F470692
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 628 | 307 | 1256 | 305 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2600255067|2600811155 |
| Length | 323 |
| Sequence | RAYEVFVTVVSRGSFTRAADALETSPANVTRYVNELEAHLGTRLINRTSRKLSLTEGGETLYARCKSILDDVVETEGLVSSASVEPRGRLRINAPVSFGILYLAPLWPEFMRRYPRVELDVALIDRVVDIVDEGYDLAIRISRTGSTNHAARKLATSRNIVCASPDYLERCGHPATPADLAGHQCIGYLYASTGDEWQLIDSKGHAHAVKVNYHMRSNNGDTARAAALAGQGVIWQPTFLVGNDLRAGKLVQILPEYRLPDIDVLALYPSRRHLSAKIRAMIDFLAEAFGGVAPWDREITARPGQAGPDAPRDYCSGVRIGAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 42 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 43 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 48 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 57 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 58 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 60 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 61 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 105 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 108 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 109 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 110 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 111 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 112 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 113 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 114 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 115 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 116 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 117 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 118 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 119 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 120 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 121 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 122 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 123 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 124 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 125 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 126 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 127 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 220 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 221 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 222 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 223 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 224 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 227 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 228 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 229 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 230 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 231 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 232 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 233 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 234 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 235 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 236 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 237 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 238 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 239 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 244 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 245 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 247 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 248 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 249 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 250 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 251 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 252 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 253 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 254 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 255 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 256 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 257 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 258 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 259 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 260 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 261 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 262 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 263 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 264 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 265 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 266 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 267 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 268 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 269 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 270 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 271 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 272 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 273 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 274 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 275 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 276 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 277 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 278 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 279 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 280 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 281 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 282 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 283 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 284 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 285 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 286 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 287 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 288 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 289 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 290 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 291 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 292 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 293 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 294 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 295 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 296 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 297 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 298 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 299 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 300 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 301 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 302 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 303 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 304 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 305 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 306 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 307 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.99 |
| Metatranscriptomes | 0 |
| Isolates | 7.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.54 |
| Nodule | 1.43 |
| Rhizoplane | 4.3 |
| Rhizosphere | 61.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000059 | 3300002704 | Bacteria | 72038 |
| 2 | JGI25156J39149_1000081 | 3300002705 | Bacteria | 72221 |
| 3 | JGI25156J39149_1000477 | 3300002705 | Bacteria | 24122 |
| 4 | JGI25156J39149_1000957 | 3300002705 | Bacteria | 13722 |
| 5 | JGI25156J39149_1015503 | 3300002705 | Bacteria | 1519 |
| 6 | JGI25154J39366_1000109 | 3300002738 | Bacteria | 72431 |
| 7 | JGI25154J39366_1000834 | 3300002738 | Bacteria | 13407 |
| 8 | JGI25157J39369_1000103 | 3300002741 | Bacteria | 72221 |
| 9 | JGI25159J45721_1000488 | 3300002987 | Bacteria | 18147 |
| 10 | JGI25159J45721_1001139 | 3300002987 | Bacteria | 11361 |
| 11 | JGI25151J46595_10000370 | 3300003187 | Bacteria | 47135 |
| 12 | JGI25151J46595_10002071 | 3300003187 | Bacteria | 12502 |
| 13 | JGI25165J46597_1000785 | 3300003214 | Bacteria | 24113 |
| 14 | JGI25153J46596_10011848 | 3300003215 | Bacteria | 3821 |
| 15 | JGI25153J46596_10039913 | 3300003215 | Bacteria | 1462 |
| 16 | rootH1_10000270 | 3300003316 | Bacteria | 3725 |
| 17 | rootH2_10117627 | 3300003320 | Bacteria | 1144 |
| 18 | rootL2_10042248 | 3300003322 | Bacteria | 2095 |
| 19 | rootL2_10081604 | 3300003322 | Bacteria | 2942 |
