F470692

General Info

Members Datasets Scaffolds Average Seq Length
628 307 1256 305

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2600255067|2600811155
Length 323
Sequence RAYEVFVTVVSRGSFTRAADALETSPANVTRYVNELEAHLGTRLINRTSRKLSLTEGGETLYARCKSILDDVVETEGLVSSASVEPRGRLRINAPVSFGILYLAPLWPEFMRRYPRVELDVALIDRVVDIVDEGYDLAIRISRTGSTNHAARKLATSRNIVCASPDYLERCGHPATPADLAGHQCIGYLYASTGDEWQLIDSKGHAHAVKVNYHMRSNNGDTARAAALAGQGVIWQPTFLVGNDLRAGKLVQILPEYRLPDIDVLALYPSRRHLSAKIRAMIDFLAEAFGGVAPWDREITARPGQAGPDAPRDYCSGVRIGAP

Samples

Sample ID Description Type Environment
1 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
61 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
105 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
110 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
113 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
123 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
124 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
207 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
208 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
209 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
210 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
240 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
244 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
252 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
253 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
254 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
255 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
256 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
257 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
258 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
259 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
260 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
261 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
262 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
263 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
264 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
265 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
266 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
267 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
268 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
269 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
270 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
271 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
272 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
273 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
274 2643221645 Massilia sp. Root351 Isolate Unclassified
275 2643221660 Methylibium sp. Root1272 Isolate Unclassified
276 2643221664 Massilia sp. Root418 Isolate Unclassified
277 2738541280 Massilia sp. GV090 Isolate Unclassified
278 2738541297 Duganella sp. GV083 Isolate Unclassified
279 2738541300 Massilia sp. GV016 Isolate Unclassified
280 2738541357 Duganella sp. GV053 Isolate Unclassified
281 2738543003 Duganella sp. GV066 Isolate Unclassified
282 2738543018 Massilia sp. GV045 Isolate Unclassified
283 2738543026 Duganella sp. GV089 Isolate Unclassified
284 2738543029 Duganella sp. GV039 Isolate Unclassified
285 2738543030 Massilia sp. GV097 Isolate Unclassified
286 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
287 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
288 2818991452 Burkholderia cepacia 561 Isolate Unclassified
289 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
290 2842711865 Duganella sp. R-73148 Isolate Unclassified
291 2842733646 Variovorax sp. R-72446 Isolate Unclassified
292 2842747753 Variovorax sp. R-72060 Isolate Unclassified
293 2857558681 Duganella sp. R-74565 Isolate Unclassified
294 2857564685 Duganella sp. R-74599 Isolate Unclassified
