 Ga0495670_0009893 3300046691 Bacteria 4689
418 Ga0495670_0033938 3300046691 Bacteria 2539
419 Ga0495670_0053102 3300046691 Bacteria 2029
420 Ga0495670_0056897 3300046691 Bacteria 1962
421 Ga0495670_0078210 3300046691 Bacteria 1682
422 Ga0495670_0082312 3300046691 Bacteria 1641
423 Ga0495671_0000001 3300046692 Bacteria 1169494
424 Ga0495671_0000109 3300046692 Bacteria 74002
425 Ga0495671_0001415 3300046692 Bacteria 16132
426 Ga0495671_0003874 3300046692 Bacteria 9095
427 Ga0495671_0037769 3300046692 Bacteria 2441
428 Ga0495671_0140421 3300046692 Bacteria 1177
429 Ga0495649_0001646 3300046694 Bacteria 16617
430 Ga0495649_0008724 3300046694 Bacteria 6081
431 Ga0495649_0021966 3300046694 Bacteria 3573
432 Ga0495589_0000009 3300046794 Bacteria 256265
433 Ga0495589_0000256 3300046794 Bacteria 43404
434 Ga0495589_0001110 3300046794 Bacteria 16053
435 Ga0495589_0009713 3300046794 Bacteria 4998
436 Ga0495589_0014511 3300046794 Bacteria 4055
437 Ga0495589_0025857 3300046794 Bacteria 2975
438 Ga0495589_0070366 3300046794 Bacteria 1710
439 Ga0495600_0000501 3300046809 Bacteria 20345
440 Ga0495600_0010555 3300046809 Bacteria 5735
441 Ga0495600_0056683 3300046809 Bacteria 2560
442 Ga0495660_0000026 3300046810 Bacteria 256223
443 Ga0495660_0000424 3300046810 Bacteria 35801
444 Ga0495660_0006124 3300046810 Bacteria 7142
445 Ga0495660_0030453 3300046810 Bacteria 3039
446 Ga0495660_0052773 3300046810 Bacteria 2208
447 Ga0495660_0123986 3300046810 Bacteria 1303
448 Ga0495581_0035295 3300047315 Bacteria 2894
449 Ga0495581_0102690 3300047315 Bacteria 1661
450 Ga0495604_0006239 3300047317 Bacteria 9458
451 Ga0495604_0077369 3300047317 Bacteria 2500
452 Ga0495636_0001712 3300047318 Bacteria 8365
453 Ga0495636_0002924 3300047318 Bacteria 6607
454 Ga0495636_0003699 3300047318 Bacteria 5948
455 Ga0495674_0002230 3300047319 Bacteria 19056
456 Ga0495674_0132792 3300047319 Bacteria 2097
457 Ga0495672_0000209 3300047320 Bacteria 83909
458 Ga0495672_0000580 3300047320 Bacteria 41398
459 Ga0495672_0000715 3300047320 Bacteria 36439
460 Ga0495672_0000886 3300047320 Bacteria 31476
461 Ga0495672_0001063 3300047320 Bacteria 28042
462 Ga0495672_0012678 3300047320 Bacteria 5866
463 Ga0495676_0038777 3300047321 Bacteria 3954
464 Ga0495676_0088867 3300047321 Bacteria 2316
465 Ga0495676_0105635 3300047321 Bacteria 2076
466 Ga0495680_0044784 3300047322 Bacteria 3497
467 Ga0495683_0022303 3300047323 Bacteria 3256
468 Ga0495683_0044024 3300047323 Bacteria 2245
469 Ga0495683_0056295 3300047323 Bacteria 1956
470 Ga0495683_0098495 3300047323 Bacteria 1408
471 Ga0495687_000013 3300047443 Bacteria 371058
472 Ga0495687_000064 3300047443 Bacteria 163468
473 Ga0495687_000173 3300047443 Bacteria 95361
474 Ga0495687_003092 3300047443 Bacteria 12465
475 Ga0495687_004504 3300047443 Bacteria 9367
476 Ga0495687_005106 3300047443 Bacteria 8507
477 Ga0495687_021270 3300047443 Bacteria 3142
478 Ga0495675_0023854 3300047444 Bacteria 3898
479 Ga0495675_0046046 3300047444 Bacteria 2778
480 Ga0495675_0088057 3300047444 Bacteria 1950
481 Ga0495677_0000142 3300047445 Bacteria 34317
482 Ga0495677_0000264 3300047445 Bacteria 22980
483 Ga0495677_0002086 3300047445 Bacteria 7952
484 Ga0495677_0002485 3300047445 Bacteria 7233
485 Ga0495677_0003780 3300047445 Bacteria 5853
486 Ga0495677_0009206 3300047445 Bacteria 3649
487 Ga0495677_0009557 3300047445 Bacteria 3581
488 Ga0495677_0016317 3300047445 Bacteria 2694
489 Ga0495677_0018826 3300047445 Bacteria 2503
490 Ga0495677_0036067 3300047445 Bacteria 1805
491 Ga0495677_0043930 3300047445 Bacteria 1638
492 Ga0495677_0044391 3300047445 Bacteria 1629
493 Ga0495679_001737 3300047446 Bacteria 12015
494 Ga0495679_003435 3300047446 Bacteria 7617
495 Ga0495685_000096 3300047447 Bacteria 31951
496 Ga0495685_002823 3300047447 Bacteria 5482
497 Ga0495685_003881 3300047447 Bacteria 4796
498 Ga0495685_016346 3300047447 Bacteria 2534
499 Ga0495685_054723 3300047447 Bacteria 1350
500 Ga0495673_0000006 3300047469 Bacteria 908691
501 Ga0495673_0000014 3300047469 Bacteria 599202
502 Ga0495673_0000090 3300047469 Bacteria 188187
503 Ga0495673_0002000 3300047469 Bacteria 14998
504 Ga0495673_0048318 3300047469 Bacteria 1876
505 Ga0495681_0002284 3300047470 Bacteria 13781
506 Ga0495681_0007418 3300047470 Bacteria 7009
507 Ga0495681_0007422 3300047470 Bacteria 7007
508 Ga0495681_0021307 3300047470 Bacteria 3496
509 Ga0495681_0042514 3300047470 Bacteria 2198
510 Ga0495681_0046204 3300047470 Bacteria 2078
511 Ga0495681_0063196 3300047470 Bacteria 1699
512 Ga0495681_0068445 3300047470 Bacteria 1615
513 Ga0495681_0074666 3300047470 Bacteria 1528
514 Ga0495686_0000188 3300047472 Bacteria 115937
515 Ga0495686_0000225 3300047472 Bacteria 104121
516 Ga0495686_0012382 3300047472 Bacteria 5968
517 Ga0495686_0013166 3300047472 Bacteria 5752
518 Ga0495686_0018435 3300047472 Bacteria 4686
519 Ga0495686_0064543 3300047472 Bacteria 2266
520 Ga0495686_0072735 3300047472 Bacteria 2113
521 Ga0495593_0016915 3300047673 Bacteria 4104
522 Ga0495593_0022391 3300047673 Bacteria 3520
523 Ga0495602_0075124 3300048088 Bacteria 2869
524 Ga0495602_0092417 3300048088 Bacteria 2506
525 Ga0495615_0001097 3300048090 Bacteria 3882
526 Ga0495626_0000003 3300048091 Bacteria 427774
527 Ga0495626_0000786 3300048091 Bacteria 28839
528 Ga0495626_0001947 3300048091 Bacteria 15338
529 Ga0495626_0006082 3300048091 Bacteria 6929
530 Ga0495626_0006122 3300048091 Bacteria 6903
531 Ga0495626_0009495 3300048091 Bacteria 5255
532 Ga0495626_0016260 3300048091 Bacteria 3783
533 Ga0495626_0025118 3300048091 Bacteria 2916
534 Ga0495626_0067873 3300048091 Bacteria 1609
535 Ga0496100_0135758 3300048903 Bacteria 1738
536 Ga0496101_0095289 3300048904 Bacteria 2220
537 Ga0496102_0000193 3300048905 Bacteria 83162
538 Ga0496102_0000645 3300048905 Bacteria 35369
539 Ga0496102_0015277 3300048905 Bacteria 6685
540 Ga0496102_0030652 3300048905 Bacteria 4814
541 Ga0496102_0080987 3300048905 Bacteria 2992
542 Ga0496102_0194685 3300048905 Bacteria 1910
543 Ga0496102_0485393 3300048905 Bacteria 1157
544 Ga0496103_0006702 3300048906 Bacteria 6872
545 Ga0496103_0075680 3300048906 Bacteria 2111
546 Ga0496104_0048294 3300048907 Bacteria 4013
547 Ga0496104_0072379 3300048907 Bacteria 3278
548 Ga0496105_0053017 3300048908 Bacteria 3350
549 Ga0496106_0016490 3300048909 Bacteria 5466
550 Ga0496107_0019517 3300048910 Bacteria 4783
551 Ga0496108_0226915 3300048911 Bacteria 1623
552 Ga0496108_0276432 3300048911 Bacteria 1462
553 Ga0496109_0147172 3300048912 Bacteria 2204
554 Ga0496110_0041647 3300048913 Bacteria 4008
555 Ga0496110_0373977 3300048913 Bacteria 1298
556 Ga0496111_0058512 3300048914 Bacteria 2790
557 Ga0496111_0082728 3300048914 Bacteria 2345
558 Ga0496112_0175933 3300048915 Bacteria 2105
559 Ga0496113_0023334 3300048916 Bacteria 4387
560 Ga0496113_0072748 3300048916 Bacteria 2617
561 Ga0496114_0201787 3300048917 Bacteria 1742
562 Ga0496115_0130848 3300048918 Bacteria 2068
563 Ga0496115_0173373 3300048918 Bacteria 1783
564 Ga0496121_0035735 3300048924 Bacteria 4445