| 20 | rootL2_10092949 | 3300003322 | Bacteria | 2424 |
| 21 | rootH1_10299132 | 3300003323 | Bacteria | 1354 |
| 22 | JGI25160J50197_1000431 | 3300003354 | Bacteria | 26412 |
| 23 | JGI25161J50226_1000077 | 3300003374 | Bacteria | 83588 |
| 24 | Ga0055533_1000089 | 3300003756 | Bacteria | 122130 |
| 25 | Ga0055533_1000348 | 3300003756 | Bacteria | 20059 |
| 26 | Ga0055532_1000014 | 3300003758 | Bacteria | 344702 |
| 27 | Ga0055532_1000278 | 3300003758 | Bacteria | 33197 |
| 28 | Ga0055527_1000013 | 3300003760 | Bacteria | 347416 |
| 29 | Ga0055535_1000011 | 3300003761 | Bacteria | 347416 |
| 30 | Ga0055535_1000452 | 3300003761 | Bacteria | 37867 |
| 31 | Ga0055542_1000018 | 3300003762 | Bacteria | 347416 |
| 32 | Ga0055529_1000017 | 3300003763 | Bacteria | 347416 |
| 33 | Ga0055529_1000076 | 3300003763 | Bacteria | 156104 |
| 34 | Ga0055529_1000472 | 3300003763 | Bacteria | 38618 |
| 35 | Ga0055529_1000926 | 3300003763 | Bacteria | 15752 |
| 36 | Ga0055526_1000001 | 3300003771 | Bacteria | 669703 |
| 37 | Ga0055526_1000672 | 3300003771 | Bacteria | 26203 |
| 38 | Ga0055537_1000077 | 3300003773 | Bacteria | 70424 |
| 39 | Ga0055524_1000084 | 3300003775 | Bacteria | 119107 |
| 40 | Ga0055524_1024568 | 3300003775 | Bacteria | 1908 |
| 41 | Ga0055534_1000165 | 3300003784 | Bacteria | 49321 |
| 42 | Ga0055528_1000492 | 3300003790 | Bacteria | 31211 |
| 43 | Ga0055530_10002145 | 3300003791 | Bacteria | 13081 |
| 44 | Ga0055530_10005720 | 3300003791 | Bacteria | 5787 |
| 45 | Ga0055530_10009500 | 3300003791 | Bacteria | 3728 |
| 46 | Ga0055540_1000086 | 3300003792 | Bacteria | 102576 |
| 47 | Ga0055531_10019491 | 3300003794 | Bacteria | 2741 |
| 48 | Ga0055543_1000685 | 3300004625 | Bacteria | 17655 |
| 49 | Ga0055543_1010012 | 3300004625 | Bacteria | 2008 |
| 50 | Ga0065165_1000007 | 3300005262 | Bacteria | 337871 |
| 51 | Ga0065165_1000294 | 3300005262 | Bacteria | 84454 |
| 52 | Ga0065165_1011904 | 3300005262 | Bacteria | 3581 |
| 53 | Ga0065165_1026398 | 3300005262 | Bacteria | 1911 |
| 54 | Ga0070690_100062178 | 3300005330 | Bacteria | 2407 |
| 55 | Ga0068868_100020817 | 3300005338 | Bacteria | 4936 |
| 56 | Ga0070669_100030065 | 3300005353 | Bacteria | 3918 |
| 57 | Ga0070669_100487157 | 3300005353 | Bacteria | 1021 |
| 58 | Ga0070667_100014746 | 3300005367 | Bacteria | 6457 |
| 59 | Ga0070667_100345037 | 3300005367 | Bacteria | 1347 |
| 60 | Ga0070678_100033043 | 3300005456 | Bacteria | 3588 |
| 61 | Ga0070678_100376431 | 3300005456 | Bacteria | 1227 |
| 62 | Ga0068853_100073187 | 3300005539 | Bacteria | 2987 |
| 63 | Ga0068852_100182331 | 3300005616 | Bacteria | 1975 |
| 64 | Ga0068859_100905159 | 3300005617 | Bacteria | 967 |
| 65 | Ga0075368_10004357 | 3300006042 | Bacteria | 4788 |
| 66 | Ga0070712_100103541 | 3300006175 | Bacteria | 2110 |
| 67 | Ga0075362_10016380 | 3300006177 | Bacteria | 3034 |
| 68 | Ga0075362_10021049 | 3300006177 | Bacteria | 2732 |
| 69 | Ga0075367_10254405 | 3300006178 | Bacteria | 1102 |
| 70 | Ga0075369_10057168 | 3300006186 | Bacteria | 1696 |
| 71 | Ga0075366_10060808 | 3300006195 | Bacteria | 2244 |
| 72 | Ga0075366_10120441 | 3300006195 | Bacteria | 1581 |
| 73 | Ga0075366_10238336 | 3300006195 | Bacteria | 1109 |
| 74 | Ga0075370_10004578 | 3300006353 | Bacteria | 6741 |
| 75 | Ga0075370_10015894 | 3300006353 | Bacteria | 4040 |
| 76 | Ga0097620_100904953 | 3300006931 | Bacteria | 967 |
| 77 | Ga0079104_1000100 | 3300006946 | Bacteria | 126924 |
| 78 | Ga0105251_10113629 | 3300009011 | Bacteria | 1232 |
| 79 | Ga0105244_10004115 | 3300009036 | Bacteria | 10152 |
| 80 | Ga0105244_10005426 | 3300009036 | Bacteria | 8482 |
| 81 | Ga0105237_10003783 | 3300009545 | Bacteria | 17796 |
| 82 | Ga0105238_10028150 | 3300009551 | Bacteria | 5725 |
| 83 | Ga0105239_10000623 | 3300010375 | Bacteria | 50370 |
| 84 | Ga0105239_10564140 | 3300010375 | Bacteria | 1297 |
| 85 | Ga0157369_10005320 | 3300013105 | Bacteria | 15000 |
| 86 | Ga0157378_10062477 | 3300013297 | Bacteria | 3325 |
| 87 | Ga0163162_10028252 | 3300013306 | Bacteria | 5548 |
| 88 | Ga0163162_10084686 | 3300013306 | Bacteria | 3246 |
| 89 | Ga0163162_10278875 | 3300013306 | Bacteria | 1804 |
| 90 | Ga0182007_10006203 | 3300015262 | Bacteria | 5156 |
| 91 | Ga0183361_10003 | 3300016635 | Bacteria | 577277 |
| 92 | Ga0163161_10027436 | 3300017792 | Bacteria | 4039 |
| 93 | Ga0213872_10000014 | 3300021361 | Bacteria | 181546 |
| 94 | Ga0213872_10000363 | 3300021361 | Bacteria | 38194 |
| 95 | Ga0213872_10000894 | 3300021361 | Bacteria | 21441 |
| 96 | Ga0213872_10003590 | 3300021361 | Bacteria | 8529 |
| 97 | Ga0213872_10025154 | 3300021361 | Bacteria | 2737 |
| 98 | Ga0213872_10034254 | 3300021361 | Bacteria | 2325 |
| 99 | Ga0213872_10043974 | 3300021361 | Bacteria | 2034 |
| 100 | Ga0213872_10079269 | 3300021361 | Bacteria | 1476 |
| 101 | Ga0213872_10105725 | 3300021361 | Bacteria | 1253 |
| 102 | Ga0209435_100047 | 3300025206 | Bacteria | 92749 |
| 103 | Ga0209674_100051 | 3300025226 | Bacteria | 338399 |
| 104 | Ga0209674_100112 | 3300025226 | Bacteria | 142700 |
| 105 | Ga0209672_100027 | 3300025228 | Bacteria | 344500 |
| 106 | Ga0209147_100021 | 3300025229 | Bacteria | 464719 |
| 107 | Ga0209147_100035 | 3300025229 | Bacteria | 344500 |
| 108 | Ga0209563_102067 | 3300025230 | Bacteria | 4754 |
| 109 | Ga0207427_100297 | 3300025231 | Bacteria | 34861 |
| 110 | Ga0209258_100052 | 3300025242 | Bacteria | 344500 |
| 111 | Ga0209258_100501 | 3300025242 | Bacteria | 38827 |
| 112 | Ga0207425_1000159 | 3300025245 | Bacteria | 57245 |
| 113 | Ga0207425_1020066 | 3300025245 | Bacteria | 1433 |
| 114 | Ga0209646_1000038 | 3300025246 | Bacteria | 353982 |
| 115 | Ga0209646_1000054 | 3300025246 | Bacteria | 279447 |
| 116 | Ga0209026_1000180 | 3300025250 | Bacteria | 94396 |
| 117 | Ga0209026_1001901 | 3300025250 | Bacteria | 8480 |
| 118 | Ga0209677_102326 | 3300025253 | Bacteria | 7293 |
| 119 | Ga0209148_1000064 | 3300025254 | Bacteria | 344500 |
| 120 | Ga0209148_1009751 | 3300025254 | Bacteria | 1852 |
| 121 | Ga0209759_1000015 | 3300025256 | Bacteria | 388724 |
| 122 | Ga0209759_1000125 | 3300025256 | Bacteria | 135516 |
| 123 | Ga0209759_1000205 | 3300025256 | Bacteria | 92894 |
| 124 | Ga0209759_1001148 | 3300025256 | Bacteria | 16861 |
| 125 | Ga0209759_1003364 | 3300025256 | Bacteria | 6417 |
| 126 | Ga0209129_1005364 | 3300025258 | Bacteria | 4572 |
| 127 | Ga0209233_1000073 | 3300025261 | Bacteria | 362383 |
| 128 | Ga0209565_1000003 | 3300025263 | Bacteria | 1099648 |
| 129 | Ga0209565_1000771 | 3300025263 | Bacteria | 18692 |
| 130 | Ga0209455_1000057 | 3300025272 | Bacteria | 344500 |
| 131 | Ga0209455_1000073 | 3300025272 | Bacteria | 291417 |
| 132 | Ga0209455_1000341 | 3300025272 | Bacteria | 44283 |
| 133 | Ga0209673_1000003 | 3300025273 | Bacteria | 980859 |
| 134 | Ga0209130_1000040 | 3300025284 | Bacteria | 262926 |
| 135 | Ga0209130_1000306 | 3300025284 | Bacteria | 59508 |
| 136 | Ga0209675_1000003 | 3300025291 | Bacteria | 1003982 |
| 137 | Ga0209675_1003383 | 3300025291 | Bacteria | 7606 |
| 138 | Ga0209675_1016911 | 3300025291 | Bacteria | 2105 |
| 139 | Ga0209676_1000476 | 3300025292 | Bacteria | 66212 |
| 140 | Ga0209676_1002341 | 3300025292 | Bacteria | 13691 |
| 141 | Ga0209025_1000061 | 3300025294 | Bacteria | 304827 |
| 142 | Ga0209025_1002648 | 3300025294 | Bacteria | 18307 |
| 143 | Ga0209025_1005800 | 3300025294 | Bacteria | 9906 |
| 144 | Ga0209025_1013541 | 3300025294 | Bacteria | 5114 |
| 145 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 146 | Ga0209564_1000011 | 3300025295 | Bacteria | 822327 |
| 147 | Ga0209564_1000012 | 3300025295 | Bacteria | 792078 |
| 148 | Ga0209564_1001283 | 3300025295 | Bacteria | 27528 |
| 149 | Ga0209564_1008278 | 3300025295 | Bacteria | 5162 |
| 150 | Ga0209758_1000249 | 3300025297 | Bacteria | 110026 |
| 151 | Ga0209758_1001391 | 3300025297 | Bacteria | 28769 |
| 152 | Ga0209758_1003600 | 3300025297 | Bacteria | 13861 |
| 153 | Ga0209050_1000053 | 3300025298 | Bacteria | 349521 |
| 154 | Ga0209050_1000506 | 3300025298 | Bacteria | 66220 |
| 155 | Ga0209050_1002675 | 3300025298 | Bacteria | 14536 |
| 156 | Ga0209050_1008406 | 3300025298 | Bacteria | 5528 |
| 157 | Ga0209256_1000029 | 3300025299 | Bacteria | 415922 |
| 158 | Ga0209256_1000071 | 3300025299 | Bacteria | 242618 |