295 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
296 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
297 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
298 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
299 2904424332 Duganella sp. 1411 Isolate Rhizosphere
300 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
301 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
302 2928170801 Burkholderia sp. 572 Isolate Unclassified
303 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
304 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
305 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
306 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
307 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.99
Metatranscriptomes 0
Isolates 7.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.54
Nodule 1.43
Rhizoplane 4.3
Rhizosphere 61.15
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000059 3300002704 Bacteria 72038
2 JGI25156J39149_1000081 3300002705 Bacteria 72221
3 JGI25156J39149_1000477 3300002705 Bacteria 24122
4 JGI25156J39149_1000957 3300002705 Bacteria 13722
5 JGI25156J39149_1015503 3300002705 Bacteria 1519
6 JGI25154J39366_1000109 3300002738 Bacteria 72431
7 JGI25154J39366_1000834 3300002738 Bacteria 13407
8 JGI25157J39369_1000103 3300002741 Bacteria 72221
9 JGI25159J45721_1000488 3300002987 Bacteria 18147
10 JGI25159J45721_1001139 3300002987 Bacteria 11361
11 JGI25151J46595_10000370 3300003187 Bacteria 47135
12 JGI25151J46595_10002071 3300003187 Bacteria 12502
13 JGI25165J46597_1000785 3300003214 Bacteria 24113
14 JGI25153J46596_10011848 3300003215 Bacteria 3821
15 JGI25153J46596_10039913 3300003215 Bacteria 1462
16 rootH1_10000270 3300003316 Bacteria 3725
17 rootH2_10117627 3300003320 Bacteria 1144
18 rootL2_10042248 3300003322 Bacteria 2095
19 rootL2_10081604 3300003322 Bacteria 2942
20 rootL2_10092949 3300003322 Bacteria 2424
21 rootH1_10299132 3300003323 Bacteria 1354
22 JGI25160J50197_1000431 3300003354 Bacteria 26412
23 JGI25161J50226_1000077 3300003374 Bacteria 83588
24 Ga0055533_1000089 3300003756 Bacteria 122130
25 Ga0055533_1000348 3300003756 Bacteria 20059
26 Ga0055532_1000014 3300003758 Bacteria 344702
27 Ga0055532_1000278 3300003758 Bacteria 33197
28 Ga0055527_1000013 3300003760 Bacteria 347416
29 Ga0055535_1000011 3300003761 Bacteria 347416
30 Ga0055535_1000452 3300003761 Bacteria 37867
31 Ga0055542_1000018 3300003762 Bacteria 347416
32 Ga0055529_1000017 3300003763 Bacteria 347416
33 Ga0055529_1000076 3300003763 Bacteria 156104
34 Ga0055529_1000472 3300003763 Bacteria 38618
35 Ga0055529_1000926 3300003763 Bacteria 15752
36 Ga0055526_1000001 3300003771 Bacteria 669703
37 Ga0055526_1000672 3300003771 Bacteria 26203
38 Ga0055537_1000077 3300003773 Bacteria 70424
39 Ga0055524_1000084 3300003775 Bacteria 119107
40 Ga0055524_1024568 3300003775 Bacteria 1908
41 Ga0055534_1000165 3300003784 Bacteria 49321
42 Ga0055528_1000492 3300003790 Bacteria 31211
43 Ga0055530_10002145 3300003791 Bacteria 13081
44 Ga0055530_10005720 3300003791 Bacteria 5787
45 Ga0055530_10009500 3300003791 Bacteria 3728
46 Ga0055540_1000086 3300003792 Bacteria 102576
47 Ga0055531_10019491 3300003794 Bacteria 2741
48 Ga0055543_1000685 3300004625 Bacteria 17655
49 Ga0055543_1010012 3300004625 Bacteria 2008
50 Ga0065165_1000007 3300005262 Bacteria 337871
51 Ga0065165_1000294 3300005262 Bacteria 84454
52 Ga0065165_1011904 3300005262 Bacteria 3581
53 Ga0065165_1026398 3300005262 Bacteria 1911
54 Ga0070690_100062178 3300005330 Bacteria 2407
55 Ga0068868_100020817 3300005338 Bacteria 4936
56 Ga0070669_100030065 3300005353 Bacteria 3918
57 Ga0070669_100487157 3300005353 Bacteria 1021
58 Ga0070667_100014746 3300005367 Bacteria 6457
59 Ga0070667_100345037 3300005367 Bacteria 1347
60 Ga0070678_100033043 3300005456 Bacteria 3588