565 Ga0496122_0014619 3300048925 Bacteria 7575
566 Ga0496122_0025335 3300048925 Bacteria 5154
567 Ga0496122_0029491 3300048925 Bacteria 4626
568 Ga0496123_0000122 3300048926 Bacteria 158966
569 Ga0496123_0096712 3300048926 Bacteria 1732
570 Ga0496124_0009148 3300048927 Bacteria 10231
571 Ga0496124_0023827 3300048927 Bacteria 5578
572 Ga0496124_0054155 3300048927 Bacteria 3397
573 Ga0496124_0098252 3300048927 Bacteria 2376
574 Ga0496124_0109925 3300048927 Bacteria 2220
575 Ga0496125_0000794 3300048928 Bacteria 51484
576 Ga0496125_0003227 3300048928 Bacteria 20112
577 Ga0496125_0054679 3300048928 Bacteria 3260
578 Ga0496126_0026057 3300048929 Bacteria 5613
579 Ga0496126_0243911 3300048929 Bacteria 1500
580 Ga0496126_0323227 3300048929 Bacteria 1268
581 Ga0495678_000459 3300049459 Bacteria 40493
582 Ga0495678_001277 3300049459 Bacteria 20425
583 Ga0495678_001397 3300049459 Bacteria 19166
584 Ga0495678_002374 3300049459 Bacteria 12907
585 Ga0495678_012020 3300049459 Bacteria 4120
586 Ga0495678_079616 3300049459 Bacteria 1179
587 Ga0495682_0000233 3300049460 Bacteria 43866
588 Ga0495682_0001369 3300049460 Bacteria 13363
589 Ga0495682_0004437 3300049460 Bacteria 6006
590 Ga0495682_0018198 3300049460 Bacteria 2647
591 Ga0501040_0250247 3300049576 Bacteria 1264
592 Ga0501075_0119999 3300049591 Bacteria 2001
593 Ga0501222_002402 3300049662 Bacteria 2599
594 Ga0501235_008184 3300049669 Bacteria 2281
595 Ga0501238_008438 3300049671 Bacteria 1356
596 Ga0501079_0169128 3300049741 Bacteria 1705
597 Ga0501269_000690 3300049766 Bacteria 5653
598 Ga0501279_001231 3300049775 Bacteria 3362
599 Ga0501279_002261 3300049775 Bacteria 2534
600 Ga0501035_0034648 3300049822 Bacteria 4586
601 Ga0501044_0071023 3300049823 Bacteria 3541
602 nmdc:mga03683_31385_c1 3300050489 Bacteria 2131
603 Ga0495601_0024651 3300053077 Bacteria 3705
604 Ga0500572_014149 3300053111 Bacteria 1988
605 Ga0500595_003939 3300053119 Bacteria 6793
606 Ga0500618_000371 3300053125 Bacteria 31102
607 Ga0500586_000357 3300053145 Bacteria 9090
608 Ga0500586_023059 3300053145 Bacteria 1982
609 Ga0500619_001609 3300053154 Bacteria 4060
610 Ga0587077_003071 3300059493 Bacteria 2065
611 Ga0587067_010682 3300059640 Bacteria 1397
612 Ga0466962_0069537 3300061719 Bacteria 1681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046491 Ga0495584_0051070 Ga0495584_0051070_806_1789 299
2 3300046518 Ga0495631_0019461 Ga0495631_0019461_1342_2325 299
3 3300046523 Ga0495644_0021457 Ga0495644_0021457_386_1369 299
4 3300046538 Ga0495609_0001001 Ga0495609_0001001_2661_3644 299
5 3300047469 Ga0495673_0048318 Ga0495673_0048318_629_1612 299
6 3300042139 Ga0450904_000028 Ga0450904_000028_20504_21502 301
7 3300048091 Ga0495626_0025118 Ga0495626_0025118_293_1276 303
8 3300046506 Ga0495583_0024874 Ga0495583_0024874_1065_2045 305
9 3300046518 Ga0495631_0014350 Ga0495631_0014350_2829_3809 305
10 3300046523 Ga0495644_0106684 Ga0495644_0106684_55_1035 305
11 3300046473 Ga0495582_0056565 Ga0495582_0056565_56_1039 306
12 3300046499 Ga0495594_0036485 Ga0495594_0036485_1608_2591 306
13 3300046499 Ga0495594_0039696 Ga0495594_0039696_1502_2485 306
14 3300046500 Ga0495596_0033426 Ga0495596_0033426_68_1063 306
15 3300046526 Ga0495666_0069554 Ga0495666_0069554_522_1505 306
16 3300046538 Ga0495609_0005797 Ga0495609_0005797_1320_2291 306
17 3300046557 Ga0495622_0019018 Ga0495622_0019018_1083_2066 306
18 3300047321 Ga0495676_0038777 Ga0495676_0038777_460_1443 306
19 3300044694 Ga0466963_0328852 Ga0466963_0328852_13_981 307
20 3300046519 Ga0495632_0077163 Ga0495632_0077163_174_1211 307
21 3300046525 Ga0495663_0003777 Ga0495663_0003777_2821_3819 307
22 3300046558 Ga0495633_0015637 Ga0495633_0015637_162_1160 307
23 3300047320 Ga0495672_0000209 Ga0495672_0000209_12691_13728 307
24 3300047443 Ga0495687_003092 Ga0495687_003092_955_1938 307
25 3300048907 Ga0496104_0048294 Ga0496104_0048294_1399_2400 307
26 3300048913 Ga0496110_0373977 Ga0496110_0373977_307_1287 307
27 3300037312 Ga0395899_0263643 Ga0395899_0263643_13_993 308
28 3300046453 Ga0495627_005949 Ga0495627_005949_1152_2150 308
29 3300046492 Ga0495585_0008887 Ga0495585_0008887_2784_3782 308
30 3300047470 Ga0495681_0068445 Ga0495681_0068445_503_1501 308
31 3300046491 Ga0495584_0049555 Ga0495584_0049555_657_1628 309
32 3300046506 Ga0495583_0006440 Ga0495583_0006440_3392_4363 309
33 3300046528 Ga0495642_0022150 Ga0495642_0022150_1244_2209 309
34 3300046558 Ga0495633_0016589 Ga0495633_0016589_1711_2682 309
35 3300046674 Ga0495588_0006100 Ga0495588_0006100_887_1864 309
36 3300046691 Ga0495670_0056897 Ga0495670_0056897_697_1668 309
37 3300047470 Ga0495681_0063196 Ga0495681_0063196_711_1682 309
38 3300047472 Ga0495686_0018435 Ga0495686_0018435_2119_3120 309
39 3300048915 Ga0496112_0175933 Ga0496112_0175933_284_1270 309
40 3300048916 Ga0496113_0072748 Ga0496113_0072748_291_1277 309
41 3300048925 Ga0496122_0025335 Ga0496122_0025335_1284_2270 309
42 3300048926 Ga0496123_0000122 Ga0496123_0000122_144111_145097 309
43 3300048927 Ga0496124_0109925 Ga0496124_0109925_777_1751 309
44 3300048928 Ga0496125_0003227 Ga0496125_0003227_15977_16963 309
45 3300046491 Ga0495584_0009374 Ga0495584_0009374_3590_4573 310
46 3300046491 Ga0495584_0042297 Ga0495584_0042297_939_1928 310
47 3300046491 Ga0495584_0098128 Ga0495584_0098128_278_1246 310
48 3300046492 Ga0495585_0002112 Ga0495585_0002112_5017_6000 310
49 3300046492 Ga0495585_0010467 Ga0495585_0010467_3494_4462 310
50 3300046492 Ga0495585_0105500 Ga0495585_0105500_311_1294 310
51 3300046499 Ga0495594_0007123 Ga0495594_0007123_3508_4485 310
52 3300046518 Ga0495631_0006001 Ga0495631_0006001_1880_2848 310
53 3300046518 Ga0495631_0007504 Ga0495631_0007504_3150_4133 310
54 3300046542 Ga0495597_0018668 Ga0495597_0018668_1544_2533 310
55 3300046558 Ga0495633_0068731 Ga0495633_0068731_674_1642 310
56 3300046648 Ga0495611_0019321 Ga0495611_0019321_1670_2653 310
57 3300046648 Ga0495611_0102177 Ga0495611_0102177_342_1310 310
58 3300046665 Ga0495661_0004336 Ga0495661_0004336_7555_8523 310
59 3300046691 Ga0495670_0002112 Ga0495670_0002112_18_986 310
60 3300046691 Ga0495670_0078210 Ga0495670_0078210_65_1048 310
61 3300047318 Ga0495636_0002924 Ga0495636_0002924_4516_5499 310
62 3300047445 Ga0495677_0002086 Ga0495677_0002086_6591_7574 310
63 3300047445 Ga0495677_0009557 Ga0495677_0009557_1047_2015 310
64 3300047470 Ga0495681_0002284 Ga0495681_0002284_8504_9472 310
65 3300047470 Ga0495681_0046204 Ga0495681_0046204_963_1946 310
66 3300049662 Ga0501222_002402 Ga0501222_002402_471_1463 310
67 3300049775 Ga0501279_001231 Ga0501279_001231_1262_2254 310
68 3300046810 Ga0495660_0030453 Ga0495660_0030453_232_1215 311
69 3300049459 Ga0495678_002374 Ga0495678_002374_10893_11876 311
70 3300046452 Ga0495617_000008 Ga0495617_000008_99387_100352 312
71 3300046453 Ga0495627_000875 Ga0495627_000875_16934_17899 312
72 3300046474 Ga0495605_0000083 Ga0495605_0000083_26152_27117 312
73 3300046474 Ga0495605_0105844 Ga0495605_0105844_58_1041 312
74 3300046491 Ga0495584_0017257 Ga0495584_0017257_624_1607 312