| 159 | Ga0207426_1000359 | 3300025302 | Bacteria | 82359 |
| 160 | Ga0209051_1000210 | 3300025303 | Bacteria | 102629 |
| 161 | Ga0209051_1001779 | 3300025303 | Bacteria | 17096 |
| 162 | Ga0209257_1000314 | 3300025304 | Bacteria | 102629 |
| 163 | Ga0209257_1000316 | 3300025304 | Bacteria | 102171 |
| 164 | Ga0209257_1006323 | 3300025304 | Bacteria | 7710 |
| 165 | Ga0209257_1011179 | 3300025304 | Bacteria | 4370 |
| 166 | Ga0209257_1012588 | 3300025304 | Bacteria | 3888 |
| 167 | Ga0207655_1020772 | 3300025728 | Bacteria | 3360 |
| 168 | Ga0207647_10012621 | 3300025904 | Bacteria | 5873 |
| 169 | Ga0207671_10008408 | 3300025914 | Bacteria | 8759 |
| 170 | Ga0207693_10029893 | 3300025915 | Bacteria | 4300 |
| 171 | Ga0207681_10176098 | 3300025923 | Bacteria | 1625 |
| 172 | Ga0207665_10219201 | 3300025939 | Bacteria | 1394 |
| 173 | Ga0207691_10114281 | 3300025940 | Bacteria | 2399 |
| 174 | Ga0207689_10086122 | 3300025942 | Bacteria | 2582 |
| 175 | Ga0207658_10091847 | 3300025986 | Bacteria | 2357 |
| 176 | Ga0207658_10350035 | 3300025986 | Bacteria | 1286 |
| 177 | Ga0207677_10016814 | 3300026023 | Bacteria | 4344 |
| 178 | Ga0207639_10184582 | 3300026041 | Bacteria | 1777 |
| 179 | Ga0207639_10210691 | 3300026041 | Bacteria | 1673 |
| 180 | Ga0207641_10033387 | 3300026088 | Bacteria | 4276 |
| 181 | Ga0207676_10017519 | 3300026095 | Bacteria | 5193 |
| 182 | Ga0207683_10052169 | 3300026121 | Bacteria | 3583 |
| 183 | Ga0207683_10075406 | 3300026121 | Bacteria | 2985 |
| 184 | Ga0207698_10129856 | 3300026142 | Bacteria | 2151 |
| 185 | Ga0209281_1000084 | 3300027111 | Bacteria | 254215 |
| 186 | Ga0209371_1007459 | 3300027312 | Bacteria | 3806 |
| 187 | Ga0268264_10120234 | 3300028381 | Bacteria | 2314 |
| 188 | Ga0265336_10000111 | 3300028666 | Bacteria | 62085 |
| 189 | Ga0307515_10289783 | 3300028794 | Bacteria | 1334 |
| 190 | Ga0307515_10338347 | 3300028794 | Bacteria | 1159 |
| 191 | Ga0265324_10002789 | 3300029957 | Bacteria | 8633 |
| 192 | Ga0268256_1007679 | 3300030500 | Bacteria | 3806 |
| 193 | Ga0307511_10000056 | 3300030521 | Bacteria | 93598 |
| 194 | Ga0316177_1072788 | 3300030731 | Bacteria | 2786 |
| 195 | Ga0316180_1052560 | 3300030736 | Bacteria | 3387 |
| 196 | Ga0307513_10307563 | 3300031456 | Bacteria | 1349 |
| 197 | Ga0307408_100008377 | 3300031548 | Bacteria | 6828 |
| 198 | Ga0307408_100295245 | 3300031548 | Bacteria | 1355 |
| 199 | Ga0307516_10003006 | 3300031730 | Bacteria | 22016 |
| 200 | Ga0307516_10022947 | 3300031730 | Bacteria | 6404 |
| 201 | Ga0307406_10070468 | 3300031901 | Bacteria | 2289 |
| 202 | Ga0373934_0007593 | 3300035086 | Bacteria | 4029 |
| 203 | Ga0395898_0004799 | 3300037466 | Bacteria | 14714 |
| 204 | Ga0395898_0098319 | 3300037466 | Bacteria | 2810 |
| 205 | Ga0395901_0000079 | 3300038443 | Bacteria | 134462 |
| 206 | Ga0395901_0005069 | 3300038443 | Bacteria | 13306 |
| 207 | Ga0436361_0156472 | 3300039447 | Bacteria | 142079 |
| 208 | Ga0436361_0295570 | 3300039447 | Bacteria | 32166 |
| 209 | Ga0436361_0344276 | 3300039447 | Bacteria | 1872 |
| 210 | Ga0436361_0434209 | 3300039447 | Bacteria | 2001 |
| 211 | Ga0436361_0700633 | 3300039447 | Bacteria | 4256 |
| 212 | Ga0436361_0865069 | 3300039447 | Bacteria | 75093 |
| 213 | Ga0436361_1112214 | 3300039447 | Bacteria | 3905 |
| 214 | Ga0436361_1145940 | 3300039447 | Bacteria | 80179 |
| 215 | Ga0439436_0000199 | 3300041404 | Bacteria | 14414 |
| 216 | Ga0439439_0023454 | 3300041406 | Unclassified | 1545 |
| 217 | Ga0439449_0008250 | 3300042007 | Unclassified | 3962 |
| 218 | Ga0466965_0036307 | 3300044683 | Bacteria | 2418 |
| 219 | Ga0466968_0101508 | 3300044735 | Bacteria | 1285 |
| 220 | Ga0495617_000285 | 3300046452 | Bacteria | 29213 |
| 221 | Ga0495617_000629 | 3300046452 | Bacteria | 17685 |
| 222 | Ga0495617_001983 | 3300046452 | Bacteria | 8542 |
| 223 | Ga0495617_015539 | 3300046452 | Bacteria | 2578 |
| 224 | Ga0495592_0011088 | 3300046454 | Bacteria | 6803 |
| 225 | Ga0495592_0077764 | 3300046454 | Bacteria | 2404 |
| 226 | Ga0495592_0092383 | 3300046454 | Bacteria | 2168 |
| 227 | Ga0495603_0002032 | 3300046455 | Bacteria | 11908 |
| 228 | Ga0495603_0015559 | 3300046455 | Bacteria | 4604 |
| 229 | Ga0495590_0000002 | 3300046457 | Bacteria | 485720 |
| 230 | Ga0495590_0014452 | 3300046457 | Bacteria | 2879 |
| 231 | Ga0495629_0001421 | 3300046459 | Bacteria | 18891 |
| 232 | Ga0495629_0003207 | 3300046459 | Bacteria | 12374 |
| 233 | Ga0495629_0017898 | 3300046459 | Bacteria | 5078 |
| 234 | Ga0495638_0000030 | 3300046460 | Bacteria | 318183 |
| 235 | Ga0495638_0004879 | 3300046460 | Bacteria | 10090 |
| 236 | Ga0495641_0020814 | 3300046461 | Bacteria | 3316 |
| 237 | Ga0495651_0032429 | 3300046462 | Bacteria | 4075 |
| 238 | Ga0495651_0094199 | 3300046462 | Bacteria | 2241 |
| 239 | Ga0495651_0251833 | 3300046462 | Bacteria | 1206 |
| 240 | Ga0495653_0000005 | 3300046463 | Bacteria | 367438 |
| 241 | Ga0495653_0034722 | 3300046463 | Bacteria | 3984 |
| 242 | Ga0495653_0041185 | 3300046463 | Bacteria | 3606 |
| 243 | Ga0495653_0110585 | 3300046463 | Bacteria | 1975 |
| 244 | Ga0495650_0000067 | 3300046471 | Bacteria | 269882 |
| 245 | Ga0495650_0000385 | 3300046471 | Bacteria | 75775 |
| 246 | Ga0495650_0003168 | 3300046471 | Bacteria | 12277 |
| 247 | Ga0495650_0008424 | 3300046471 | Bacteria | 6023 |
| 248 | Ga0495650_0009509 | 3300046471 | Bacteria | 5521 |
| 249 | Ga0495650_0012274 | 3300046471 | Bacteria | 4618 |
| 250 | Ga0495650_0013800 | 3300046471 | Bacteria | 4249 |
| 251 | Ga0495650_0112249 | 3300046471 | Bacteria | 1011 |
| 252 | Ga0495580_0000183 | 3300046472 | Bacteria | 47213 |
| 253 | Ga0495580_0002954 | 3300046472 | Bacteria | 14596 |
| 254 | Ga0495580_0006601 | 3300046472 | Bacteria | 9430 |
| 255 | Ga0495580_0012034 | 3300046472 | Bacteria | 6663 |
| 256 | Ga0495580_0047056 | 3300046472 | Bacteria | 3059 |
| 257 | Ga0495582_0004221 | 3300046473 | Bacteria | 8084 |
| 258 | Ga0495582_0010606 | 3300046473 | Bacteria | 5069 |
| 259 | Ga0495582_0328369 | 3300046473 | Bacteria | 880 |
| 260 | Ga0495605_0000073 | 3300046474 | Bacteria | 131765 |
| 261 | Ga0495605_0006264 | 3300046474 | Bacteria | 6858 |
| 262 | Ga0495639_0003400 | 3300046475 | Bacteria | 6893 |
| 263 | Ga0495639_0007560 | 3300046475 | Bacteria | 4669 |
| 264 | Ga0495662_0020387 | 3300046476 | Bacteria | 3207 |
| 265 | Ga0495662_0043649 | 3300046476 | Bacteria | 2164 |
| 266 | Ga0495664_0001680 | 3300046477 | Bacteria | 11763 |
| 267 | Ga0495664_0002758 | 3300046477 | Bacteria | 9449 |
| 268 | Ga0495664_0004994 | 3300046477 | Bacteria | 7263 |
| 269 | Ga0495584_0000016 | 3300046491 | Bacteria | 156560 |
| 270 | Ga0495584_0101339 | 3300046491 | Bacteria | 1455 |
| 271 | Ga0495585_0003881 | 3300046492 | Bacteria | 9938 |
| 272 | Ga0495585_0004708 | 3300046492 | Bacteria | 8789 |
| 273 | Ga0495585_0028940 | 3300046492 | Bacteria | 3157 |
| 274 | Ga0495585_0048595 | 3300046492 | Bacteria | 2358 |
| 275 | Ga0495594_0245952 | 3300046499 | Bacteria | 1019 |
| 276 | Ga0495596_0002408 | 3300046500 | Bacteria | 10100 |
| 277 | Ga0495607_0000219 | 3300046501 | Bacteria | 61110 |
| 278 | Ga0495607_0001517 | 3300046501 | Bacteria | 20431 |
| 279 | Ga0495607_0001827 | 3300046501 | Bacteria | 18144 |
| 280 | Ga0495607_0044621 | 3300046501 | Bacteria | 2613 |
| 281 | Ga0495607_0117844 | 3300046501 | Bacteria | 1398 |
| 282 | Ga0495583_0000029 | 3300046506 | Bacteria | 255536 |
| 283 | Ga0495583_0000058 | 3300046506 | Bacteria | 200120 |
| 284 | Ga0495583_0000113 | 3300046506 | Bacteria | 136475 |
| 285 | Ga0495583_0013348 | 3300046506 | Bacteria | 4586 |
| 286 | Ga0495583_0018439 | 3300046506 | Bacteria | 3674 |
| 287 | Ga0495583_0133575 | 3300046506 | Bacteria | 1037 |
| 288 | Ga0495606_0000049 | 3300046507 | Bacteria | 204038 |
| 289 | Ga0495606_0000381 | 3300046507 | Bacteria | 75386 |
| 290 | Ga0495606_0000422 | 3300046507 | Bacteria | 70719 |
| 291 | Ga0495606_0001776 | 3300046507 | Bacteria | 27602 |
| 292 | Ga0495606_0002831 | 3300046507 | Bacteria | 19246 |
| 293 | Ga0495606_0004619 | 3300046507 | Bacteria | 13640 |
| 294 | Ga0495606_0027046 | 3300046507 | Bacteria | 4074 |
| 295 | Ga0495608_0009673 | 3300046511 | Bacteria | 6726 |
| 296 | Ga0495608_0057849 | 3300046511 | Bacteria | 2557 |
| 297 | Ga0495610_0000012 | 3300046512 | Bacteria | 517442 |