61 Ga0070678_100376431 3300005456 Bacteria 1227
62 Ga0068853_100073187 3300005539 Bacteria 2987
63 Ga0068852_100182331 3300005616 Bacteria 1975
64 Ga0068859_100905159 3300005617 Bacteria 967
65 Ga0075368_10004357 3300006042 Bacteria 4788
66 Ga0070712_100103541 3300006175 Bacteria 2110
67 Ga0075362_10016380 3300006177 Bacteria 3034
68 Ga0075362_10021049 3300006177 Bacteria 2732
69 Ga0075367_10254405 3300006178 Bacteria 1102
70 Ga0075369_10057168 3300006186 Bacteria 1696
71 Ga0075366_10060808 3300006195 Bacteria 2244
72 Ga0075366_10120441 3300006195 Bacteria 1581
73 Ga0075366_10238336 3300006195 Bacteria 1109
74 Ga0075370_10004578 3300006353 Bacteria 6741
75 Ga0075370_10015894 3300006353 Bacteria 4040
76 Ga0097620_100904953 3300006931 Bacteria 967
77 Ga0079104_1000100 3300006946 Bacteria 126924
78 Ga0105251_10113629 3300009011 Bacteria 1232
79 Ga0105244_10004115 3300009036 Bacteria 10152
80 Ga0105244_10005426 3300009036 Bacteria 8482
81 Ga0105237_10003783 3300009545 Bacteria 17796
82 Ga0105238_10028150 3300009551 Bacteria 5725
83 Ga0105239_10000623 3300010375 Bacteria 50370
84 Ga0105239_10564140 3300010375 Bacteria 1297
85 Ga0157369_10005320 3300013105 Bacteria 15000
86 Ga0157378_10062477 3300013297 Bacteria 3325
87 Ga0163162_10028252 3300013306 Bacteria 5548
88 Ga0163162_10084686 3300013306 Bacteria 3246
89 Ga0163162_10278875 3300013306 Bacteria 1804
90 Ga0182007_10006203 3300015262 Bacteria 5156
91 Ga0183361_10003 3300016635 Bacteria 577277
92 Ga0163161_10027436 3300017792 Bacteria 4039
93 Ga0213872_10000014 3300021361 Bacteria 181546
94 Ga0213872_10000363 3300021361 Bacteria 38194
95 Ga0213872_10000894 3300021361 Bacteria 21441
96 Ga0213872_10003590 3300021361 Bacteria 8529
97 Ga0213872_10025154 3300021361 Bacteria 2737
98 Ga0213872_10034254 3300021361 Bacteria 2325
99 Ga0213872_10043974 3300021361 Bacteria 2034
100 Ga0213872_10079269 3300021361 Bacteria 1476
101 Ga0213872_10105725 3300021361 Bacteria 1253
102 Ga0209435_100047 3300025206 Bacteria 92749
103 Ga0209674_100051 3300025226 Bacteria 338399
104 Ga0209674_100112 3300025226 Bacteria 142700
105 Ga0209672_100027 3300025228 Bacteria 344500
106 Ga0209147_100021 3300025229 Bacteria 464719
107 Ga0209147_100035 3300025229 Bacteria 344500
108 Ga0209563_102067 3300025230 Bacteria 4754
109 Ga0207427_100297 3300025231 Bacteria 34861
110 Ga0209258_100052 3300025242 Bacteria 344500
111 Ga0209258_100501 3300025242 Bacteria 38827
112 Ga0207425_1000159 3300025245 Bacteria 57245
113 Ga0207425_1020066 3300025245 Bacteria 1433
114 Ga0209646_1000038 3300025246 Bacteria 353982
115 Ga0209646_1000054 3300025246 Bacteria 279447
116 Ga0209026_1000180 3300025250 Bacteria 94396
117 Ga0209026_1001901 3300025250 Bacteria 8480
118 Ga0209677_102326 3300025253 Bacteria 7293
119 Ga0209148_1000064 3300025254 Bacteria 344500
120 Ga0209148_1009751 3300025254 Bacteria 1852
121 Ga0209759_1000015 3300025256 Bacteria 388724
122 Ga0209759_1000125 3300025256 Bacteria 135516
123 Ga0209759_1000205 3300025256 Bacteria 92894
124 Ga0209759_1001148 3300025256 Bacteria 16861
125 Ga0209759_1003364 3300025256 Bacteria 6417
126 Ga0209129_1005364 3300025258 Bacteria 4572
127 Ga0209233_1000073 3300025261 Bacteria 362383
128 Ga0209565_1000003 3300025263 Bacteria 1099648
129 Ga0209565_1000771 3300025263 Bacteria 18692
130 Ga0209455_1000057 3300025272 Bacteria 344500
131 Ga0209455_1000073 3300025272 Bacteria 291417
132 Ga0209455_1000341 3300025272 Bacteria 44283
133 Ga0209673_1000003 3300025273 Bacteria 980859
134 Ga0209130_1000040 3300025284 Bacteria 262926
135 Ga0209130_1000306 3300025284 Bacteria 59508
136 Ga0209675_1000003 3300025291 Bacteria 1003982
137 Ga0209675_1003383 3300025291 Bacteria 7606
138 Ga0209675_1016911 3300025291 Bacteria 2105
139 Ga0209676_1000476 3300025292 Bacteria 66212
140 Ga0209676_1002341 3300025292 Bacteria 13691