75 3300046500 Ga0495596_0018406 Ga0495596_0018406_1459_2424 312
76 3300046500 Ga0495596_0021114 Ga0495596_0021114_1613_2602 312
77 3300046500 Ga0495596_0022613 Ga0495596_0022613_1186_2148 312
78 3300046501 Ga0495607_0003020 Ga0495607_0003020_3159_4124 312
79 3300046506 Ga0495583_0104143 Ga0495583_0104143_34_1023 312
80 3300046513 Ga0495616_0006157 Ga0495616_0006157_5391_6356 312
81 3300046518 Ga0495631_0011111 Ga0495631_0011111_1923_2888 312
82 3300046522 Ga0495643_0024033 Ga0495643_0024033_152_1147 312
83 3300046523 Ga0495644_0086800 Ga0495644_0086800_186_1151 312
84 3300046524 Ga0495648_0002247 Ga0495648_0002247_15496_16461 312
85 3300046528 Ga0495642_0007957 Ga0495642_0007957_2944_3909 312
86 3300046616 Ga0495668_0004225 Ga0495668_0004225_1147_2130 312
87 3300046616 Ga0495668_0007391 Ga0495668_0007391_5371_6336 312
88 3300046665 Ga0495661_0009595 Ga0495661_0009595_3194_4159 312
89 3300046691 Ga0495670_0007570 Ga0495670_0007570_631_1596 312
90 3300046692 Ga0495671_0001415 Ga0495671_0001415_6741_7706 312
91 3300046694 Ga0495649_0001646 Ga0495649_0001646_9199_10194 312
92 3300046794 Ga0495589_0009713 Ga0495589_0009713_1242_2225 312
93 3300046794 Ga0495589_0025857 Ga0495589_0025857_1070_2035 312
94 3300047320 Ga0495672_0012678 Ga0495672_0012678_139_1122 312
95 3300047445 Ga0495677_0003780 Ga0495677_0003780_3875_4840 312
96 3300047472 Ga0495686_0013166 Ga0495686_0013166_70_1032 312
97 3300048927 Ga0496124_0009148 Ga0496124_0009148_8756_9724 312
98 3300049459 Ga0495678_001277 Ga0495678_001277_17911_18879 312
99 3300049460 Ga0495682_0004437 Ga0495682_0004437_4122_5084 312
100 iso_pu_bacteria 2643221556 2643798287 312
101 iso_pu_bacteria 2643221684 2644475290 312
102 iso_pu_bacteria 8047673197 8047674393 312
103 3300044656 Ga0466969_0116992 Ga0466969_0116992_166_1152 313
104 3300046455 Ga0495603_0004305 Ga0495603_0004305_7218_8195 313
105 3300046513 Ga0495616_0000050 Ga0495616_0000050_96822_97796 313
106 3300046518 Ga0495631_0062996 Ga0495631_0062996_485_1459 313
107 3300046519 Ga0495632_0000366 Ga0495632_0000366_38728_39702 313
108 3300046522 Ga0495643_0010359 Ga0495643_0010359_3786_4754 313
109 3300046542 Ga0495597_0001581 Ga0495597_0001581_12191_13162 313
110 3300046674 Ga0495588_0161848 Ga0495588_0161848_27_1007 313
111 3300046684 Ga0495669_0023817 Ga0495669_0023817_251_1225 313
112 3300046810 Ga0495660_0006124 Ga0495660_0006124_1697_2662 313
113 3300047470 Ga0495681_0007418 Ga0495681_0007418_2604_3572 313
114 3300048905 Ga0496102_0000645 Ga0496102_0000645_17935_18903 313
115 3300048906 Ga0496103_0075680 Ga0496103_0075680_511_1491 313
116 3300048911 Ga0496108_0226915 Ga0496108_0226915_135_1103 313
117 3300048929 Ga0496126_0323227 Ga0496126_0323227_199_1167 313
118 3300003215 JGI25153J46596_10012733 JGI25153J46596_100127335 314
119 3300005344 Ga0070661_100256992 Ga0070661_1002569922 314
120 3300025245 Ga0207425_1000322 Ga0207425_100032219 314
121 3300025250 Ga0209026_1001916 Ga0209026_10019163 314
122 3300025297 Ga0209758_1000945 Ga0209758_10009458 314
123 3300042005 Ga0439448_0000170 Ga0439448_0000170_900_1889 314
124 3300042007 Ga0439449_0053711 Ga0439449_0053711_416_1405 314
125 3300042008 Ga0439450_006683 Ga0439450_006683_35_1024 314
126 3300046471 Ga0495650_0000147 Ga0495650_0000147_2233_3282 314
127 3300046491 Ga0495584_0028659 Ga0495584_0028659_1777_2775 314
128 3300046501 Ga0495607_0044638 Ga0495607_0044638_428_1426 314
129 3300046507 Ga0495606_0073284 Ga0495606_0073284_652_1650 314
130 3300046518 Ga0495631_0046675 Ga0495631_0046675_779_1777 314
131 3300046522 Ga0495643_0020093 Ga0495643_0020093_1059_2057 314
132 3300046528 Ga0495642_0011303 Ga0495642_0011303_976_1974 314
133 3300046538 Ga0495609_0001257 Ga0495609_0001257_14124_15173 314
134 3300046538 Ga0495609_0017829 Ga0495609_0017829_1021_2019 314
135 3300046616 Ga0495668_0070132 Ga0495668_0070132_301_1299 314
136 3300046648 Ga0495611_0093532 Ga0495611_0093532_118_1116 314
137 3300046692 Ga0495671_0140421 Ga0495671_0140421_75_1073 314
138 3300046794 Ga0495589_0070366 Ga0495589_0070366_281_1279 314
139 3300047320 Ga0495672_0001063 Ga0495672_0001063_24660_25709 314
140 3300047323 Ga0495683_0044024 Ga0495683_0044024_132_1130 314
141 3300047445 Ga0495677_0018826 Ga0495677_0018826_736_1734 314
142 3300047447 Ga0495685_016346 Ga0495685_016346_661_1659 314
143 3300047470 Ga0495681_0042514 Ga0495681_0042514_61_1059 314
144 3300047472 Ga0495686_0064543 Ga0495686_0064543_971_1969 314
145 3300048091 Ga0495626_0016260 Ga0495626_0016260_1878_2876 314
146 3300048927 Ga0496124_0023827 Ga0496124_0023827_1309_2319 314
147 3300049460 Ga0495682_0018198 Ga0495682_0018198_251_1249 314
148 3300005366 Ga0070659_100059051 Ga0070659_1000590513 315
149 3300005834 Ga0068851_10067893 Ga0068851_100678931 315
150 3300009148 Ga0105243_10018589 Ga0105243_100185895 315
151 3300009174 Ga0105241_10081152 Ga0105241_100811522 315
152 3300009176 Ga0105242_10056058 Ga0105242_100560582 315
153 3300009551 Ga0105238_10124508 Ga0105238_101245081 315
154 3300013297 Ga0157378_10114933 Ga0157378_101149333 315
155 3300025909 Ga0207705_10017834 Ga0207705_100178343 315
156 3300025934 Ga0207686_10061779 Ga0207686_100617792 315
157 3300025935 Ga0207709_10107360 Ga0207709_101073603 315
158 3300025942 Ga0207689_10098001 Ga0207689_100980013 315
159 3300025949 Ga0207667_10045284 Ga0207667_100452843 315
160 3300044719 Ga0466971_0066512 Ga0466971_0066512_559_1560 315
161 3300044842 Ga0466957_0142951 Ga0466957_0142951_17_1006 315
162 3300045836 Ga0466958_0048776 Ga0466958_0048776_1090_2082 315
163 3300045976 Ga0466967_0063852 Ga0466967_0063852_999_1991 315
164 3300046460 Ga0495638_0061139 Ga0495638_0061139_1179_2276 315
165 3300046471 Ga0495650_0000131 Ga0495650_0000131_166376_167473 315
166 3300046492 Ga0495585_0080828 Ga0495585_0080828_27_1025 315
167 3300046660 Ga0495625_0000916 Ga0495625_0000916_1278_2375 315
168 3300048905 Ga0496102_0485393 Ga0496102_0485393_41_1045 315
169 3300003322 rootL2_10020589 rootL2_100205893 316
170 3300003759 Ga0055525_1000105 Ga0055525_100010567 316
171 3300005327 Ga0070658_10247655 Ga0070658_102476551 316
172 3300005366 Ga0070659_100136553 Ga0070659_1001365531 316
173 3300005457 Ga0070662_100204216 Ga0070662_1002042162 316
174 3300009036 Ga0105244_10000758 Ga0105244_100007584 316
175 3300013296 Ga0157374_10359510 Ga0157374_103595102 316
176 3300013307 Ga0157372_10759683 Ga0157372_107596832 316
177 3300025230 Ga0209563_100007 Ga0209563_1000071309 316
178 3300025728 Ga0207655_1008380 Ga0207655_10083803 316
179 3300025919 Ga0207657_10036548 Ga0207657_100365481 316
180 3300037312 Ga0395899_0280895 Ga0395899_0280895_132_1118 316
181 3300037418 Ga0395900_0000928 Ga0395900_0000928_28986_29972 316
182 3300037418 Ga0395900_0009234 Ga0395900_0009234_7813_8817 316
183 3300037418 Ga0395900_0047818 Ga0395900_0047818_3325_4311 316
184 3300037466 Ga0395898_0126321 Ga0395898_0126321_1301_2305 316
185 3300037466 Ga0395898_0424742 Ga0395898_0424742_93_1079 316
186 3300037471 Ga0395905_0133328 Ga0395905_0133328_1335_2321 316