| 298 | Ga0495610_0002552 | 3300046512 | Bacteria | 15157 |
| 299 | Ga0495610_0007104 | 3300046512 | Bacteria | 7555 |
| 300 | Ga0495610_0048317 | 3300046512 | Bacteria | 2089 |
| 301 | Ga0495610_0052229 | 3300046512 | Bacteria | 1985 |
| 302 | Ga0495616_0002322 | 3300046513 | Bacteria | 12713 |
| 303 | Ga0495616_0024647 | 3300046513 | Bacteria | 3224 |
| 304 | Ga0495618_0017609 | 3300046514 | Bacteria | 4382 |
| 305 | Ga0495628_0004640 | 3300046516 | Bacteria | 12132 |
| 306 | Ga0495628_0006852 | 3300046516 | Bacteria | 9904 |
| 307 | Ga0495628_0068082 | 3300046516 | Bacteria | 2778 |
| 308 | Ga0495628_0082804 | 3300046516 | Bacteria | 2492 |
| 309 | Ga0495630_0029737 | 3300046517 | Bacteria | 4061 |
| 310 | Ga0495630_0037927 | 3300046517 | Bacteria | 3603 |
| 311 | Ga0495630_0236289 | 3300046517 | Bacteria | 1396 |
| 312 | Ga0495632_0004689 | 3300046519 | Bacteria | 9236 |
| 313 | Ga0495637_0001275 | 3300046520 | Bacteria | 15197 |
| 314 | Ga0495643_0000011 | 3300046522 | Bacteria | 324745 |
| 315 | Ga0495643_0000078 | 3300046522 | Bacteria | 162974 |
| 316 | Ga0495644_0000967 | 3300046523 | Bacteria | 11902 |
| 317 | Ga0495644_0002934 | 3300046523 | Bacteria | 6776 |
| 318 | Ga0495644_0039222 | 3300046523 | Bacteria | 1786 |
| 319 | Ga0495648_0000009 | 3300046524 | Bacteria | 317193 |
| 320 | Ga0495648_0002444 | 3300046524 | Bacteria | 17169 |
| 321 | Ga0495648_0006254 | 3300046524 | Bacteria | 9744 |
| 322 | Ga0495648_0009797 | 3300046524 | Bacteria | 7371 |
| 323 | Ga0495648_0012276 | 3300046524 | Bacteria | 6398 |
| 324 | Ga0495648_0012288 | 3300046524 | Bacteria | 6395 |
| 325 | Ga0495648_0017753 | 3300046524 | Bacteria | 5073 |
| 326 | Ga0495648_0023719 | 3300046524 | Bacteria | 4193 |
| 327 | Ga0495648_0023740 | 3300046524 | Bacteria | 4191 |
| 328 | Ga0495648_0036988 | 3300046524 | Bacteria | 3141 |
| 329 | Ga0495663_0002855 | 3300046525 | Bacteria | 5106 |
| 330 | Ga0495663_0003293 | 3300046525 | Bacteria | 4680 |
| 331 | Ga0495666_0001075 | 3300046526 | Bacteria | 13008 |
| 332 | Ga0495666_0002585 | 3300046526 | Bacteria | 9005 |
| 333 | Ga0495666_0006590 | 3300046526 | Bacteria | 5839 |
| 334 | Ga0495666_0012104 | 3300046526 | Bacteria | 4306 |
| 335 | Ga0495642_0005575 | 3300046528 | Bacteria | 4837 |
| 336 | Ga0495642_0017008 | 3300046528 | Bacteria | 2839 |
| 337 | Ga0495642_0024533 | 3300046528 | Bacteria | 2386 |
| 338 | Ga0495642_0028310 | 3300046528 | Bacteria | 2232 |
| 339 | Ga0495652_0010507 | 3300046529 | Bacteria | 8389 |
| 340 | Ga0495652_0114881 | 3300046529 | Bacteria | 2158 |
| 341 | Ga0495652_0255603 | 3300046529 | Bacteria | 1296 |
| 342 | Ga0495652_0317994 | 3300046529 | Bacteria | 1125 |
| 343 | Ga0495654_0000011 | 3300046530 | Bacteria | 363172 |
| 344 | Ga0495654_0052378 | 3300046530 | Bacteria | 1988 |
| 345 | Ga0495665_0008679 | 3300046531 | Bacteria | 5515 |
| 346 | Ga0495665_0016089 | 3300046531 | Bacteria | 4030 |
| 347 | Ga0495665_0060357 | 3300046531 | Bacteria | 2002 |
| 348 | Ga0495640_0006014 | 3300046533 | Bacteria | 9624 |
| 349 | Ga0495640_0020445 | 3300046533 | Bacteria | 4871 |
| 350 | Ga0495586_0009365 | 3300046535 | Bacteria | 5211 |
| 351 | Ga0495586_0064330 | 3300046535 | Bacteria | 1998 |
| 352 | Ga0495586_0111034 | 3300046535 | Bacteria | 1526 |
| 353 | Ga0495587_0012720 | 3300046536 | Bacteria | 5293 |
| 354 | Ga0495587_0021846 | 3300046536 | Bacteria | 3947 |
| 355 | Ga0495609_0000054 | 3300046538 | Bacteria | 147369 |
| 356 | Ga0495609_0064812 | 3300046538 | Bacteria | 1611 |
| 357 | Ga0495597_0000014 | 3300046542 | Bacteria | 177043 |
| 358 | Ga0495597_0000362 | 3300046542 | Bacteria | 40147 |
| 359 | Ga0495597_0043475 | 3300046542 | Bacteria | 2000 |
| 360 | Ga0495597_0066839 | 3300046542 | Bacteria | 1557 |
| 361 | Ga0495645_0001543 | 3300046543 | Bacteria | 15573 |
| 362 | Ga0495645_0019470 | 3300046543 | Bacteria | 4886 |
| 363 | Ga0495622_0000002 | 3300046557 | Bacteria | 321742 |
| 364 | Ga0495622_0000018 | 3300046557 | Bacteria | 173985 |
| 365 | Ga0495622_0001368 | 3300046557 | Bacteria | 12438 |
| 366 | Ga0495633_0000041 | 3300046558 | Bacteria | 176298 |
| 367 | Ga0495633_0000047 | 3300046558 | Bacteria | 165890 |
| 368 | Ga0495633_0001049 | 3300046558 | Bacteria | 22608 |
| 369 | Ga0495633_0001874 | 3300046558 | Bacteria | 15358 |
| 370 | Ga0495633_0007614 | 3300046558 | Bacteria | 6201 |
| 371 | Ga0495633_0039613 | 3300046558 | Bacteria | 2249 |
| 372 | Ga0495633_0159095 | 3300046558 | Bacteria | 1042 |
| 373 | Ga0495667_0021458 | 3300046559 | Bacteria | 4358 |
| 374 | Ga0495656_0008463 | 3300046615 | Bacteria | 3673 |
| 375 | Ga0495656_0121524 | 3300046615 | Bacteria | 1233 |
| 376 | Ga0495668_0000020 | 3300046616 | Bacteria | 411641 |
| 377 | Ga0495668_0000077 | 3300046616 | Bacteria | 159120 |
| 378 | Ga0495668_0000750 | 3300046616 | Bacteria | 38415 |
| 379 | Ga0495668_0002404 | 3300046616 | Bacteria | 15499 |
| 380 | Ga0495668_0019403 | 3300046616 | Bacteria | 3920 |
| 381 | Ga0495634_0034718 | 3300046642 | Bacteria | 3458 |
| 382 | Ga0495634_0047786 | 3300046642 | Bacteria | 2882 |
| 383 | Ga0495611_0003441 | 3300046648 | Bacteria | 6980 |
| 384 | Ga0495611_0003837 | 3300046648 | Bacteria | 6555 |
| 385 | Ga0495611_0009879 | 3300046648 | Bacteria | 4037 |
| 386 | Ga0495625_0000023 | 3300046660 | Bacteria | 274067 |
| 387 | Ga0495625_0000721 | 3300046660 | Bacteria | 46512 |
| 388 | Ga0495625_0003924 | 3300046660 | Bacteria | 14297 |
| 389 | Ga0495625_0009136 | 3300046660 | Bacteria | 8342 |
| 390 | Ga0495625_0059480 | 3300046660 | Bacteria | 2711 |
| 391 | Ga0495625_0082040 | 3300046660 | Bacteria | 2243 |
| 392 | Ga0495625_0085478 | 3300046660 | Bacteria | 2189 |
| 393 | Ga0495625_0097742 | 3300046660 | Bacteria | 2020 |
| 394 | Ga0495625_0407929 | 3300046660 | Bacteria | 847 |
| 395 | Ga0495635_0001086 | 3300046663 | Bacteria | 18041 |
| 396 | Ga0495635_0001345 | 3300046663 | Bacteria | 16351 |
| 397 | Ga0495635_0198231 | 3300046663 | Bacteria | 1362 |
| 398 | Ga0495659_0000012 | 3300046664 | Bacteria | 82444 |
| 399 | Ga0495659_0000155 | 3300046664 | Bacteria | 30367 |
| 400 | Ga0495661_0023956 | 3300046665 | Bacteria | 3956 |
| 401 | Ga0495661_0025145 | 3300046665 | Bacteria | 3849 |
| 402 | Ga0495661_0042851 | 3300046665 | Bacteria | 2787 |
| 403 | Ga0495588_0048900 | 3300046674 | Bacteria | 2173 |
| 404 | Ga0495588_0051996 | 3300046674 | Bacteria | 2111 |
| 405 | Ga0495657_0057553 | 3300046675 | Bacteria | 2584 |
| 406 | Ga0495623_0007343 | 3300046679 | Bacteria | 7153 |
| 407 | Ga0495623_0086121 | 3300046679 | Bacteria | 1937 |
| 408 | Ga0495646_0002226 | 3300046680 | Bacteria | 11839 |
| 409 | Ga0495646_0005808 | 3300046680 | Bacteria | 7828 |
| 410 | Ga0495646_0010615 | 3300046680 | Bacteria | 5849 |
| 411 | Ga0495646_0041779 | 3300046680 | Bacteria | 2816 |
| 412 | Ga0495669_0003596 | 3300046684 | Bacteria | 6391 |
| 413 | Ga0495669_0035024 | 3300046684 | Bacteria | 2215 |
| 414 | Ga0495613_0000702 | 3300046689 | Bacteria | 26408 |
| 415 | Ga0495613_0014097 | 3300046689 | Bacteria | 5929 |
| 416 | Ga0495613_0019525 | 3300046689 | Bacteria | 5051 |
| 417 | Ga0495624_0001390 | 3300046690 | Bacteria | 18860 |
| 418 | Ga0495624_0007668 | 3300046690 | Bacteria | 7575 |
| 419 | Ga0495624_0037528 | 3300046690 | Bacteria | 3115 |
| 420 | Ga0495624_0043821 | 3300046690 | Bacteria | 2853 |
| 421 | Ga0495624_0070239 | 3300046690 | Bacteria | 2180 |
| 422 | Ga0495670_0004550 | 3300046691 | Bacteria | 6801 |
| 423 | Ga0495670_0022998 | 3300046691 | Bacteria | 3077 |
| 424 | Ga0495671_0000006 | 3300046692 | Bacteria | 500471 |
| 425 | Ga0495671_0000145 | 3300046692 | Bacteria | 62201 |
| 426 | Ga0495671_0018495 | 3300046692 | Bacteria | 3697 |
| 427 | Ga0495671_0028885 | 3300046692 | Bacteria | 2852 |
| 428 | Ga0495671_0071502 | 3300046692 | Bacteria | 1704 |
| 429 | Ga0495649_0002043 | 3300046694 | Bacteria | 14565 |
| 430 | Ga0495649_0003667 | 3300046694 | Bacteria | 10238 |
| 431 | Ga0495649_0008694 | 3300046694 | Bacteria | 6094 |
| 432 | Ga0495649_0037498 | 3300046694 | Bacteria | 2661 |
| 433 | Ga0495589_0006404 | 3300046794 | Bacteria | 6217 |
| 434 | Ga0495589_0008587 | 3300046794 | Bacteria | 5325 |
| 435 | Ga0495589_0051063 | 3300046794 | Bacteria | 2045 |
| 436 | Ga0495600_0010468 | 3300046809 | Bacteria | 5759 |