141 Ga0209025_1000061 3300025294 Bacteria 304827
142 Ga0209025_1002648 3300025294 Bacteria 18307
143 Ga0209025_1005800 3300025294 Bacteria 9906
144 Ga0209025_1013541 3300025294 Bacteria 5114
145 Ga0209564_1000002 3300025295 Bacteria 1636803
146 Ga0209564_1000011 3300025295 Bacteria 822327
147 Ga0209564_1000012 3300025295 Bacteria 792078
148 Ga0209564_1001283 3300025295 Bacteria 27528
149 Ga0209564_1008278 3300025295 Bacteria 5162
150 Ga0209758_1000249 3300025297 Bacteria 110026
151 Ga0209758_1001391 3300025297 Bacteria 28769
152 Ga0209758_1003600 3300025297 Bacteria 13861
153 Ga0209050_1000053 3300025298 Bacteria 349521
154 Ga0209050_1000506 3300025298 Bacteria 66220
155 Ga0209050_1002675 3300025298 Bacteria 14536
156 Ga0209050_1008406 3300025298 Bacteria 5528
157 Ga0209256_1000029 3300025299 Bacteria 415922
158 Ga0209256_1000071 3300025299 Bacteria 242618
159 Ga0207426_1000359 3300025302 Bacteria 82359
160 Ga0209051_1000210 3300025303 Bacteria 102629
161 Ga0209051_1001779 3300025303 Bacteria 17096
162 Ga0209257_1000314 3300025304 Bacteria 102629
163 Ga0209257_1000316 3300025304 Bacteria 102171
164 Ga0209257_1006323 3300025304 Bacteria 7710
165 Ga0209257_1011179 3300025304 Bacteria 4370
166 Ga0209257_1012588 3300025304 Bacteria 3888
167 Ga0207655_1020772 3300025728 Bacteria 3360
168 Ga0207647_10012621 3300025904 Bacteria 5873
169 Ga0207671_10008408 3300025914 Bacteria 8759
170 Ga0207693_10029893 3300025915 Bacteria 4300
171 Ga0207681_10176098 3300025923 Bacteria 1625
172 Ga0207665_10219201 3300025939 Bacteria 1394
173 Ga0207691_10114281 3300025940 Bacteria 2399
174 Ga0207689_10086122 3300025942 Bacteria 2582
175 Ga0207658_10091847 3300025986 Bacteria 2357
176 Ga0207658_10350035 3300025986 Bacteria 1286
177 Ga0207677_10016814 3300026023 Bacteria 4344
178 Ga0207639_10184582 3300026041 Bacteria 1777
179 Ga0207639_10210691 3300026041 Bacteria 1673
180 Ga0207641_10033387 3300026088 Bacteria 4276
181 Ga0207676_10017519 3300026095 Bacteria 5193
182 Ga0207683_10052169 3300026121 Bacteria 3583
183 Ga0207683_10075406 3300026121 Bacteria 2985
184 Ga0207698_10129856 3300026142 Bacteria 2151
185 Ga0209281_1000084 3300027111 Bacteria 254215
186 Ga0209371_1007459 3300027312 Bacteria 3806
187 Ga0268264_10120234 3300028381 Bacteria 2314
188 Ga0265336_10000111 3300028666 Bacteria 62085
189 Ga0307515_10289783 3300028794 Bacteria 1334
190 Ga0307515_10338347 3300028794 Bacteria 1159
191 Ga0265324_10002789 3300029957 Bacteria 8633
192 Ga0268256_1007679 3300030500 Bacteria 3806
193 Ga0307511_10000056 3300030521 Bacteria 93598
194 Ga0316177_1072788 3300030731 Bacteria 2786
195 Ga0316180_1052560 3300030736 Bacteria 3387
196 Ga0307513_10307563 3300031456 Bacteria 1349
197 Ga0307408_100008377 3300031548 Bacteria 6828
198 Ga0307408_100295245 3300031548 Bacteria 1355
199 Ga0307516_10003006 3300031730 Bacteria 22016
200 Ga0307516_10022947 3300031730 Bacteria 6404
201 Ga0307406_10070468 3300031901 Bacteria 2289
202 Ga0373934_0007593 3300035086 Bacteria 4029
203 Ga0395898_0004799 3300037466 Bacteria 14714
204 Ga0395898_0098319 3300037466 Bacteria 2810
205 Ga0395901_0000079 3300038443 Bacteria 134462
206 Ga0395901_0005069 3300038443 Bacteria 13306
207 Ga0436361_0156472 3300039447 Bacteria 142079
208 Ga0436361_0295570 3300039447 Bacteria 32166
209 Ga0436361_0344276 3300039447 Bacteria 1872
210 Ga0436361_0434209 3300039447 Bacteria 2001
211 Ga0436361_0700633 3300039447 Bacteria 4256
212 Ga0436361_0865069 3300039447 Bacteria 75093
213 Ga0436361_1112214 3300039447 Bacteria 3905
214 Ga0436361_1145940 3300039447 Bacteria 80179
215 Ga0439436_0000199 3300041404 Bacteria 14414
216 Ga0439439_0023454 3300041406 Unclassified 1545
217 Ga0439449_0008250 3300042007 Unclassified 3962
218 Ga0466965_0036307 3300044683 Bacteria 2418
219 Ga0466968_0101508 3300044735 Bacteria 1285