187 3300037471 Ga0395905_0293611 Ga0395905_0293611_473_1477 316
188 3300038443 Ga0395901_0000082 Ga0395901_0000082_126532_127518 316
189 3300044684 Ga0466966_0081906 Ga0466966_0081906_768_1760 316
190 3300044693 Ga0466961_0042840 Ga0466961_0042840_1186_2178 316
191 3300044706 Ga0466964_0001134 Ga0466964_0001134_5425_6426 316
192 3300044706 Ga0466964_0003974 Ga0466964_0003974_2581_3567 316
193 3300044735 Ga0466968_0003420 Ga0466968_0003420_2431_3417 316
194 3300045049 Ga0466959_0093824 Ga0466959_0093824_104_1096 316
195 3300045976 Ga0466967_0116903 Ga0466967_0116903_1388_2389 316
196 3300046457 Ga0495590_0017832 Ga0495590_0017832_1547_2533 316
197 3300046474 Ga0495605_0000217 Ga0495605_0000217_43523_44509 316
198 3300046474 Ga0495605_0021532 Ga0495605_0021532_2375_3370 316
199 3300046474 Ga0495605_0057093 Ga0495605_0057093_18_1043 316
200 3300046491 Ga0495584_0000342 Ga0495584_0000342_3188_4186 316
201 3300046491 Ga0495584_0024923 Ga0495584_0024923_84_1079 316
202 3300046501 Ga0495607_0013880 Ga0495607_0013880_3096_4091 316
203 3300046501 Ga0495607_0088126 Ga0495607_0088126_709_1674 316
204 3300046501 Ga0495607_0162938 Ga0495607_0162938_16_1002 316
205 3300046513 Ga0495616_0005062 Ga0495616_0005062_942_1937 316
206 3300046518 Ga0495631_0000987 Ga0495631_0000987_1642_2667 316
207 3300046520 Ga0495637_0011742 Ga0495637_0011742_1152_2177 316
208 3300046522 Ga0495643_0000505 Ga0495643_0000505_18966_20078 316
209 3300046522 Ga0495643_0005672 Ga0495643_0005672_1296_2282 316
210 3300046522 Ga0495643_0064122 Ga0495643_0064122_127_1113 316
211 3300046522 Ga0495643_0124407 Ga0495643_0124407_26_1012 316
212 3300046528 Ga0495642_0038403 Ga0495642_0038403_507_1493 316
213 3300046528 Ga0495642_0094045 Ga0495642_0094045_245_1240 316
214 3300046530 Ga0495654_0003954 Ga0495654_0003954_5036_6061 316
215 3300046538 Ga0495609_0000002 Ga0495609_0000002_610101_611096 316
216 3300046557 Ga0495622_0000004 Ga0495622_0000004_213905_214924 316
217 3300046615 Ga0495656_0007797 Ga0495656_0007797_1202_2197 316
218 3300046615 Ga0495656_0028796 Ga0495656_0028796_964_1950 316
219 3300046616 Ga0495668_0004743 Ga0495668_0004743_5114_6139 316
220 3300046660 Ga0495625_0007321 Ga0495625_0007321_62_1081 316
221 3300046665 Ga0495661_0000364 Ga0495661_0000364_44738_45733 316
222 3300046665 Ga0495661_0001138 Ga0495661_0001138_4812_5798 316
223 3300046674 Ga0495588_0000067 Ga0495588_0000067_71782_72768 316
224 3300046692 Ga0495671_0003874 Ga0495671_0003874_1626_2651 316
225 3300046694 Ga0495649_0008724 Ga0495649_0008724_28_1065 316
226 3300046794 Ga0495589_0000009 Ga0495589_0000009_125760_126755 316
227 3300046794 Ga0495589_0000256 Ga0495589_0000256_10187_11173 316
228 3300046810 Ga0495660_0000026 Ga0495660_0000026_415_1401 316
229 3300046810 Ga0495660_0123986 Ga0495660_0123986_75_1100 316
230 3300047320 Ga0495672_0000580 Ga0495672_0000580_26160_27272 316
231 3300047320 Ga0495672_0000886 Ga0495672_0000886_15324_16310 316
232 3300047323 Ga0495683_0098495 Ga0495683_0098495_29_1015 316
233 3300047443 Ga0495687_000013 Ga0495687_000013_125760_126755 316
234 3300047443 Ga0495687_005106 Ga0495687_005106_7226_8224 316
235 3300047445 Ga0495677_0000142 Ga0495677_0000142_4893_5888 316
236 3300047445 Ga0495677_0009206 Ga0495677_0009206_2548_3534 316
237 3300047445 Ga0495677_0036067 Ga0495677_0036067_74_1060 316
238 3300047446 Ga0495679_001737 Ga0495679_001737_1784_2809 316
239 3300047447 Ga0495685_002823 Ga0495685_002823_3208_4233 316
240 3300047470 Ga0495681_0074666 Ga0495681_0074666_103_1086 316
241 3300048091 Ga0495626_0000003 Ga0495626_0000003_198414_199490 316
242 3300048091 Ga0495626_0000786 Ga0495626_0000786_26168_27154 316
243 3300048091 Ga0495626_0001947 Ga0495626_0001947_12079_13062 316
244 3300048905 Ga0496102_0080987 Ga0496102_0080987_1508_2500 316
245 3300048909 Ga0496106_0016490 Ga0496106_0016490_1317_2303 316
246 3300048910 Ga0496107_0019517 Ga0496107_0019517_2524_3510 316
247 3300048911 Ga0496108_0276432 Ga0496108_0276432_271_1263 316
248 3300048916 Ga0496113_0023334 Ga0496113_0023334_140_1132 316
249 3300048925 Ga0496122_0014619 Ga0496122_0014619_5436_6428 316
250 3300048926 Ga0496123_0096712 Ga0496123_0096712_377_1369 316
251 3300048927 Ga0496124_0054155 Ga0496124_0054155_2289_3287 316
252 3300049459 Ga0495678_000459 Ga0495678_000459_16262_17374 316
253 3300049822 Ga0501035_0034648 Ga0501035_0034648_1878_2864 316
254 3300049823 Ga0501044_0071023 Ga0501044_0071023_1080_2066 316
255 3300025254 Ga0209148_1000476 Ga0209148_100047628 317
256 3300046455 Ga0495603_0056221 Ga0495603_0056221_1220_2203 317
257 3300046459 Ga0495629_0157898 Ga0495629_0157898_553_1536 317
258 3300046463 Ga0495653_0026978 Ga0495653_0026978_3366_4349 317
259 3300046463 Ga0495653_0069337 Ga0495653_0069337_662_1660 317
260 3300046471 Ga0495650_0000015 Ga0495650_0000015_111449_112420 317
261 3300046472 Ga0495580_0123057 Ga0495580_0123057_502_1485 317
262 3300046500 Ga0495596_0018135 Ga0495596_0018135_1857_2855 317
263 3300046506 Ga0495583_0009396 Ga0495583_0009396_4831_5829 317
264 3300046507 Ga0495606_0000284 Ga0495606_0000284_73026_74111 317
265 3300046517 Ga0495630_0005242 Ga0495630_0005242_3216_4199 317
266 3300046526 Ga0495666_0018734 Ga0495666_0018734_1176_2159 317
267 3300046526 Ga0495666_0029943 Ga0495666_0029943_704_1687 317
268 3300046531 Ga0495665_0052946 Ga0495665_0052946_461_1444 317
269 3300046536 Ga0495587_0009735 Ga0495587_0009735_4674_5657 317
270 3300046542 Ga0495597_0001302 Ga0495597_0001302_11611_12624 317
271 3300046543 Ga0495645_0019063 Ga0495645_0019063_3767_4762 317
272 3300046543 Ga0495645_0181590 Ga0495645_0181590_281_1279 317
273 3300046557 Ga0495622_0074729 Ga0495622_0074729_457_1440 317
274 3300046660 Ga0495625_0009931 Ga0495625_0009931_3031_4014 317
275 3300046689 Ga0495613_0184507 Ga0495613_0184507_122_1105 317
276 3300046690 Ga0495624_0007465 Ga0495624_0007465_728_1711 317
277 3300046794 Ga0495589_0001110 Ga0495589_0001110_18_1031 317
278 3300046809 Ga0495600_0010555 Ga0495600_0010555_4301_5284 317
279 3300047315 Ga0495581_0035295 Ga0495581_0035295_1256_2239 317
280 3300047317 Ga0495604_0077369 Ga0495604_0077369_1460_2443 317
281 3300047319 Ga0495674_0132792 Ga0495674_0132792_967_1950 317
282 3300047322 Ga0495680_0044784 Ga0495680_0044784_1443_2441 317
283 3300047443 Ga0495687_000064 Ga0495687_000064_131140_132138 317
284 3300047444 Ga0495675_0023854 Ga0495675_0023854_12_995 317
285 3300047444 Ga0495675_0088057 Ga0495675_0088057_563_1561 317
286 3300047445 Ga0495677_0000264 Ga0495677_0000264_19644_20630 317
287 3300047673 Ga0495593_0022391 Ga0495593_0022391_1582_2565 317
288 3300048088 Ga0495602_0075124 Ga0495602_0075124_1066_2049 317
289 3300048927 Ga0496124_0098252 Ga0496124_0098252_367_1374 317
290 3300046463 Ga0495653_0026997 Ga0495653_0026997_1341_2342 318
291 3300046473 Ga0495582_0018513 Ga0495582_0018513_372_1373 318
292 3300046499 Ga0495594_0092277 Ga0495594_0092277_322_1323 318
293 3300046507 Ga0495606_0061536 Ga0495606_0061536_825_1826 318
294 3300046507 Ga0495606_0105644 Ga0495606_0105644_691_1683 318