| 437 | Ga0495600_0094155 | 3300046809 | Bacteria | 1953 |
| 438 | Ga0495660_0001355 | 3300046810 | Bacteria | 16845 |
| 439 | Ga0495660_0007238 | 3300046810 | Bacteria | 6533 |
| 440 | Ga0495660_0016445 | 3300046810 | Bacteria | 4266 |
| 441 | Ga0495660_0067772 | 3300046810 | Bacteria | 1900 |
| 442 | Ga0495660_0105313 | 3300046810 | Bacteria | 1446 |
| 443 | Ga0495604_0034566 | 3300047317 | Bacteria | 3998 |
| 444 | Ga0495604_0046792 | 3300047317 | Bacteria | 3372 |
| 445 | Ga0495604_0061919 | 3300047317 | Bacteria | 2860 |
| 446 | Ga0495636_0001529 | 3300047318 | Bacteria | 8787 |
| 447 | Ga0495636_0003932 | 3300047318 | Bacteria | 5797 |
| 448 | Ga0495674_0003027 | 3300047319 | Bacteria | 16366 |
| 449 | Ga0495674_0068284 | 3300047319 | Bacteria | 3076 |
| 450 | Ga0495674_0108798 | 3300047319 | Bacteria | 2351 |
| 451 | Ga0495674_0168854 | 3300047319 | Bacteria | 1826 |
| 452 | Ga0495672_0000019 | 3300047320 | Bacteria | 448153 |
| 453 | Ga0495672_0000369 | 3300047320 | Bacteria | 56889 |
| 454 | Ga0495672_0002008 | 3300047320 | Bacteria | 19220 |
| 455 | Ga0495672_0002210 | 3300047320 | Bacteria | 18132 |
| 456 | Ga0495672_0003325 | 3300047320 | Bacteria | 13872 |
| 457 | Ga0495672_0003638 | 3300047320 | Bacteria | 13064 |
| 458 | Ga0495672_0036263 | 3300047320 | Bacteria | 3029 |
| 459 | Ga0495676_0016966 | 3300047321 | Bacteria | 6448 |
| 460 | Ga0495676_0042118 | 3300047321 | Bacteria | 3751 |
| 461 | Ga0495680_0015217 | 3300047322 | Bacteria | 6641 |
| 462 | Ga0495680_0023602 | 3300047322 | Bacteria | 5111 |
| 463 | Ga0495683_0080377 | 3300047323 | Bacteria | 1591 |
| 464 | Ga0495687_001155 | 3300047443 | Bacteria | 25561 |
| 465 | Ga0495687_008492 | 3300047443 | Bacteria | 5874 |
| 466 | Ga0495687_010933 | 3300047443 | Bacteria | 4925 |
| 467 | Ga0495687_022167 | 3300047443 | Bacteria | 3056 |
| 468 | Ga0495687_061619 | 3300047443 | Bacteria | 1542 |
| 469 | Ga0495675_0013857 | 3300047444 | Bacteria | 5096 |
| 470 | Ga0495677_0001723 | 3300047445 | Bacteria | 8776 |
| 471 | Ga0495677_0009011 | 3300047445 | Bacteria | 3690 |
| 472 | Ga0495677_0010710 | 3300047445 | Bacteria | 3360 |
| 473 | Ga0495679_000321 | 3300047446 | Bacteria | 38180 |
| 474 | Ga0495679_006469 | 3300047446 | Bacteria | 5037 |
| 475 | Ga0495679_008544 | 3300047446 | Bacteria | 4154 |
| 476 | Ga0495679_008890 | 3300047446 | Bacteria | 4053 |
| 477 | Ga0495685_000327 | 3300047447 | Bacteria | 15291 |
| 478 | Ga0495685_011991 | 3300047447 | Bacteria | 2931 |
| 479 | Ga0495685_061229 | 3300047447 | Bacteria | 1268 |
| 480 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 481 | Ga0495673_0000050 | 3300047469 | Bacteria | 262267 |
| 482 | Ga0495673_0000951 | 3300047469 | Bacteria | 26188 |
| 483 | Ga0495673_0003746 | 3300047469 | Bacteria | 9869 |
| 484 | Ga0495673_0004762 | 3300047469 | Bacteria | 8407 |
| 485 | Ga0495673_0086680 | 3300047469 | Bacteria | 1287 |
| 486 | Ga0495681_0021197 | 3300047470 | Bacteria | 3506 |
| 487 | Ga0495684_0029802 | 3300047471 | Bacteria | 4188 |
| 488 | Ga0495684_0196892 | 3300047471 | Bacteria | 1487 |
| 489 | Ga0495686_0000143 | 3300047472 | Bacteria | 143037 |
| 490 | Ga0495686_0000358 | 3300047472 | Bacteria | 74461 |
| 491 | Ga0495686_0000590 | 3300047472 | Bacteria | 50972 |
| 492 | Ga0495686_0002536 | 3300047472 | Bacteria | 17070 |
| 493 | Ga0495686_0004056 | 3300047472 | Bacteria | 12228 |
| 494 | Ga0495686_0005085 | 3300047472 | Bacteria | 10524 |
| 495 | Ga0495686_0024624 | 3300047472 | Bacteria | 3952 |
| 496 | Ga0495686_0040483 | 3300047472 | Bacteria | 2971 |
| 497 | Ga0495593_0011624 | 3300047673 | Bacteria | 5051 |
| 498 | Ga0495593_0026239 | 3300047673 | Bacteria | 3219 |
| 499 | Ga0495602_0012270 | 3300048088 | Bacteria | 8817 |
| 500 | Ga0495602_0190587 | 3300048088 | Bacteria | 1572 |
| 501 | Ga0495614_0009783 | 3300048089 | Bacteria | 4236 |
| 502 | Ga0495614_0019584 | 3300048089 | Bacteria | 2928 |
| 503 | Ga0495615_0000451 | 3300048090 | Bacteria | 5993 |
| 504 | Ga0495615_0050572 | 3300048090 | Bacteria | 1068 |
| 505 | Ga0496100_0081238 | 3300048903 | Bacteria | 2189 |
| 506 | Ga0496101_0000981 | 3300048904 | Bacteria | 16866 |
| 507 | Ga0496101_0013439 | 3300048904 | Bacteria | 5486 |
| 508 | Ga0496102_0022687 | 3300048905 | Bacteria | 5562 |
| 509 | Ga0496102_0032143 | 3300048905 | Bacteria | 4714 |
| 510 | Ga0496103_0004133 | 3300048906 | Bacteria | 8813 |
| 511 | Ga0496103_0031109 | 3300048906 | Bacteria | 3251 |
| 512 | Ga0496103_0198099 | 3300048906 | Bacteria | 1291 |
| 513 | Ga0496105_0005727 | 3300048908 | Bacteria | 9459 |
| 514 | Ga0496105_0095207 | 3300048908 | Bacteria | 2460 |
| 515 | Ga0496106_0074059 | 3300048909 | Bacteria | 2606 |
| 516 | Ga0496106_0110844 | 3300048909 | Bacteria | 2136 |
| 517 | Ga0496107_0000515 | 3300048910 | Bacteria | 21514 |
| 518 | Ga0496107_0172315 | 3300048910 | Bacteria | 1606 |
| 519 | Ga0496108_0398770 | 3300048911 | Bacteria | 1201 |
| 520 | Ga0496110_0002220 | 3300048913 | Bacteria | 14508 |
| 521 | Ga0496110_0024162 | 3300048913 | Bacteria | 5176 |
| 522 | Ga0496110_0234273 | 3300048913 | Bacteria | 1670 |
| 523 | Ga0496111_0036317 | 3300048914 | Bacteria | 3523 |
| 524 | Ga0496111_0217051 | 3300048914 | Bacteria | 1421 |
| 525 | Ga0496112_0137098 | 3300048915 | Bacteria | 2417 |
| 526 | Ga0496113_0323743 | 3300048916 | Bacteria | 1236 |
| 527 | Ga0496114_0011104 | 3300048917 | Bacteria | 7188 |
| 528 | Ga0496114_0019609 | 3300048917 | Bacteria | 5480 |
| 529 | Ga0496114_0028604 | 3300048917 | Bacteria | 4575 |
| 530 | Ga0496114_0069234 | 3300048917 | Bacteria | 2963 |
| 531 | Ga0496117_0038142 | 3300048920 | Bacteria | 3569 |
| 532 | Ga0496118_0000175 | 3300048921 | Bacteria | 115396 |
| 533 | Ga0496120_0147162 | 3300048923 | Bacteria | 1188 |
| 534 | Ga0496121_0000187 | 3300048924 | Bacteria | 138361 |
| 535 | Ga0496121_0002676 | 3300048924 | Bacteria | 26674 |
| 536 | Ga0496121_0015294 | 3300048924 | Bacteria | 8057 |
| 537 | Ga0496122_0000754 | 3300048925 | Bacteria | 62842 |
| 538 | Ga0496122_0016086 | 3300048925 | Bacteria | 7109 |
| 539 | Ga0496122_0018330 | 3300048925 | Bacteria | 6478 |
| 540 | Ga0496123_0000299 | 3300048926 | Bacteria | 96749 |
| 541 | Ga0496123_0002827 | 3300048926 | Bacteria | 20536 |
| 542 | Ga0496124_0093636 | 3300048927 | Bacteria | 2445 |
| 543 | Ga0496124_0140390 | 3300048927 | Bacteria | 1907 |
| 544 | Ga0496124_0146334 | 3300048927 | Bacteria | 1859 |
| 545 | Ga0496124_0233729 | 3300048927 | Bacteria | 1372 |
| 546 | Ga0496125_0007163 | 3300048928 | Bacteria | 11904 |
| 547 | Ga0496126_0000898 | 3300048929 | Bacteria | 51758 |
| 548 | Ga0496126_0001470 | 3300048929 | Bacteria | 36664 |
| 549 | Ga0496126_0011911 | 3300048929 | Bacteria | 8944 |
| 550 | Ga0495678_000630 | 3300049459 | Bacteria | 32774 |
| 551 | Ga0495678_001102 | 3300049459 | Bacteria | 22703 |
| 552 | Ga0495678_002129 | 3300049459 | Bacteria | 14033 |
| 553 | Ga0495682_0000239 | 3300049460 | Bacteria | 43540 |
| 554 | Ga0495682_0007290 | 3300049460 | Bacteria | 4410 |
| 555 | Ga0501033_0038492 | 3300049570 | Bacteria | 3575 |
| 556 | Ga0501043_0015056 | 3300049579 | Bacteria | 6057 |
| 557 | Ga0501249_006057 | 3300049679 | Bacteria | 2483 |
| 558 | Ga0501269_000550 | 3300049766 | Bacteria | 7137 |
| 559 | Ga0501044_0152070 | 3300049823 | Bacteria | 2296 |
| 560 | nmdc:mga03683_36280_c1 | 3300050489 | Bacteria | 2005 |
| 561 | nmdc:mga0k408_118719_c1 | 3300050493 | Bacteria | 1566 |
| 562 | nmdc:mga0k408_157818_c1 | 3300050493 | Bacteria | 1351 |
| 563 | nmdc:mga06z11_8010_c1 | 3300050494 | Bacteria | 4381 |
| 564 | nmdc:mga07m45_11641_c1 | 3300050496 | Bacteria | 4626 |
| 565 | nmdc:mga07m45_2701_c1 | 3300050496 | Bacteria | 8360 |
| 566 | nmdc:mga0sz30_3702_c1 | 3300050516 | Bacteria | 5511 |
| 567 | Ga0500578_0037027 | 3300053086 | Bacteria | 3133 |
| 568 | Ga0500644_0000132 | 3300053088 | Bacteria | 45910 |
| 569 | Ga0500644_0014342 | 3300053088 | Bacteria | 2235 |
| 570 | Ga0500650_0149548 | 3300053098 | Bacteria | 1080 |
| 571 | Ga0500593_018177 | 3300053117 | Bacteria | 3061 |
| 572 | Ga0500618_000024 | 3300053125 | Bacteria | 152149 |
| 573 | Ga0500618_000052 | 3300053125 | Bacteria | 102436 |
| 574 | Ga0500658_0004682 | 3300053134 | Bacteria | 5105 |
| 575 | Ga0500559_0001139 | 3300053136 | Bacteria | 16025 |