220 Ga0495617_000285 3300046452 Bacteria 29213
221 Ga0495617_000629 3300046452 Bacteria 17685
222 Ga0495617_001983 3300046452 Bacteria 8542
223 Ga0495617_015539 3300046452 Bacteria 2578
224 Ga0495592_0011088 3300046454 Bacteria 6803
225 Ga0495592_0077764 3300046454 Bacteria 2404
226 Ga0495592_0092383 3300046454 Bacteria 2168
227 Ga0495603_0002032 3300046455 Bacteria 11908
228 Ga0495603_0015559 3300046455 Bacteria 4604
229 Ga0495590_0000002 3300046457 Bacteria 485720
230 Ga0495590_0014452 3300046457 Bacteria 2879
231 Ga0495629_0001421 3300046459 Bacteria 18891
232 Ga0495629_0003207 3300046459 Bacteria 12374
233 Ga0495629_0017898 3300046459 Bacteria 5078
234 Ga0495638_0000030 3300046460 Bacteria 318183
235 Ga0495638_0004879 3300046460 Bacteria 10090
236 Ga0495641_0020814 3300046461 Bacteria 3316
237 Ga0495651_0032429 3300046462 Bacteria 4075
238 Ga0495651_0094199 3300046462 Bacteria 2241
239 Ga0495651_0251833 3300046462 Bacteria 1206
240 Ga0495653_0000005 3300046463 Bacteria 367438
241 Ga0495653_0034722 3300046463 Bacteria 3984
242 Ga0495653_0041185 3300046463 Bacteria 3606
243 Ga0495653_0110585 3300046463 Bacteria 1975
244 Ga0495650_0000067 3300046471 Bacteria 269882
245 Ga0495650_0000385 3300046471 Bacteria 75775
246 Ga0495650_0003168 3300046471 Bacteria 12277
247 Ga0495650_0008424 3300046471 Bacteria 6023
248 Ga0495650_0009509 3300046471 Bacteria 5521
249 Ga0495650_0012274 3300046471 Bacteria 4618
250 Ga0495650_0013800 3300046471 Bacteria 4249
251 Ga0495650_0112249 3300046471 Bacteria 1011
252 Ga0495580_0000183 3300046472 Bacteria 47213
253 Ga0495580_0002954 3300046472 Bacteria 14596
254 Ga0495580_0006601 3300046472 Bacteria 9430
255 Ga0495580_0012034 3300046472 Bacteria 6663
256 Ga0495580_0047056 3300046472 Bacteria 3059
257 Ga0495582_0004221 3300046473 Bacteria 8084
258 Ga0495582_0010606 3300046473 Bacteria 5069
259 Ga0495582_0328369 3300046473 Bacteria 880
260 Ga0495605_0000073 3300046474 Bacteria 131765
261 Ga0495605_0006264 3300046474 Bacteria 6858
262 Ga0495639_0003400 3300046475 Bacteria 6893
263 Ga0495639_0007560 3300046475 Bacteria 4669
264 Ga0495662_0020387 3300046476 Bacteria 3207
265 Ga0495662_0043649 3300046476 Bacteria 2164
266 Ga0495664_0001680 3300046477 Bacteria 11763
267 Ga0495664_0002758 3300046477 Bacteria 9449
268 Ga0495664_0004994 3300046477 Bacteria 7263
269 Ga0495584_0000016 3300046491 Bacteria 156560
270 Ga0495584_0101339 3300046491 Bacteria 1455
271 Ga0495585_0003881 3300046492 Bacteria 9938
272 Ga0495585_0004708 3300046492 Bacteria 8789
273 Ga0495585_0028940 3300046492 Bacteria 3157
274 Ga0495585_0048595 3300046492 Bacteria 2358
275 Ga0495594_0245952 3300046499 Bacteria 1019
276 Ga0495596_0002408 3300046500 Bacteria 10100
277 Ga0495607_0000219 3300046501 Bacteria 61110
278 Ga0495607_0001517 3300046501 Bacteria 20431
279 Ga0495607_0001827 3300046501 Bacteria 18144
280 Ga0495607_0044621 3300046501 Bacteria 2613
281 Ga0495607_0117844 3300046501 Bacteria 1398
282 Ga0495583_0000029 3300046506 Bacteria 255536
283 Ga0495583_0000058 3300046506 Bacteria 200120
284 Ga0495583_0000113 3300046506 Bacteria 136475
285 Ga0495583_0013348 3300046506 Bacteria 4586
286 Ga0495583_0018439 3300046506 Bacteria 3674
287 Ga0495583_0133575 3300046506 Bacteria 1037
288 Ga0495606_0000049 3300046507 Bacteria 204038
289 Ga0495606_0000381 3300046507 Bacteria 75386
290 Ga0495606_0000422 3300046507 Bacteria 70719
291 Ga0495606_0001776 3300046507 Bacteria 27602
292 Ga0495606_0002831 3300046507 Bacteria 19246
293 Ga0495606_0004619 3300046507 Bacteria 13640
294 Ga0495606_0027046 3300046507 Bacteria 4074
295 Ga0495608_0009673 3300046511 Bacteria 6726
296 Ga0495608_0057849 3300046511 Bacteria 2557
297 Ga0495610_0000012 3300046512 Bacteria 517442
298 Ga0495610_0002552 3300046512 Bacteria 15157
299 Ga0495610_0007104 3300046512 Bacteria 7555