295 3300046517 Ga0495630_0057447 Ga0495630_0057447_890_1891 318
296 3300046522 Ga0495643_0007665 Ga0495643_0007665_2734_3750 318
297 3300046524 Ga0495648_0021695 Ga0495648_0021695_3167_4147 318
298 3300046531 Ga0495665_0006877 Ga0495665_0006877_1657_2658 318
299 3300046536 Ga0495587_0050061 Ga0495587_0050061_405_1394 318
300 3300046557 Ga0495622_0098601 Ga0495622_0098601_76_1077 318
301 3300046642 Ga0495634_0004336 Ga0495634_0004336_5357_6358 318
302 3300046665 Ga0495661_0001818 Ga0495661_0001818_10522_11538 318
303 3300046674 Ga0495588_0009883 Ga0495588_0009883_2573_3574 318
304 3300046678 Ga0495599_0094709 Ga0495599_0094709_345_1346 318
305 3300046809 Ga0495600_0056683 Ga0495600_0056683_666_1667 318
306 3300047317 Ga0495604_0006239 Ga0495604_0006239_5922_6923 318
307 3300047444 Ga0495675_0046046 Ga0495675_0046046_689_1690 318
308 3300048918 Ga0496115_0173373 Ga0496115_0173373_748_1737 318
309 3300049669 Ga0501235_008184 Ga0501235_008184_262_1272 318
310 3300053125 Ga0500618_000371 Ga0500618_000371_23502_24587 318
311 iso_pu_bacteria 2738541357 2739148799 318
312 iso_pu_bacteria 2738543003 2739190718 318
313 iso_pu_bacteria 2738543026 2739317195 318
314 iso_pu_bacteria 2738543029 2739335436 318
315 3300002774 JGI25150J39212_1003312 JGI25150J39212_10033124 319
316 3300003790 Ga0055528_1013615 Ga0055528_10136152 319
317 3300014497 Ga0182008_10015478 Ga0182008_100154785 319
318 3300025263 Ga0209565_1000705 Ga0209565_100070511 319
319 3300025303 Ga0209051_1025729 Ga0209051_10257292 319
320 3300031548 Ga0307408_100000182 Ga0307408_10000018252 319
321 3300031548 Ga0307408_100000200 Ga0307408_10000020022 319
322 3300031548 Ga0307408_100036740 Ga0307408_1000367405 319
323 3300044683 Ga0466965_0011911 Ga0466965_0011911_82_1077 319
324 3300044735 Ga0466968_0120286 Ga0466968_0120286_60_1055 319
325 3300046459 Ga0495629_0011641 Ga0495629_0011641_2440_3429 319
326 3300046501 Ga0495607_0006266 Ga0495607_0006266_2514_3506 319
327 3300046506 Ga0495583_0000049 Ga0495583_0000049_83908_84891 319
328 3300046513 Ga0495616_0037179 Ga0495616_0037179_17_1009 319
329 3300046519 Ga0495632_0003798 Ga0495632_0003798_7558_8550 319
330 3300046524 Ga0495648_0002560 Ga0495648_0002560_14530_15555 319
331 3300046525 Ga0495663_0003031 Ga0495663_0003031_2328_3317 319
332 3300046528 Ga0495642_0030756 Ga0495642_0030756_108_1103 319
333 3300046542 Ga0495597_0000336 Ga0495597_0000336_29910_30908 319
334 3300046665 Ga0495661_0021194 Ga0495661_0021194_3218_4210 319
335 3300046794 Ga0495589_0014511 Ga0495589_0014511_2165_3190 319
336 3300047319 Ga0495674_0002230 Ga0495674_0002230_17407_18396 319
337 3300047445 Ga0495677_0002485 Ga0495677_0002485_5031_6023 319
338 3300047472 Ga0495686_0000188 Ga0495686_0000188_66265_67266 319
339 3300048091 Ga0495626_0006082 Ga0495626_0006082_5626_6618 319
340 3300048091 Ga0495626_0006122 Ga0495626_0006122_193_1185 319
341 3300048091 Ga0495626_0067873 Ga0495626_0067873_488_1513 319
342 3300048914 Ga0496111_0058512 Ga0496111_0058512_1602_2624 319
343 3300046492 Ga0495585_0000528 Ga0495585_0000528_15409_16392 320
344 3300046507 Ga0495606_0005995 Ga0495606_0005995_1632_2645 320
345 3300046524 Ga0495648_0009431 Ga0495648_0009431_4179_5177 320
346 3300046538 Ga0495609_0011972 Ga0495609_0011972_2895_3890 320
347 3300046648 Ga0495611_0053112 Ga0495611_0053112_732_1715 320
348 3300046691 Ga0495670_0009893 Ga0495670_0009893_1458_2441 320
349 3300047470 Ga0495681_0021307 Ga0495681_0021307_1421_2416 320
350 3300048091 Ga0495626_0009495 Ga0495626_0009495_2486_3481 320
351 3300048918 Ga0496115_0130848 Ga0496115_0130848_953_1948 320
352 3300048929 Ga0496126_0026057 Ga0496126_0026057_3202_4287 320
353 3300049459 Ga0495678_001397 Ga0495678_001397_17261_18235 320
354 iso_pu_bacteria 2643221645 2644253990 320
355 iso_pu_bacteria 2643221664 2644356759 320
356 iso_pu_bacteria 2738541280 2738742052 320
357 iso_pu_bacteria 2738541300 2738844507 320
358 iso_pu_bacteria 2738543018 2739277085 320
359 iso_pu_bacteria 2738543030 2739345974 320
360 3300037312 Ga0395899_0000449 Ga0395899_0000449_18536_19522 321
361 3300042007 Ga0439449_0067468 Ga0439449_0067468_15_1028 321
362 3300042876 Ga0451577_0003395 Ga0451577_0003395_16024_17019 321
363 3300042876 Ga0451577_0008544 Ga0451577_0008544_4788_5783 321
364 3300042876 Ga0451577_0011087 Ga0451577_0011087_5823_6818 321
365 3300044712 Ga0453684_0339964 Ga0453684_0339964_167_1162 321
366 3300045051 Ga0451576_0012129 Ga0451576_0012129_4126_5121 321
367 3300045051 Ga0451576_0330678 Ga0451576_0330678_26_1021 321
368 3300046471 Ga0495650_0000544 Ga0495650_0000544_22673_23680 321
369 3300046500 Ga0495596_0001508 Ga0495596_0001508_9413_10408 321
370 3300046522 Ga0495643_0067657 Ga0495643_0067657_12_1094 321
371 3300046523 Ga0495644_0054740 Ga0495644_0054740_48_1043 321
372 3300046531 Ga0495665_0014000 Ga0495665_0014000_2642_3643 321
373 3300046557 Ga0495622_0007502 Ga0495622_0007502_2179_3180 321
374 3300046558 Ga0495633_0019156 Ga0495633_0019156_973_1968 321
375 3300046616 Ga0495668_0007896 Ga0495668_0007896_2248_3255 321
376 3300046674 Ga0495588_0014112 Ga0495588_0014112_1198_2184 321
377 3300046674 Ga0495588_0038366 Ga0495588_0038366_1334_2332 321
378 3300046674 Ga0495588_0054963 Ga0495588_0054963_896_1897 321
379 3300046684 Ga0495669_0011457 Ga0495669_0011457_1816_2811 321
380 3300046691 Ga0495670_0053102 Ga0495670_0053102_62_1057 321
381 3300047315 Ga0495581_0102690 Ga0495581_0102690_43_1044 321
382 3300047321 Ga0495676_0088867 Ga0495676_0088867_315_1313 321
383 3300047447 Ga0495685_054723 Ga0495685_054723_114_1100 321
384 3300047472 Ga0495686_0000225 Ga0495686_0000225_79441_80445 321
385 3300047673 Ga0495593_0016915 Ga0495593_0016915_1560_2561 321
386 3300048090 Ga0495615_0001097 Ga0495615_0001097_99_1088 321
387 3300048905 Ga0496102_0030652 Ga0496102_0030652_2261_3271 321
388 3300048905 Ga0496102_0194685 Ga0496102_0194685_742_1728 321
389 3300049576 Ga0501040_0250247 Ga0501040_0250247_40_1035 321
390 3300049591 Ga0501075_0119999 Ga0501075_0119999_504_1499 321
391 3300049741 Ga0501079_0169128 Ga0501079_0169128_86_1081 321
392 3300049766 Ga0501269_000690 Ga0501269_000690_2851_3870 321
393 3300049775 Ga0501279_002261 Ga0501279_002261_1446_2438 321
394 3300003775 Ga0055524_1000007 Ga0055524_1000007151 322
395 3300005262 Ga0065165_1019534 Ga0065165_10195342 322
396 3300006948 Ga0099826_10000003 Ga0099826_1000000395 322
397 3300021361 Ga0213872_10000317 Ga0213872_1000031742 322
398 3300025299 Ga0209256_1000005 Ga0209256_1000005342 322
399 3300027666 Ga0209282_1000002 Ga0209282_1000002901 322
400 3300039447 Ga0436361_1086294 Ga0436361_1086294_29_1141 322
401 3300046457 Ga0495590_0021572 Ga0495590_0021572_48_1127 322
402 3300046460 Ga0495638_0009676 Ga0495638_0009676_4343_5422 322
403 3300046460 Ga0495638_0186030 Ga0495638_0186030_44_1129 322
404 3300046471 Ga0495650_0000235 Ga0495650_0000235_52772_53857 322
405 3300046471 Ga0495650_0026734 Ga0495650_0026734_1619_2614 322
406 3300046492 Ga0495585_0000632 Ga0495585_0000632_23470_24555 322