| 576 | Ga0500559_0016508 | 3300053136 | Bacteria | 3118 |
| 577 | Ga0500559_0034406 | 3300053136 | Bacteria | 2185 |
| 578 | Ga0500568_0008130 | 3300053139 | Bacteria | 5086 |
| 579 | Ga0500573_0097630 | 3300053140 | Bacteria | 1655 |
| 580 | Ga0500622_0011947 | 3300053156 | Bacteria | 4722 |
| 581 | Ga0500636_0003457 | 3300053177 | Bacteria | 8888 |
| 582 | Ga0500645_000911 | 3300053730 | Bacteria | 17004 |
| 583 | Ga0500645_010449 | 3300053730 | Bacteria | 3071 |
| 584 | Ga0500661_004366 | 3300055283 | Bacteria | 2647 |
| 585 | 2600811155 | 2600255067 | Bacteria | 6795583 |
| 586 | 2509128869 | 2508501125 | Bacteria | 7208311 |
| 587 | 2511247274 | 2511231002 | Bacteria | 5042903 |
| 588 | 2513553327 | 2513237082 | Bacteria | 8640282 |
| 589 | 2513564219 | 2513237083 | Bacteria | 8410967 |
| 590 | 2515679823 | 2515154122 | Bacteria | 8609520 |
| 591 | 2516021945 | 2515154189 | Bacteria | 9629850 |
| 592 | 2527079846 | 2526164713 | Bacteria | 6780608 |
| 593 | 2585148730 | 2582581279 | Bacteria | 4980720 |
| 594 | 2599739269 | 2599185239 | Bacteria | 8686614 |
| 595 | 2644253001 | 2643221645 | Bacteria | 7207331 |
| 596 | 2644339332 | 2643221660 | Bacteria | 4208257 |
| 597 | 2644354937 | 2643221664 | Bacteria | 7272945 |
| 598 | 2738737901 | 2738541280 | Bacteria | 6630198 |
| 599 | 2738828369 | 2738541297 | Bacteria | 6549566 |
| 600 | 2738842114 | 2738541300 | Bacteria | 6675882 |
| 601 | 2739152165 | 2738541357 | Bacteria | 6549408 |
| 602 | 2739193814 | 2738543003 | Bacteria | 6549560 |
| 603 | 2739272972 | 2738543018 | Bacteria | 6718814 |
| 604 | 2739320561 | 2738543026 | Bacteria | 6549408 |
| 605 | 2739338531 | 2738543029 | Bacteria | 6549249 |
| 606 | 2739342016 | 2738543030 | Bacteria | 6719714 |
| 607 | 2746091421 | 2744054900 | Bacteria | 8399525 |
| 608 | 2746097315 | 2744054901 | Bacteria | 8397047 |
| 609 | 2819636049 | 2818991452 | Bacteria | 8442785 |
| 610 | 2821449952 | 2821443989 | Bacteria | 7658172 |
| 611 | 2842713359 | 2842711865 | Bacteria | 7155354 |
| 612 | 2842737026 | 2842733646 | Bacteria | 5716726 |
| 613 | 2842750273 | 2842747753 | Bacteria | 5578255 |
| 614 | 2857561455 | 2857558681 | Bacteria | 6617694 |
| 615 | 2857569833 | 2857564685 | Bacteria | 6290584 |
| 616 | 2857580690 | 2857576091 | Bacteria | 5465855 |
| 617 | 2883093585 | 2883087390 | Bacteria | 9532701 |
| 618 | 2885275138 | 2885270888 | Bacteria | 9831543 |
| 619 | 2902690237 | 2902682994 | Bacteria | 8951596 |
| 620 | 2904425341 | 2904424332 | Bacteria | 7633521 |
| 621 | 2904489454 | 2904483920 | Bacteria | 7545285 |
| 622 | 2919531824 | 2919527303 | Bacteria | 7718827 |
| 623 | 2928176524 | 2928170801 | Bacteria | 8785406 |
| 624 | 2928529316 | 2928526807 | Bacteria | 4760224 |
| 625 | 8003960700 | 8003955200 | Bacteria | 8601927 |
| 626 | 8018853211 | 8018845410 | Bacteria | 8933938 |
| 627 | 8021124505 | 8021120328 | Bacteria | 8782274 |
| 628 | 8055270546 | 8055266321 | Bacteria | 7999742 |
| 629 | JGI25155J39150_1000059 | |||
| 630 | JGI25156J39149_1000081 | |||
| 631 | JGI25156J39149_1000477 | |||
| 632 | JGI25156J39149_1000957 | |||
| 633 | JGI25156J39149_1015503 | |||
| 634 | JGI25154J39366_1000109 | |||
| 635 | JGI25154J39366_1000834 | |||
| 636 | JGI25157J39369_1000103 | |||
| 637 | JGI25159J45721_1000488 | |||
| 638 | JGI25159J45721_1001139 | |||
| 639 | JGI25151J46595_10000370 | |||
| 640 | JGI25151J46595_10002071 | |||
| 641 | JGI25165J46597_1000785 | |||
| 642 | JGI25153J46596_10011848 | |||
| 643 | JGI25153J46596_10039913 | |||
| 644 | rootH1_10000270 | |||
| 645 | rootH2_10117627 | |||
| 646 | rootL2_10042248 | |||
| 647 | rootL2_10081604 | |||
| 648 | rootL2_10092949 | |||
| 649 | rootH1_10299132 | |||
| 650 | JGI25160J50197_1000431 | |||
| 651 | JGI25161J50226_1000077 | |||
| 652 | Ga0055533_1000089 | |||
| 653 | Ga0055533_1000348 | |||
| 654 | Ga0055532_1000014 | |||
| 655 | Ga0055532_1000278 | |||
| 656 | Ga0055527_1000013 | |||
| 657 | Ga0055535_1000011 | |||
| 658 | Ga0055535_1000452 | |||
| 659 | Ga0055542_1000018 | |||
| 660 | Ga0055529_1000017 | |||
| 661 | Ga0055529_1000076 | |||
| 662 | Ga0055529_1000472 | |||
| 663 | Ga0055529_1000926 | |||
| 664 | Ga0055526_1000001 | |||
| 665 | Ga0055526_1000672 | |||
| 666 | Ga0055537_1000077 | |||
| 667 | Ga0055524_1000084 | |||
| 668 | Ga0055524_1024568 | |||
| 669 | Ga0055534_1000165 | |||
| 670 | Ga0055528_1000492 | |||
| 671 | Ga0055530_10002145 | |||
| 672 | Ga0055530_10005720 | |||
| 673 | Ga0055530_10009500 | |||
| 674 | Ga0055540_1000086 | |||
| 675 | Ga0055531_10019491 | |||
| 676 | Ga0055543_1000685 | |||
| 677 | Ga0055543_1010012 | |||
| 678 | Ga0065165_1000007 | |||
| 679 | Ga0065165_1000294 | |||
| 680 | Ga0065165_1011904 | |||
| 681 | Ga0065165_1026398 | |||
| 682 | Ga0070690_100062178 | |||
| 683 | Ga0068868_100020817 | |||
| 684 | Ga0070669_100030065 | |||
| 685 | Ga0070669_100487157 | |||
| 686 | Ga0070667_100014746 | |||
| 687 | Ga0070667_100345037 | |||
| 688 | Ga0070678_100033043 | |||
| 689 | Ga0070678_100376431 | |||
| 690 | Ga0068853_100073187 | |||
| 691 | Ga0068852_100182331 | |||
| 692 | Ga0068859_100905159 | |||
| 693 | Ga0075368_10004357 | |||
| 694 | Ga0070712_100103541 | |||
| 695 | Ga0075362_10016380 | |||
| 696 | Ga0075362_10021049 | |||
| 697 | Ga0075367_10254405 | |||
| 698 | Ga0075369_10057168 | |||
| 699 | Ga0075366_10060808 | |||
| 700 | Ga0075366_10120441 | |||
| 701 | Ga0075366_10238336 | |||
| 702 | Ga0075370_10004578 | |||
| 703 | Ga0075370_10015894 | |||
| 704 | Ga0097620_100904953 | |||
| 705 | Ga0079104_1000100 | |||
| 706 | Ga0105251_10113629 | |||
| 707 | Ga0105244_10004115 | |||
| 708 | Ga0105244_10005426 | |||
| 709 | Ga0105237_10003783 | |||
| 710 | Ga0105238_10028150 | |||
| 711 | Ga0105239_10000623 | |||
| 712 | Ga0105239_10564140 | |||
| 713 | Ga0157369_10005320 | |||
| 714 | Ga0157378_10062477 | |||
| 715 | Ga0163162_10028252 | |||
| 716 | Ga0163162_10084686 | |||
| 717 | Ga0163162_10278875 | |||
| 718 | Ga0182007_10006203 | |||
| 719 | Ga0183361_10003 | |||
| 720 | Ga0163161_10027436 | |||
| 721 | Ga0213872_10000014 | |||
| 722 | Ga0213872_10000363 | |||
| 723 | Ga0213872_10000894 | |||
| 724 | Ga0213872_10003590 | |||
| 725 | Ga0213872_10025154 | |||
| 726 | Ga0213872_10034254 | |||
| 727 | Ga0213872_10043974 | |||
| 728 | Ga0213872_10079269 | |||
| 729 | Ga0213872_10105725 | |||
| 730 | Ga0209435_100047 | |||
| 731 | Ga0209674_100051 | |||
| 732 | Ga0209674_100112 | |||
| 733 | Ga0209672_100027 | |||
| 734 | Ga0209147_100021 | |||
| 735 | Ga0209147_100035 | |||
| 736 | Ga0209563_102067 | |||
| 737 | Ga0207427_100297 | |||
| 738 | Ga0209258_100052 | |||
| 739 | Ga0209258_100501 | |||
| 740 | Ga0207425_1000159 | |||
| 741 | Ga0207425_1020066 | |||
| 742 | Ga0209646_1000038 | |||
| 743 | Ga0209646_1000054 | |||
| 744 | Ga0209026_1000180 | |||
| 745 | Ga0209026_1001901 | |||
| 746 | Ga0209677_102326 | |||
| 747 | Ga0209148_1000064 | |||
| 748 | Ga0209148_1009751 | |||
| 749 | Ga0209759_1000015 | |||
| 750 | Ga0209759_1000125 | |||
| 751 | Ga0209759_1000205 | |||
| 752 | Ga0209759_1001148 | |||
| 753 | Ga0209759_1003364 | |||
| 754 | Ga0209129_1005364 | |||
| 755 | Ga0209233_1000073 | |||
| 756 | Ga0209565_1000003 | |||
| 757 | Ga0209565_1000771 | |||
| 758 | Ga0209455_1000057 | |||
| 759 | Ga0209455_1000073 | |||
| 760 | Ga0209455_1000341 | |||
| 761 | Ga0209673_1000003 | |||
| 762 | Ga0209130_1000040 | |||
| 763 | Ga0209130_1000306 | |||
| 764 | Ga0209675_1000003 | |||
| 765 | Ga0209675_1003383 | |||
| 766 | Ga0209675_1016911 | |||
| 767 | Ga0209676_1000476 | |||
| 768 | Ga0209676_1002341 | |||
| 769 | Ga0209025_1000061 | |||
| 770 | Ga0209025_1002648 | |||
| 771 | Ga0209025_1005800 | |||
| 772 | Ga0209025_1013541 | |||
| 773 | Ga0209564_1000002 | |||
| 774 | Ga0209564_1000011 | |||
| 775 | Ga0209564_1000012 | |||
| 776 | Ga0209564_1001283 | |||
| 777 | Ga0209564_1008278 | |||
| 778 | Ga0209758_1000249 | |||
| 779 | Ga0209758_1001391 | |||
| 780 | Ga0209758_1003600 | |||
| 781 | Ga0209050_1000053 | |||
| 782 | Ga0209050_1000506 | |||
| 783 | Ga0209050_1002675 | |||
| 784 | Ga0209050_1008406 | |||
| 785 | Ga0209256_1000029 | |||
| 786 | Ga0209256_1000071 | |||
| 787 | Ga0207426_1000359 | |||
| 788 | Ga0209051_1000210 | |||
| 789 | Ga0209051_1001779 | |||
| 790 | Ga0209257_1000314 | |||
| 791 | Ga0209257_1000316 | |||