300 Ga0495610_0048317 3300046512 Bacteria 2089
301 Ga0495610_0052229 3300046512 Bacteria 1985
302 Ga0495616_0002322 3300046513 Bacteria 12713
303 Ga0495616_0024647 3300046513 Bacteria 3224
304 Ga0495618_0017609 3300046514 Bacteria 4382
305 Ga0495628_0004640 3300046516 Bacteria 12132
306 Ga0495628_0006852 3300046516 Bacteria 9904
307 Ga0495628_0068082 3300046516 Bacteria 2778
308 Ga0495628_0082804 3300046516 Bacteria 2492
309 Ga0495630_0029737 3300046517 Bacteria 4061
310 Ga0495630_0037927 3300046517 Bacteria 3603
311 Ga0495630_0236289 3300046517 Bacteria 1396
312 Ga0495632_0004689 3300046519 Bacteria 9236
313 Ga0495637_0001275 3300046520 Bacteria 15197
314 Ga0495643_0000011 3300046522 Bacteria 324745
315 Ga0495643_0000078 3300046522 Bacteria 162974
316 Ga0495644_0000967 3300046523 Bacteria 11902
317 Ga0495644_0002934 3300046523 Bacteria 6776
318 Ga0495644_0039222 3300046523 Bacteria 1786
319 Ga0495648_0000009 3300046524 Bacteria 317193
320 Ga0495648_0002444 3300046524 Bacteria 17169
321 Ga0495648_0006254 3300046524 Bacteria 9744
322 Ga0495648_0009797 3300046524 Bacteria 7371
323 Ga0495648_0012276 3300046524 Bacteria 6398
324 Ga0495648_0012288 3300046524 Bacteria 6395
325 Ga0495648_0017753 3300046524 Bacteria 5073
326 Ga0495648_0023719 3300046524 Bacteria 4193
327 Ga0495648_0023740 3300046524 Bacteria 4191
328 Ga0495648_0036988 3300046524 Bacteria 3141
329 Ga0495663_0002855 3300046525 Bacteria 5106
330 Ga0495663_0003293 3300046525 Bacteria 4680
331 Ga0495666_0001075 3300046526 Bacteria 13008
332 Ga0495666_0002585 3300046526 Bacteria 9005
333 Ga0495666_0006590 3300046526 Bacteria 5839
334 Ga0495666_0012104 3300046526 Bacteria 4306
335 Ga0495642_0005575 3300046528 Bacteria 4837
336 Ga0495642_0017008 3300046528 Bacteria 2839
337 Ga0495642_0024533 3300046528 Bacteria 2386
338 Ga0495642_0028310 3300046528 Bacteria 2232
339 Ga0495652_0010507 3300046529 Bacteria 8389
340 Ga0495652_0114881 3300046529 Bacteria 2158
341 Ga0495652_0255603 3300046529 Bacteria 1296
342 Ga0495652_0317994 3300046529 Bacteria 1125
343 Ga0495654_0000011 3300046530 Bacteria 363172
344 Ga0495654_0052378 3300046530 Bacteria 1988
345 Ga0495665_0008679 3300046531 Bacteria 5515
346 Ga0495665_0016089 3300046531 Bacteria 4030
347 Ga0495665_0060357 3300046531 Bacteria 2002
348 Ga0495640_0006014 3300046533 Bacteria 9624
349 Ga0495640_0020445 3300046533 Bacteria 4871
350 Ga0495586_0009365 3300046535 Bacteria 5211
351 Ga0495586_0064330 3300046535 Bacteria 1998
352 Ga0495586_0111034 3300046535 Bacteria 1526
353 Ga0495587_0012720 3300046536 Bacteria 5293
354 Ga0495587_0021846 3300046536 Bacteria 3947
355 Ga0495609_0000054 3300046538 Bacteria 147369
356 Ga0495609_0064812 3300046538 Bacteria 1611
357 Ga0495597_0000014 3300046542 Bacteria 177043
358 Ga0495597_0000362 3300046542 Bacteria 40147
359 Ga0495597_0043475 3300046542 Bacteria 2000
360 Ga0495597_0066839 3300046542 Bacteria 1557
361 Ga0495645_0001543 3300046543 Bacteria 15573
362 Ga0495645_0019470 3300046543 Bacteria 4886
363 Ga0495622_0000002 3300046557 Bacteria 321742
364 Ga0495622_0000018 3300046557 Bacteria 173985
365 Ga0495622_0001368 3300046557 Bacteria 12438
366 Ga0495633_0000041 3300046558 Bacteria 176298
367 Ga0495633_0000047 3300046558 Bacteria 165890
368 Ga0495633_0001049 3300046558 Bacteria 22608
369 Ga0495633_0001874 3300046558 Bacteria 15358
370 Ga0495633_0007614 3300046558 Bacteria 6201
371 Ga0495633_0039613 3300046558 Bacteria 2249
372 Ga0495633_0159095 3300046558 Bacteria 1042
373 Ga0495667_0021458 3300046559 Bacteria 4358
374 Ga0495656_0008463 3300046615 Bacteria 3673
375 Ga0495656_0121524 3300046615 Bacteria 1233
376 Ga0495668_0000020 3300046616 Bacteria 411641
377 Ga0495668_0000077 3300046616 Bacteria 159120
378 Ga0495668_0000750 3300046616 Bacteria 38415
379 Ga0495668_0002404 3300046616 Bacteria 15499