407 3300046501 Ga0495607_0044573 Ga0495607_0044573_1425_2507 322
408 3300046506 Ga0495583_0000165 Ga0495583_0000165_1329_2408 322
409 3300046512 Ga0495610_0000004 Ga0495610_0000004_214549_215634 322
410 3300046513 Ga0495616_0001970 Ga0495616_0001970_11765_12844 322
411 3300046520 Ga0495637_0003764 Ga0495637_0003764_1456_2541 322
412 3300046523 Ga0495644_0000141 Ga0495644_0000141_26542_27621 322
413 3300046523 Ga0495644_0011914 Ga0495644_0011914_330_1409 322
414 3300046524 Ga0495648_0001095 Ga0495648_0001095_1353_2432 322
415 3300046525 Ga0495663_0063848 Ga0495663_0063848_74_1072 322
416 3300046530 Ga0495654_0000035 Ga0495654_0000035_168656_169741 322
417 3300046530 Ga0495654_0026016 Ga0495654_0026016_718_1803 322
418 3300046538 Ga0495609_0008596 Ga0495609_0008596_2579_3658 322
419 3300046557 Ga0495622_0045492 Ga0495622_0045492_154_1233 322
420 3300046558 Ga0495633_0000586 Ga0495633_0000586_8244_9323 322
421 3300046616 Ga0495668_0000817 Ga0495668_0000817_17410_18495 322
422 3300046648 Ga0495611_0006398 Ga0495611_0006398_1591_2670 322
423 3300046664 Ga0495659_0000720 Ga0495659_0000720_10456_11535 322
424 3300046665 Ga0495661_0035837 Ga0495661_0035837_1474_2559 322
425 3300046691 Ga0495670_0033938 Ga0495670_0033938_1157_2236 322
426 3300046692 Ga0495671_0000001 Ga0495671_0000001_866720_867805 322
427 3300046692 Ga0495671_0037769 Ga0495671_0037769_623_1702 322
428 3300047318 Ga0495636_0003699 Ga0495636_0003699_4649_5728 322
429 3300047323 Ga0495683_0022303 Ga0495683_0022303_756_1841 322
430 3300047323 Ga0495683_0056295 Ga0495683_0056295_215_1294 322
431 3300047443 Ga0495687_000173 Ga0495687_000173_80941_82020 322
432 3300047445 Ga0495677_0043930 Ga0495677_0043930_441_1520 322
433 3300047445 Ga0495677_0044391 Ga0495677_0044391_623_1612 322
434 3300047446 Ga0495679_003435 Ga0495679_003435_2069_3154 322
435 3300047447 Ga0495685_000096 Ga0495685_000096_29970_31049 322
436 3300047469 Ga0495673_0000006 Ga0495673_0000006_296960_298045 322
437 3300047469 Ga0495673_0000090 Ga0495673_0000090_70995_72080 322
438 3300047469 Ga0495673_0002000 Ga0495673_0002000_626_1705 322
439 3300048905 Ga0496102_0000193 Ga0496102_0000193_45909_46907 322
440 3300048924 Ga0496121_0035735 Ga0496121_0035735_2925_4010 322
441 3300048925 Ga0496122_0029491 Ga0496122_0029491_1923_3008 322
442 3300049459 Ga0495678_012020 Ga0495678_012020_1476_2555 322
443 3300049460 Ga0495682_0000233 Ga0495682_0000233_9980_11059 322
444 3300049460 Ga0495682_0001369 Ga0495682_0001369_623_1702 322
445 3300053145 Ga0500586_000357 Ga0500586_000357_1151_2236 322
446 3300003771 Ga0055526_1000077 Ga0055526_100007764 323
447 3300003771 Ga0055526_1000094 Ga0055526_100009410 323
448 3300025245 Ga0207425_1000001 Ga0207425_10000011994 323
449 3300025246 Ga0209646_1000028 Ga0209646_1000028269 323
450 3300025258 Ga0209129_1000001 Ga0209129_10000011171 323
451 3300025295 Ga0209564_1000009 Ga0209564_1000009855 323
452 3300025295 Ga0209564_1000045 Ga0209564_1000045274 323
453 3300025297 Ga0209758_1000230 Ga0209758_100023045 323
454 3300025299 Ga0209256_1000763 Ga0209256_100076345 323
455 3300030744 Ga0316181_1218906 Ga0316181_12189065 323
456 3300032002 Ga0307416_100009909 Ga0307416_1000099094 323
457 3300046474 Ga0495605_0000003 Ga0495605_0000003_223568_224662 323
458 3300046507 Ga0495606_0000185 Ga0495606_0000185_36040_37044 323
459 3300046507 Ga0495606_0001704 Ga0495606_0001704_24749_25774 323
460 3300046512 Ga0495610_0008234 Ga0495610_0008234_3602_4606 323
461 3300046558 Ga0495633_0016848 Ga0495633_0016848_744_1748 323
462 3300046616 Ga0495668_0001384 Ga0495668_0001384_12944_13948 323
463 3300046810 Ga0495660_0000424 Ga0495660_0000424_17115_18110 323
464 3300047472 Ga0495686_0012382 Ga0495686_0012382_1885_2889 323
465 3300047472 Ga0495686_0072735 Ga0495686_0072735_709_1704 323
466 3300048928 Ga0496125_0054679 Ga0496125_0054679_1255_2253 323
467 3300046542 Ga0495597_0012832 Ga0495597_0012832_925_1917 324
468 3300046558 Ga0495633_0000543 Ga0495633_0000543_2876_3892 324
469 3300046660 Ga0495625_0005938 Ga0495625_0005938_9010_10002 324
470 3300046664 Ga0495659_0000031 Ga0495659_0000031_9460_10452 324
471 3300046692 Ga0495671_0000109 Ga0495671_0000109_13792_14784 324
472 3300047320 Ga0495672_0000715 Ga0495672_0000715_25115_26107 324
473 3300046507 Ga0495606_0008707 Ga0495606_0008707_7595_8623 325
474 iso_pu_bacteria 2842711865 2842716779 325
475 3300005262 Ga0065165_1000094 Ga0065165_100009468 326
476 3300025284 Ga0209130_1000455 Ga0209130_10004559 326
477 3300025302 Ga0207426_1043432 Ga0207426_10434322 326
478 3300039447 Ga0436361_1079056 Ga0436361_1079056_29_1141 326
479 3300046457 Ga0495590_0000003 Ga0495590_0000003_87944_88969 326
480 3300046507 Ga0495606_0000345 Ga0495606_0000345_77622_78638 326
481 3300046520 Ga0495637_0002176 Ga0495637_0002176_4043_5059 326
482 3300046522 Ga0495643_0001311 Ga0495643_0001311_131_1156 326
483 3300046542 Ga0495597_0000206 Ga0495597_0000206_43150_44175 326
484 3300046616 Ga0495668_0000094 Ga0495668_0000094_69051_70055 326
485 3300046616 Ga0495668_0000168 Ga0495668_0000168_8929_9954 326
486 3300046691 Ga0495670_0082312 Ga0495670_0082312_378_1403 326
487 3300047443 Ga0495687_021270 Ga0495687_021270_696_1715 326
488 3300050489 nmdc:mga03683_31385_c1 nmdc:mga03683_31385_c1_365_1378 326
489 3300003763 Ga0055529_1000185 Ga0055529_100018567 327
490 3300003763 Ga0055529_1000208 Ga0055529_10002089 327
491 3300003773 Ga0055537_1000072 Ga0055537_100007218 327
492 3300003775 Ga0055524_1007445 Ga0055524_10074455 327
493 3300003784 Ga0055534_1000136 Ga0055534_10001365 327
494 3300003790 Ga0055528_1000444 Ga0055528_10004446 327
495 3300021361 Ga0213872_10000002 Ga0213872_1000000271 327
496 3300025263 Ga0209565_1000009 Ga0209565_1000009415 327
497 3300025272 Ga0209455_1000049 Ga0209455_100004963 327
498 3300025273 Ga0209673_1000036 Ga0209673_1000036267 327
499 3300025291 Ga0209675_1000013 Ga0209675_1000013267 327
500 3300025295 Ga0209564_1000240 Ga0209564_100024097 327
501 3300025299 Ga0209256_1000052 Ga0209256_1000052249 327
502 3300031711 Ga0265314_10089927 Ga0265314_100899272 327
503 3300039447 Ga0436361_0570400 Ga0436361_0570400_30244_31347 327
504 3300046460 Ga0495638_0046754 Ga0495638_0046754_702_1706 327
505 3300046471 Ga0495650_0000195 Ga0495650_0000195_35026_36039 327
506 3300046491 Ga0495584_0004000 Ga0495584_0004000_2899_3903 327
507 3300046501 Ga0495607_0003492 Ga0495607_0003492_10017_11021 327
508 3300046506 Ga0495583_0010706 Ga0495583_0010706_3121_4125 327
509 3300046507 Ga0495606_0000420 Ga0495606_0000420_32926_33939 327
510 3300046513 Ga0495616_0008372 Ga0495616_0008372_4556_5560 327
511 3300046538 Ga0495609_0001049 Ga0495609_0001049_739_1743 327
512 3300046616 Ga0495668_0008044 Ga0495668_0008044_93_1097 327
513 3300046660 Ga0495625_0002151 Ga0495625_0002151_5257_6261 327
514 3300046664 Ga0495659_0002794 Ga0495659_0002794_2960_3964 327
515 3300046665 Ga0495661_0056331 Ga0495661_0056331_1142_2146 327
516 3300046684 Ga0495669_0003891 Ga0495669_0003891_2472_3476 327
517 3300046694 Ga0495649_0021966 Ga0495649_0021966_1200_2204 327