| 792 | Ga0209257_1006323 | |||
| 793 | Ga0209257_1011179 | |||
| 794 | Ga0209257_1012588 | |||
| 795 | Ga0207655_1020772 | |||
| 796 | Ga0207647_10012621 | |||
| 797 | Ga0207671_10008408 | |||
| 798 | Ga0207693_10029893 | |||
| 799 | Ga0207681_10176098 | |||
| 800 | Ga0207665_10219201 | |||
| 801 | Ga0207691_10114281 | |||
| 802 | Ga0207689_10086122 | |||
| 803 | Ga0207658_10091847 | |||
| 804 | Ga0207658_10350035 | |||
| 805 | Ga0207677_10016814 | |||
| 806 | Ga0207639_10184582 | |||
| 807 | Ga0207639_10210691 | |||
| 808 | Ga0207641_10033387 | |||
| 809 | Ga0207676_10017519 | |||
| 810 | Ga0207683_10052169 | |||
| 811 | Ga0207683_10075406 | |||
| 812 | Ga0207698_10129856 | |||
| 813 | Ga0209281_1000084 | |||
| 814 | Ga0209371_1007459 | |||
| 815 | Ga0268264_10120234 | |||
| 816 | Ga0265336_10000111 | |||
| 817 | Ga0307515_10289783 | |||
| 818 | Ga0307515_10338347 | |||
| 819 | Ga0265324_10002789 | |||
| 820 | Ga0268256_1007679 | |||
| 821 | Ga0307511_10000056 | |||
| 822 | Ga0316177_1072788 | |||
| 823 | Ga0316180_1052560 | |||
| 824 | Ga0307513_10307563 | |||
| 825 | Ga0307408_100008377 | |||
| 826 | Ga0307408_100295245 | |||
| 827 | Ga0307516_10003006 | |||
| 828 | Ga0307516_10022947 | |||
| 829 | Ga0307406_10070468 | |||
| 830 | Ga0373934_0007593 | |||
| 831 | Ga0395898_0004799 | |||
| 832 | Ga0395898_0098319 | |||
| 833 | Ga0395901_0000079 | |||
| 834 | Ga0395901_0005069 | |||
| 835 | Ga0436361_0156472 | |||
| 836 | Ga0436361_0295570 | |||
| 837 | Ga0436361_0344276 | |||
| 838 | Ga0436361_0434209 | |||
| 839 | Ga0436361_0700633 | |||
| 840 | Ga0436361_0865069 | |||
| 841 | Ga0436361_1112214 | |||
| 842 | Ga0436361_1145940 | |||
| 843 | Ga0439436_0000199 | |||
| 844 | Ga0439439_0023454 | |||
| 845 | Ga0439449_0008250 | |||
| 846 | Ga0466965_0036307 | |||
| 847 | Ga0466968_0101508 | |||
| 848 | Ga0495617_000285 | |||
| 849 | Ga0495617_000629 | |||
| 850 | Ga0495617_001983 | |||
| 851 | Ga0495617_015539 | |||
| 852 | Ga0495592_0011088 | |||
| 853 | Ga0495592_0077764 | |||
| 854 | Ga0495592_0092383 | |||
| 855 | Ga0495603_0002032 | |||
| 856 | Ga0495603_0015559 | |||
| 857 | Ga0495590_0000002 | |||
| 858 | Ga0495590_0014452 | |||
| 859 | Ga0495629_0001421 | |||
| 860 | Ga0495629_0003207 | |||
| 861 | Ga0495629_0017898 | |||
| 862 | Ga0495638_0000030 | |||
| 863 | Ga0495638_0004879 | |||
| 864 | Ga0495641_0020814 | |||
| 865 | Ga0495651_0032429 | |||
| 866 | Ga0495651_0094199 | |||
| 867 | Ga0495651_0251833 | |||
| 868 | Ga0495653_0000005 | |||
| 869 | Ga0495653_0034722 | |||
| 870 | Ga0495653_0041185 | |||
| 871 | Ga0495653_0110585 | |||
| 872 | Ga0495650_0000067 | |||
| 873 | Ga0495650_0000385 | |||
| 874 | Ga0495650_0003168 | |||
| 875 | Ga0495650_0008424 | |||
| 876 | Ga0495650_0009509 | |||
| 877 | Ga0495650_0012274 | |||
| 878 | Ga0495650_0013800 | |||
| 879 | Ga0495650_0112249 | |||
| 880 | Ga0495580_0000183 | |||
| 881 | Ga0495580_0002954 | |||
| 882 | Ga0495580_0006601 | |||
| 883 | Ga0495580_0012034 | |||
| 884 | Ga0495580_0047056 | |||
| 885 | Ga0495582_0004221 | |||
| 886 | Ga0495582_0010606 | |||
| 887 | Ga0495582_0328369 | |||
| 888 | Ga0495605_0000073 | |||
| 889 | Ga0495605_0006264 | |||
| 890 | Ga0495639_0003400 | |||
| 891 | Ga0495639_0007560 | |||
| 892 | Ga0495662_0020387 | |||
| 893 | Ga0495662_0043649 | |||
| 894 | Ga0495664_0001680 | |||
| 895 | Ga0495664_0002758 | |||
| 896 | Ga0495664_0004994 | |||
| 897 | Ga0495584_0000016 | |||
| 898 | Ga0495584_0101339 | |||
| 899 | Ga0495585_0003881 | |||
| 900 | Ga0495585_0004708 | |||
| 901 | Ga0495585_0028940 | |||
| 902 | Ga0495585_0048595 | |||
| 903 | Ga0495594_0245952 | |||
| 904 | Ga0495596_0002408 | |||
| 905 | Ga0495607_0000219 | |||
| 906 | Ga0495607_0001517 | |||
| 907 | Ga0495607_0001827 | |||
| 908 | Ga0495607_0044621 | |||
| 909 | Ga0495607_0117844 | |||
| 910 | Ga0495583_0000029 | |||
| 911 | Ga0495583_0000058 | |||
| 912 | Ga0495583_0000113 | |||
| 913 | Ga0495583_0013348 | |||
| 914 | Ga0495583_0018439 | |||
| 915 | Ga0495583_0133575 | |||
| 916 | Ga0495606_0000049 | |||
| 917 | Ga0495606_0000381 | |||
| 918 | Ga0495606_0000422 | |||
| 919 | Ga0495606_0001776 | |||
| 920 | Ga0495606_0002831 | |||
| 921 | Ga0495606_0004619 | |||
| 922 | Ga0495606_0027046 | |||
| 923 | Ga0495608_0009673 | |||
| 924 | Ga0495608_0057849 | |||
| 925 | Ga0495610_0000012 | |||
| 926 | Ga0495610_0002552 | |||
| 927 | Ga0495610_0007104 | |||
| 928 | Ga0495610_0048317 | |||
| 929 | Ga0495610_0052229 | |||
| 930 | Ga0495616_0002322 | |||
| 931 | Ga0495616_0024647 | |||
| 932 | Ga0495618_0017609 | |||
| 933 | Ga0495628_0004640 | |||
| 934 | Ga0495628_0006852 | |||
| 935 | Ga0495628_0068082 | |||
| 936 | Ga0495628_0082804 | |||
| 937 | Ga0495630_0029737 | |||
| 938 | Ga0495630_0037927 | |||
| 939 | Ga0495630_0236289 | |||
| 940 | Ga0495632_0004689 | |||
| 941 | Ga0495637_0001275 | |||
| 942 | Ga0495643_0000011 | |||
| 943 | Ga0495643_0000078 | |||
| 944 | Ga0495644_0000967 | |||
| 945 | Ga0495644_0002934 | |||
| 946 | Ga0495644_0039222 | |||
| 947 | Ga0495648_0000009 | |||
| 948 | Ga0495648_0002444 | |||
| 949 | Ga0495648_0006254 | |||
| 950 | Ga0495648_0009797 | |||
| 951 | Ga0495648_0012276 | |||
| 952 | Ga0495648_0012288 | |||
| 953 | Ga0495648_0017753 | |||
| 954 | Ga0495648_0023719 | |||
| 955 | Ga0495648_0023740 | |||
| 956 | Ga0495648_0036988 | |||
| 957 | Ga0495663_0002855 | |||
| 958 | Ga0495663_0003293 | |||
| 959 | Ga0495666_0001075 | |||
| 960 | Ga0495666_0002585 | |||
| 961 | Ga0495666_0006590 | |||
| 962 | Ga0495666_0012104 | |||
| 963 | Ga0495642_0005575 | |||
| 964 | Ga0495642_0017008 | |||
| 965 | Ga0495642_0024533 | |||
| 966 | Ga0495642_0028310 | |||
| 967 | Ga0495652_0010507 | |||
| 968 | Ga0495652_0114881 | |||
| 969 | Ga0495652_0255603 | |||
| 970 | Ga0495652_0317994 | |||
| 971 | Ga0495654_0000011 | |||
| 972 | Ga0495654_0052378 | |||
| 973 | Ga0495665_0008679 | |||
| 974 | Ga0495665_0016089 | |||
| 975 | Ga0495665_0060357 | |||
| 976 | Ga0495640_0006014 | |||
| 977 | Ga0495640_0020445 | |||
| 978 | Ga0495586_0009365 | |||
| 979 | Ga0495586_0064330 | |||
| 980 | Ga0495586_0111034 | |||
| 981 | Ga0495587_0012720 | |||
| 982 | Ga0495587_0021846 | |||
| 983 | Ga0495609_0000054 | |||
| 984 | Ga0495609_0064812 | |||
| 985 | Ga0495597_0000014 | |||
| 986 | Ga0495597_0000362 | |||
| 987 | Ga0495597_0043475 | |||
| 988 | Ga0495597_0066839 | |||
| 989 | Ga0495645_0001543 | |||
| 990 | Ga0495645_0019470 | |||
| 991 | Ga0495622_0000002 | |||
| 992 | Ga0495622_0000018 | |||
| 993 | Ga0495622_0001368 | |||
| 994 | Ga0495633_0000041 | |||
| 995 | Ga0495633_0000047 | |||
| 996 | Ga0495633_0001049 | |||
| 997 | Ga0495633_0001874 | |||
| 998 | Ga0495633_0007614 | |||
| 999 | Ga0495633_0039613 | |||
| 1000 | Ga0495633_0159095 | |||
| 1001 | Ga0495667_0021458 | |||
| 1002 | Ga0495656_0008463 | |||
| 1003 | Ga0495656_0121524 | |||
| 1004 | Ga0495668_0000020 | |||
| 1005 | Ga0495668_0000077 | |||
| 1006 | Ga0495668_0000750 | |||
| 1007 | Ga0495668_0002404 | |||
| 1008 | Ga0495668_0019403 | |||
| 1009 | Ga0495634_0034718 | |||
| 1010 | Ga0495634_0047786 | |||
| 1011 | Ga0495611_0003441 | |||
| 1012 | Ga0495611_0003837 | |||
| 1013 | Ga0495611_0009879 | |||
| 1014 | Ga0495625_0000023 | |||
| 1015 | Ga0495625_0000721 | |||
| 1016 | Ga0495625_0003924 | |||
| 1017 | Ga0495625_0009136 | |||
| 1018 | Ga0495625_0059480 | |||
| 1019 | Ga0495625_0082040 | |||
| 1020 | Ga0495625_0085478 | |||
| 1021 | Ga0495625_0097742 | |||
| 1022 | Ga0495625_0407929 | |||
| 1023 | Ga0495635_0001086 | |||
| 1024 | Ga0495635_0001345 | |||
| 1025 | Ga0495635_0198231 | |||
| 1026 | Ga0495659_0000012 | |||
| 1027 | Ga0495659_0000155 | |||
| 1028 | Ga0495661_0023956 | |||
| 1029 | Ga0495661_0025145 | |||
| 1030 | Ga0495661_0042851 | |||
| 1031 | Ga0495588_0048900 | |||
| 1032 | Ga0495588_0051996 | |||
| 1033 | Ga0495657_0057553 | |||
| 1034 | Ga0495623_0007343 | |||
| 1035 | Ga0495623_0086121 | |||
| 1036 | Ga0495646_0002226 | |||
| 1037 | Ga0495646_0005808 | |||
| 1038 | Ga0495646_0010615 | |||
| 1039 | Ga0495646_0041779 | |||
| 1040 | Ga0495669_0003596 | |||
| 1041 | Ga0495669_0035024 | |||
| 1042 | Ga0495613_0000702 | |||
| 1043 | Ga0495613_0014097 | |||
| 1044 | Ga0495613_0019525 | |||
| 1045 | Ga0495624_0001390 | |||
| 1046 | Ga0495624_0007668 | |||
| 1047 | Ga0495624_0037528 | |||