380 Ga0495668_0019403 3300046616 Bacteria 3920
381 Ga0495634_0034718 3300046642 Bacteria 3458
382 Ga0495634_0047786 3300046642 Bacteria 2882
383 Ga0495611_0003441 3300046648 Bacteria 6980
384 Ga0495611_0003837 3300046648 Bacteria 6555
385 Ga0495611_0009879 3300046648 Bacteria 4037
386 Ga0495625_0000023 3300046660 Bacteria 274067
387 Ga0495625_0000721 3300046660 Bacteria 46512
388 Ga0495625_0003924 3300046660 Bacteria 14297
389 Ga0495625_0009136 3300046660 Bacteria 8342
390 Ga0495625_0059480 3300046660 Bacteria 2711
391 Ga0495625_0082040 3300046660 Bacteria 2243
392 Ga0495625_0085478 3300046660 Bacteria 2189
393 Ga0495625_0097742 3300046660 Bacteria 2020
394 Ga0495625_0407929 3300046660 Bacteria 847
395 Ga0495635_0001086 3300046663 Bacteria 18041
396 Ga0495635_0001345 3300046663 Bacteria 16351
397 Ga0495635_0198231 3300046663 Bacteria 1362
398 Ga0495659_0000012 3300046664 Bacteria 82444
399 Ga0495659_0000155 3300046664 Bacteria 30367
400 Ga0495661_0023956 3300046665 Bacteria 3956
401 Ga0495661_0025145 3300046665 Bacteria 3849
402 Ga0495661_0042851 3300046665 Bacteria 2787
403 Ga0495588_0048900 3300046674 Bacteria 2173
404 Ga0495588_0051996 3300046674 Bacteria 2111
405 Ga0495657_0057553 3300046675 Bacteria 2584
406 Ga0495623_0007343 3300046679 Bacteria 7153
407 Ga0495623_0086121 3300046679 Bacteria 1937
408 Ga0495646_0002226 3300046680 Bacteria 11839
409 Ga0495646_0005808 3300046680 Bacteria 7828
410 Ga0495646_0010615 3300046680 Bacteria 5849
411 Ga0495646_0041779 3300046680 Bacteria 2816
412 Ga0495669_0003596 3300046684 Bacteria 6391
413 Ga0495669_0035024 3300046684 Bacteria 2215
414 Ga0495613_0000702 3300046689 Bacteria 26408
415 Ga0495613_0014097 3300046689 Bacteria 5929
416 Ga0495613_0019525 3300046689 Bacteria 5051
417 Ga0495624_0001390 3300046690 Bacteria 18860
418 Ga0495624_0007668 3300046690 Bacteria 7575
419 Ga0495624_0037528 3300046690 Bacteria 3115
420 Ga0495624_0043821 3300046690 Bacteria 2853
421 Ga0495624_0070239 3300046690 Bacteria 2180
422 Ga0495670_0004550 3300046691 Bacteria 6801
423 Ga0495670_0022998 3300046691 Bacteria 3077
424 Ga0495671_0000006 3300046692 Bacteria 500471
425 Ga0495671_0000145 3300046692 Bacteria 62201
426 Ga0495671_0018495 3300046692 Bacteria 3697
427 Ga0495671_0028885 3300046692 Bacteria 2852
428 Ga0495671_0071502 3300046692 Bacteria 1704
429 Ga0495649_0002043 3300046694 Bacteria 14565
430 Ga0495649_0003667 3300046694 Bacteria 10238
431 Ga0495649_0008694 3300046694 Bacteria 6094
432 Ga0495649_0037498 3300046694 Bacteria 2661
433 Ga0495589_0006404 3300046794 Bacteria 6217
434 Ga0495589_0008587 3300046794 Bacteria 5325
435 Ga0495589_0051063 3300046794 Bacteria 2045
436 Ga0495600_0010468 3300046809 Bacteria 5759
437 Ga0495600_0094155 3300046809 Bacteria 1953
438 Ga0495660_0001355 3300046810 Bacteria 16845
439 Ga0495660_0007238 3300046810 Bacteria 6533
440 Ga0495660_0016445 3300046810 Bacteria 4266
441 Ga0495660_0067772 3300046810 Bacteria 1900
442 Ga0495660_0105313 3300046810 Bacteria 1446
443 Ga0495604_0034566 3300047317 Bacteria 3998
444 Ga0495604_0046792 3300047317 Bacteria 3372
445 Ga0495604_0061919 3300047317 Bacteria 2860
446 Ga0495636_0001529 3300047318 Bacteria 8787
447 Ga0495636_0003932 3300047318 Bacteria 5797
448 Ga0495674_0003027 3300047319 Bacteria 16366
449 Ga0495674_0068284 3300047319 Bacteria 3076
450 Ga0495674_0108798 3300047319 Bacteria 2351
451 Ga0495674_0168854 3300047319 Bacteria 1826
452 Ga0495672_0000019 3300047320 Bacteria 448153
453 Ga0495672_0000369 3300047320 Bacteria 56889
454 Ga0495672_0002008 3300047320 Bacteria 19220
455 Ga0495672_0002210 3300047320 Bacteria 18132
456 Ga0495672_0003325 3300047320 Bacteria 13872
457 Ga0495672_0003638 3300047320 Bacteria 13064
458 Ga0495672_0036263 3300047320 Bacteria 3029
459 Ga0495676_0016966 3300047321 Bacteria 6448
460 Ga0495676_0042118 3300047321 Bacteria 3751