518 3300046810 Ga0495660_0052773 Ga0495660_0052773_960_1964 327
519 3300047318 Ga0495636_0001712 Ga0495636_0001712_2899_3903 327
520 3300047443 Ga0495687_004504 Ga0495687_004504_2667_3671 327
521 3300047445 Ga0495677_0016317 Ga0495677_0016317_1470_2474 327
522 3300047447 Ga0495685_003881 Ga0495685_003881_3188_4192 327
523 3300047469 Ga0495673_0000014 Ga0495673_0000014_106973_107983 327
524 3300047470 Ga0495681_0007422 Ga0495681_0007422_3318_4322 327
525 3300048903 Ga0496100_0135758 Ga0496100_0135758_187_1194 327
526 3300046501 Ga0495607_0030707 Ga0495607_0030707_1432_2448 328
527 3300046542 Ga0495597_0000583 Ga0495597_0000583_13676_14689 328
528 3300046460 Ga0495638_0000118 Ga0495638_0000118_42986_44011 329
529 3300046471 Ga0495650_0019508 Ga0495650_0019508_914_1939 329
530 3300046506 Ga0495583_0000079 Ga0495583_0000079_85893_86918 329
531 3300046512 Ga0495610_0038196 Ga0495610_0038196_999_2021 329
532 3300046524 Ga0495648_0000070 Ga0495648_0000070_43063_44088 329
533 3300046524 Ga0495648_0057304 Ga0495648_0057304_173_1189 329
534 3300046528 Ga0495642_0007840 Ga0495642_0007840_199_1224 329
535 3300046557 Ga0495622_0000439 Ga0495622_0000439_16949_17974 329
536 3300046558 Ga0495633_0000164 Ga0495633_0000164_73773_74798 329
537 3300046660 Ga0495625_0000038 Ga0495625_0000038_16138_17163 329
538 3300049459 Ga0495678_079616 Ga0495678_079616_138_1163 329
539 3300053145 Ga0500586_023059 Ga0500586_023059_858_1883 329
540 iso_pu_bacteria 2643221603 2644028215 330
541 3300017792 Ga0163161_10208808 Ga0163161_102088081 331
542 3300021361 Ga0213872_10000290 Ga0213872_100002908 331
543 3300037418 Ga0395900_0141660 Ga0395900_0141660_181_1194 331
544 3300037466 Ga0395898_0072224 Ga0395898_0072224_825_1838 331
545 3300037471 Ga0395905_0003794 Ga0395905_0003794_8807_9820 331
546 3300039447 Ga0436361_0750950 Ga0436361_0750950_4083_5087 331
547 3300048904 Ga0496101_0095289 Ga0496101_0095289_754_1905 331
548 3300048905 Ga0496102_0015277 Ga0496102_0015277_860_2011 331
549 3300048906 Ga0496103_0006702 Ga0496103_0006702_1822_2973 331
550 3300048907 Ga0496104_0072379 Ga0496104_0072379_524_1675 331
551 3300048908 Ga0496105_0053017 Ga0496105_0053017_835_1986 331
552 3300048912 Ga0496109_0147172 Ga0496109_0147172_586_1737 331
553 3300048913 Ga0496110_0041647 Ga0496110_0041647_2656_3807 331
554 3300048914 Ga0496111_0082728 Ga0496111_0082728_864_2015 331
555 3300048917 Ga0496114_0201787 Ga0496114_0201787_218_1369 331
556 3300038443 Ga0395901_0029900 Ga0395901_0029900_2633_3637 332
557 3300046507 Ga0495606_0014205 Ga0495606_0014205_1860_2861 332
558 3300025250 Ga0209026_1005238 Ga0209026_10052383 333
559 3300044684 Ga0466966_0007622 Ga0466966_0007622_2971_4056 333
560 3300061719 Ga0466962_0069537 Ga0466962_0069537_443_1528 333
561 3300005344 Ga0070661_100023134 Ga0070661_1000231345 334
562 3300005366 Ga0070659_100011305 Ga0070659_1000113053 334
563 3300005455 Ga0070663_100260239 Ga0070663_1002602392 334
564 3300005564 Ga0070664_100025715 Ga0070664_1000257155 334
565 3300025919 Ga0207657_10036676 Ga0207657_100366765 334
566 3300025932 Ga0207690_10005549 Ga0207690_100055495 334
567 3300037312 Ga0395899_0000473 Ga0395899_0000473_21075_22082 334
568 3300037312 Ga0395899_0001163 Ga0395899_0001163_5214_6221 334
569 3300037312 Ga0395899_0004316 Ga0395899_0004316_1597_2604 334
570 3300037312 Ga0395899_0120471 Ga0395899_0120471_422_1510 334
571 3300037418 Ga0395900_0030934 Ga0395900_0030934_2723_3730 334
572 3300037418 Ga0395900_0057430 Ga0395900_0057430_2976_3983 334
573 3300037466 Ga0395898_0153570 Ga0395898_0153570_918_1925 334
574 3300037471 Ga0395905_0005821 Ga0395905_0005821_6091_7098 334
575 3300037471 Ga0395905_0006637 Ga0395905_0006637_2253_3260 334
576 3300044658 Ga0466972_0000005 Ga0466972_0000005_231559_232578 334
577 3300044658 Ga0466972_0016043 Ga0466972_0016043_1360_2379 334
578 3300044706 Ga0466964_0009763 Ga0466964_0009763_1787_2806 334
579 3300044706 Ga0466964_0019022 Ga0466964_0019022_1069_2088 334
580 3300044901 Ga0466960_0031934 Ga0466960_0031934_1207_2226 334
581 3300048928 Ga0496125_0000794 Ga0496125_0000794_25245_26252 334
582 3300048929 Ga0496126_0243911 Ga0496126_0243911_225_1232 334
583 3300049671 Ga0501238_008438 Ga0501238_008438_23_1030 334
584 3300059493 Ga0587077_003071 Ga0587077_003071_502_1509 334
585 3300059640 Ga0587067_010682 Ga0587067_010682_89_1096 334
586 iso_pu_bacteria 2818991436 2819541172 334
587 3300002737 JGI25162J39368_1000142 JGI25162J39368_100014247 338
588 3300002772 JGI25164J39214_1005747 JGI25164J39214_10057471 338
589 3300003214 JGI25165J46597_1000064 JGI25165J46597_1000064147 338
590 3300003751 Ga0055538_1000031 Ga0055538_100003140 338
591 3300003752 Ga0055539_1000041 Ga0055539_100004140 338
592 3300003756 Ga0055533_1000051 Ga0055533_1000051147 338
593 3300003759 Ga0055525_1000061 Ga0055525_100006140 338
594 3300003841 Ga0055541_1000028 Ga0055541_100002840 338
595 3300014497 Ga0182008_10075216 Ga0182008_100752162 338
596 3300015261 Ga0182006_1010376 Ga0182006_10103762 338
597 3300015262 Ga0182007_10008464 Ga0182007_100084643 338
598 3300015265 Ga0182005_1000656 Ga0182005_10006566 338
599 3300025207 Ga0209760_101300 Ga0209760_1013002 338
600 3300025224 Ga0209784_100039 Ga0209784_10003979 338
601 3300025225 Ga0209566_100023 Ga0209566_10002379 338
602 3300025226 Ga0209674_100040 Ga0209674_10004079 338
603 3300025230 Ga0209563_100072 Ga0209563_10007279 338
604 3300025231 Ga0207427_100911 Ga0207427_10091111 338
605 3300025233 Ga0209437_100097 Ga0209437_10009779 338
606 3300025253 Ga0209677_100041 Ga0209677_10004179 338
607 3300025261 Ga0209233_1000122 Ga0209233_100012279 338
608 3300046454 Ga0495592_0042886 Ga0495592_0042886_791_1807 338
609 3300046462 Ga0495651_0190560 Ga0495651_0190560_12_1028 338
610 3300046463 Ga0495653_0005746 Ga0495653_0005746_380_1396 338
611 3300046511 Ga0495608_0003435 Ga0495608_0003435_2940_3956 338
612 3300046514 Ga0495618_0014933 Ga0495618_0014933_687_1703 338
613 3300046516 Ga0495628_0002806 Ga0495628_0002806_14614_15630 338
614 3300046543 Ga0495645_0013625 Ga0495645_0013625_899_1915 338
615 3300046543 Ga0495645_0061147 Ga0495645_0061147_55_1071 338
616 3300046648 Ga0495611_0120758 Ga0495611_0120758_127_1143 338
617 3300046663 Ga0495635_0027357 Ga0495635_0027357_1402_2418 338
618 3300046678 Ga0495599_0039513 Ga0495599_0039513_435_1451 338
619 3300046680 Ga0495646_0010988 Ga0495646_0010988_500_1516 338
620 3300046680 Ga0495646_0017130 Ga0495646_0017130_2476_3492 338
621 3300046690 Ga0495624_0010581 Ga0495624_0010581_1933_2949 338
622 3300046809 Ga0495600_0000501 Ga0495600_0000501_1510_2526 338
623 3300047321 Ga0495676_0105635 Ga0495676_0105635_514_1635 338
624 3300048088 Ga0495602_0092417 Ga0495602_0092417_416_1432 338
625 3300053077 Ga0495601_0024651 Ga0495601_0024651_1422_2438 338
626 3300053111 Ga0500572_014149 Ga0500572_014149_673_1689 338
627 3300053119 Ga0500595_003939 Ga0500595_003939_3814_4830 338
628 3300053154 Ga0500619_001609 Ga0500619_001609_1580_2596 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00069