| 1048 | Ga0495624_0043821 | |||
| 1049 | Ga0495624_0070239 | |||
| 1050 | Ga0495670_0004550 | |||
| 1051 | Ga0495670_0022998 | |||
| 1052 | Ga0495671_0000006 | |||
| 1053 | Ga0495671_0000145 | |||
| 1054 | Ga0495671_0018495 | |||
| 1055 | Ga0495671_0028885 | |||
| 1056 | Ga0495671_0071502 | |||
| 1057 | Ga0495649_0002043 | |||
| 1058 | Ga0495649_0003667 | |||
| 1059 | Ga0495649_0008694 | |||
| 1060 | Ga0495649_0037498 | |||
| 1061 | Ga0495589_0006404 | |||
| 1062 | Ga0495589_0008587 | |||
| 1063 | Ga0495589_0051063 | |||
| 1064 | Ga0495600_0010468 | |||
| 1065 | Ga0495600_0094155 | |||
| 1066 | Ga0495660_0001355 | |||
| 1067 | Ga0495660_0007238 | |||
| 1068 | Ga0495660_0016445 | |||
| 1069 | Ga0495660_0067772 | |||
| 1070 | Ga0495660_0105313 | |||
| 1071 | Ga0495604_0034566 | |||
| 1072 | Ga0495604_0046792 | |||
| 1073 | Ga0495604_0061919 | |||
| 1074 | Ga0495636_0001529 | |||
| 1075 | Ga0495636_0003932 | |||
| 1076 | Ga0495674_0003027 | |||
| 1077 | Ga0495674_0068284 | |||
| 1078 | Ga0495674_0108798 | |||
| 1079 | Ga0495674_0168854 | |||
| 1080 | Ga0495672_0000019 | |||
| 1081 | Ga0495672_0000369 | |||
| 1082 | Ga0495672_0002008 | |||
| 1083 | Ga0495672_0002210 | |||
| 1084 | Ga0495672_0003325 | |||
| 1085 | Ga0495672_0003638 | |||
| 1086 | Ga0495672_0036263 | |||
| 1087 | Ga0495676_0016966 | |||
| 1088 | Ga0495676_0042118 | |||
| 1089 | Ga0495680_0015217 | |||
| 1090 | Ga0495680_0023602 | |||
| 1091 | Ga0495683_0080377 | |||
| 1092 | Ga0495687_001155 | |||
| 1093 | Ga0495687_008492 | |||
| 1094 | Ga0495687_010933 | |||
| 1095 | Ga0495687_022167 | |||
| 1096 | Ga0495687_061619 | |||
| 1097 | Ga0495675_0013857 | |||
| 1098 | Ga0495677_0001723 | |||
| 1099 | Ga0495677_0009011 | |||
| 1100 | Ga0495677_0010710 | |||
| 1101 | Ga0495679_000321 | |||
| 1102 | Ga0495679_006469 | |||
| 1103 | Ga0495679_008544 | |||
| 1104 | Ga0495679_008890 | |||
| 1105 | Ga0495685_000327 | |||
| 1106 | Ga0495685_011991 | |||
| 1107 | Ga0495685_061229 | |||
| 1108 | Ga0495673_0000003 | |||
| 1109 | Ga0495673_0000050 | |||
| 1110 | Ga0495673_0000951 | |||
| 1111 | Ga0495673_0003746 | |||
| 1112 | Ga0495673_0004762 | |||
| 1113 | Ga0495673_0086680 | |||
| 1114 | Ga0495681_0021197 | |||
| 1115 | Ga0495684_0029802 | |||
| 1116 | Ga0495684_0196892 | |||
| 1117 | Ga0495686_0000143 | |||
| 1118 | Ga0495686_0000358 | |||
| 1119 | Ga0495686_0000590 | |||
| 1120 | Ga0495686_0002536 | |||
| 1121 | Ga0495686_0004056 | |||
| 1122 | Ga0495686_0005085 | |||
| 1123 | Ga0495686_0024624 | |||
| 1124 | Ga0495686_0040483 | |||
| 1125 | Ga0495593_0011624 | |||
| 1126 | Ga0495593_0026239 | |||
| 1127 | Ga0495602_0012270 | |||
| 1128 | Ga0495602_0190587 | |||
| 1129 | Ga0495614_0009783 | |||
| 1130 | Ga0495614_0019584 | |||
| 1131 | Ga0495615_0000451 | |||
| 1132 | Ga0495615_0050572 | |||
| 1133 | Ga0496100_0081238 | |||
| 1134 | Ga0496101_0000981 | |||
| 1135 | Ga0496101_0013439 | |||
| 1136 | Ga0496102_0022687 | |||
| 1137 | Ga0496102_0032143 | |||
| 1138 | Ga0496103_0004133 | |||
| 1139 | Ga0496103_0031109 | |||
| 1140 | Ga0496103_0198099 | |||
| 1141 | Ga0496105_0005727 | |||
| 1142 | Ga0496105_0095207 | |||
| 1143 | Ga0496106_0074059 | |||
| 1144 | Ga0496106_0110844 | |||
| 1145 | Ga0496107_0000515 | |||
| 1146 | Ga0496107_0172315 | |||
| 1147 | Ga0496108_0398770 | |||
| 1148 | Ga0496110_0002220 | |||
| 1149 | Ga0496110_0024162 | |||
| 1150 | Ga0496110_0234273 | |||
| 1151 | Ga0496111_0036317 | |||
| 1152 | Ga0496111_0217051 | |||
| 1153 | Ga0496112_0137098 | |||
| 1154 | Ga0496113_0323743 | |||
| 1155 | Ga0496114_0011104 | |||
| 1156 | Ga0496114_0019609 | |||
| 1157 | Ga0496114_0028604 | |||
| 1158 | Ga0496114_0069234 | |||
| 1159 | Ga0496117_0038142 | |||
| 1160 | Ga0496118_0000175 | |||
| 1161 | Ga0496120_0147162 | |||
| 1162 | Ga0496121_0000187 | |||
| 1163 | Ga0496121_0002676 | |||
| 1164 | Ga0496121_0015294 | |||
| 1165 | Ga0496122_0000754 | |||
| 1166 | Ga0496122_0016086 | |||
| 1167 | Ga0496122_0018330 | |||
| 1168 | Ga0496123_0000299 | |||
| 1169 | Ga0496123_0002827 | |||
| 1170 | Ga0496124_0093636 | |||
| 1171 | Ga0496124_0140390 | |||
| 1172 | Ga0496124_0146334 | |||
| 1173 | Ga0496124_0233729 | |||
| 1174 | Ga0496125_0007163 | |||
| 1175 | Ga0496126_0000898 | |||
| 1176 | Ga0496126_0001470 | |||
| 1177 | Ga0496126_0011911 | |||
| 1178 | Ga0495678_000630 | |||
| 1179 | Ga0495678_001102 | |||
| 1180 | Ga0495678_002129 | |||
| 1181 | Ga0495682_0000239 | |||
| 1182 | Ga0495682_0007290 | |||
| 1183 | Ga0501033_0038492 | |||
| 1184 | Ga0501043_0015056 | |||
| 1185 | Ga0501249_006057 | |||
| 1186 | Ga0501269_000550 | |||
| 1187 | Ga0501044_0152070 | |||
| 1188 | nmdc:mga03683_36280_c1 | |||
| 1189 | nmdc:mga0k408_118719_c1 | |||
| 1190 | nmdc:mga0k408_157818_c1 | |||
| 1191 | nmdc:mga06z11_8010_c1 | |||
| 1192 | nmdc:mga07m45_11641_c1 | |||
| 1193 | nmdc:mga07m45_2701_c1 | |||
| 1194 | nmdc:mga0sz30_3702_c1 | |||
| 1195 | Ga0500578_0037027 | |||
| 1196 | Ga0500644_0000132 | |||
| 1197 | Ga0500644_0014342 | |||
| 1198 | Ga0500650_0149548 | |||
| 1199 | Ga0500593_018177 | |||
| 1200 | Ga0500618_000024 | |||
| 1201 | Ga0500618_000052 | |||
| 1202 | Ga0500658_0004682 | |||
| 1203 | Ga0500559_0001139 | |||
| 1204 | Ga0500559_0016508 | |||
| 1205 | Ga0500559_0034406 | |||
| 1206 | Ga0500568_0008130 | |||
| 1207 | Ga0500573_0097630 | |||
| 1208 | Ga0500622_0011947 | |||
| 1209 | Ga0500636_0003457 | |||
| 1210 | Ga0500645_000911 | |||
| 1211 | Ga0500645_010449 | |||
| 1212 | Ga0500661_004366 | |||
| 1213 | 2600811155 | |||
| 1214 | 2509128869 | |||
| 1215 | 2511247274 | |||
| 1216 | 2513553327 | |||
| 1217 | 2513564219 | |||
| 1218 | 2515679823 | |||
| 1219 | 2516021945 | |||
| 1220 | 2527079846 | |||
| 1221 | 2585148730 | |||
| 1222 | 2599739269 | |||
| 1223 | 2644253001 | |||
| 1224 | 2644339332 | |||
| 1225 | 2644354937 | |||
| 1226 | 2738737901 | |||
| 1227 | 2738828369 | |||
| 1228 | 2738842114 | |||
| 1229 | 2739152165 | |||
| 1230 | 2739193814 | |||
| 1231 | 2739272972 | |||
| 1232 | 2739320561 | |||
| 1233 | 2739338531 | |||
| 1234 | 2739342016 | |||
| 1235 | 2746091421 | |||
| 1236 | 2746097315 | |||
| 1237 | 2819636049 | |||
| 1238 | 2821449952 | |||
| 1239 | 2842713359 | |||
| 1240 | 2842737026 | |||
| 1241 | 2842750273 | |||
| 1242 | 2857561455 | |||
| 1243 | 2857569833 | |||
| 1244 | 2857580690 | |||
| 1245 | 2883093585 | |||
| 1246 | 2885275138 | |||
| 1247 | 2902690237 | |||
| 1248 | 2904425341 | |||
| 1249 | 2904489454 | |||
| 1250 | 2919531824 | |||
| 1251 | 2928176524 | |||
| 1252 | 2928529316 | |||
| 1253 | 8003960700 | |||
| 1254 | 8018853211 | |||
| 1255 | 8021124505 | |||
| 1256 | 8055270546 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ihs-assembly1.cif.gz_A | crystal structure of benm_dbd/catb site 1 dna complex | 0.9492 | 1 | 87 |
| 4ihs-assembly3.cif.gz_C | crystal structure of benm_dbd/catb site 1 dna complex | 0.9454 | 1 | 87 |
| 4iht-assembly1.cif.gz_A | crystal structure of benm_dbd/bena site 1 dna complex | 0.9376 | 1 | 87 |
| 4iht-assembly2.cif.gz_C | crystal structure of benm_dbd/bena site 1 dna complex | 0.9361 | 1 | 86 |
| 5z4y-assembly1.cif.gz_B | crystal structure of pacysb ntd domain with space group p4 | 0.9335 | 4 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37682_6_92_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9782 | 4 | 87 | 1.10.10.10 |
| af_P30864_1_87_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9711 | 4 | 85 | 1.10.10.10 |
| 3fzvC01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9641 | 4 | 73 | 1.10.10.10 |
| af_P67662_3_85_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9636 | 3 | 79 | 1.10.10.10 |
| af_P27111_3_88_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9619 | 5 | 77 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y4T7C7-F1-model_v4 | LysR family transcriptional regulator | 0.9518 | 109 | 299 |
GO:0003700
GO:0006351 GO:0043565 |
| AF-A0A850QN73-F1-model_v4 | LysR family transcriptional regulator | 0.9348 | 96 | 300 |
GO:0003700
GO:0006351 GO:0043565 |
| AF-A0A1Q9QL98-F1-model_v4 | deleted | 0.9331 | 1 | 303 |
|
| AF-A0A5C8BTK9-F1-model_v4 | LysR family transcriptional regulator | 0.9314 | 118 | 297 |
GO:0003700
GO:0006351 GO:0043565 |
| AF-A0A850QN73-F1-model_v4 | LysR family transcriptional regulator | 0.9262 | 96 | 300 |
GO:0003700
GO:0006351 GO:0043565 |