Pkinase

Protein kinase domain

68

345

0.89

PF03109

ABC1

ABC1 atypical kinase-like domain

135

251

0.83

PF07714

PK_Tyr_Ser-Thr

Protein tyrosine and serine/threonine kinase

125

341

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s73-assembly3.cif.gz_C crystal structure of nek7 srs mutant bound to compound 51 0.7497 9 292
4eqm-assembly6.cif.gz_F structural analysis of staphylococcus aureus serine/threonine kinase pknb 0.7416 8 299
5x1s-assembly1.cif.gz_A ppka-294 with amppcp 0.7409 5 292
4idt-assembly1.cif.gz_A crystal structure of nik with 11-bromo-5,6,7,8-tetrahydropyrimido[4',5':3,4]cyclohepta[1,2-b]indol-2-amine (t28) 0.7384 10 292
5x1s-assembly1.cif.gz_A ppka-294 with amppcp 0.734 5 292
ID Description Score Start End Superfamily
af_A4IAU7_107_274_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8748 74 182 1.10.510.10
af_Q9Y7J6_79_202_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.871 77 182 2.30.29.30
af_A0A1D6NGZ5_6_131_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8195 77 183 3.30.200.20
af_A0A0R0L5T5_1_181_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7703 80 240 1.10.510.10
af_A0A0R0K8J1_102_241_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7703 117 238 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A1C6MC65-F1-model_v4 Protein kinase domain-containing protein 0.8167 8 297 GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0005524
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0140823
GO:0140855
GO:0140857
GO:1990244
AF-A0A0P7ZNR7-F1-model_v4 Parallel beta-helix repeat domain protein 0.7992 8 295 GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0005524
GO:0006511
GO:0016020
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0042981
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0140823
GO:0140855
GO:0140857
GO:1990244
AF-A0A2N9MZY8-F1-model_v4 Serine/threonine protein kinase 0.7967 4 295 GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0005524
GO:0005737
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0140823
GO:0140855
GO:0140857
GO:1990244
AF-A0A5C7QYK5-F1-model_v4 Serine/threonine protein kinase 0.7944 1 297 GO:0000407
GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0005524
GO:0005776
GO:0005829
GO:0010506
GO:0016020
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0140823
GO:0140855
GO:0140857
GO:1990244
AF-A0A7C7QF92-F1-model_v4 Serine/threonine protein kinase 0.7931 94 300 GO:0004674
GO:0005524
GO:0005776
GO:0005829
GO:0010506
GO:0034045
GO:0042594

Feature Viewer

pLDDT pTM Quality
74.67 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map