461 Ga0495680_0015217 3300047322 Bacteria 6641
462 Ga0495680_0023602 3300047322 Bacteria 5111
463 Ga0495683_0080377 3300047323 Bacteria 1591
464 Ga0495687_001155 3300047443 Bacteria 25561
465 Ga0495687_008492 3300047443 Bacteria 5874
466 Ga0495687_010933 3300047443 Bacteria 4925
467 Ga0495687_022167 3300047443 Bacteria 3056
468 Ga0495687_061619 3300047443 Bacteria 1542
469 Ga0495675_0013857 3300047444 Bacteria 5096
470 Ga0495677_0001723 3300047445 Bacteria 8776
471 Ga0495677_0009011 3300047445 Bacteria 3690
472 Ga0495677_0010710 3300047445 Bacteria 3360
473 Ga0495679_000321 3300047446 Bacteria 38180
474 Ga0495679_006469 3300047446 Bacteria 5037
475 Ga0495679_008544 3300047446 Bacteria 4154
476 Ga0495679_008890 3300047446 Bacteria 4053
477 Ga0495685_000327 3300047447 Bacteria 15291
478 Ga0495685_011991 3300047447 Bacteria 2931
479 Ga0495685_061229 3300047447 Bacteria 1268
480 Ga0495673_0000003 3300047469 Bacteria 1491337
481 Ga0495673_0000050 3300047469 Bacteria 262267
482 Ga0495673_0000951 3300047469 Bacteria 26188
483 Ga0495673_0003746 3300047469 Bacteria 9869
484 Ga0495673_0004762 3300047469 Bacteria 8407
485 Ga0495673_0086680 3300047469 Bacteria 1287
486 Ga0495681_0021197 3300047470 Bacteria 3506
487 Ga0495684_0029802 3300047471 Bacteria 4188
488 Ga0495684_0196892 3300047471 Bacteria 1487
489 Ga0495686_0000143 3300047472 Bacteria 143037
490 Ga0495686_0000358 3300047472 Bacteria 74461
491 Ga0495686_0000590 3300047472 Bacteria 50972
492 Ga0495686_0002536 3300047472 Bacteria 17070
493 Ga0495686_0004056 3300047472 Bacteria 12228
494 Ga0495686_0005085 3300047472 Bacteria 10524
495 Ga0495686_0024624 3300047472 Bacteria 3952
496 Ga0495686_0040483 3300047472 Bacteria 2971
497 Ga0495593_0011624 3300047673 Bacteria 5051
498 Ga0495593_0026239 3300047673 Bacteria 3219
499 Ga0495602_0012270 3300048088 Bacteria 8817
500 Ga0495602_0190587 3300048088 Bacteria 1572
501 Ga0495614_0009783 3300048089 Bacteria 4236
502 Ga0495614_0019584 3300048089 Bacteria 2928
503 Ga0495615_0000451 3300048090 Bacteria 5993
504 Ga0495615_0050572 3300048090 Bacteria 1068
505 Ga0496100_0081238 3300048903 Bacteria 2189
506 Ga0496101_0000981 3300048904 Bacteria 16866
507 Ga0496101_0013439 3300048904 Bacteria 5486
508 Ga0496102_0022687 3300048905 Bacteria 5562
509 Ga0496102_0032143 3300048905 Bacteria 4714
510 Ga0496103_0004133 3300048906 Bacteria 8813
511 Ga0496103_0031109 3300048906 Bacteria 3251
512 Ga0496103_0198099 3300048906 Bacteria 1291
513 Ga0496105_0005727 3300048908 Bacteria 9459
514 Ga0496105_0095207 3300048908 Bacteria 2460
515 Ga0496106_0074059 3300048909 Bacteria 2606
516 Ga0496106_0110844 3300048909 Bacteria 2136
517 Ga0496107_0000515 3300048910 Bacteria 21514
518 Ga0496107_0172315 3300048910 Bacteria 1606
519 Ga0496108_0398770 3300048911 Bacteria 1201
520 Ga0496110_0002220 3300048913 Bacteria 14508
521 Ga0496110_0024162 3300048913 Bacteria 5176
522 Ga0496110_0234273 3300048913 Bacteria 1670
523 Ga0496111_0036317 3300048914 Bacteria 3523
524 Ga0496111_0217051 3300048914 Bacteria 1421
525 Ga0496112_0137098 3300048915 Bacteria 2417
526 Ga0496113_0323743 3300048916 Bacteria 1236
527 Ga0496114_0011104 3300048917 Bacteria 7188
528 Ga0496114_0019609 3300048917 Bacteria 5480
529 Ga0496114_0028604 3300048917 Bacteria 4575
530 Ga0496114_0069234 3300048917 Bacteria 2963
531 Ga0496117_0038142 3300048920 Bacteria 3569
532 Ga0496118_0000175 3300048921 Bacteria 115396
533 Ga0496120_0147162 3300048923 Bacteria 1188
534 Ga0496121_0000187 3300048924 Bacteria 138361
535 Ga0496121_0002676 3300048924 Bacteria 26674
536 Ga0496121_0015294 3300048924 Bacteria 8057
537 Ga0496122_0000754 3300048925 Bacteria 62842
538 Ga0496122_0016086 3300048925 Bacteria 7109
539 Ga0496122_0018330 3300048925 Bacteria 6478
540 Ga0496123_0000299 3300048926 Bacteria 96749
541 Ga0496123_0002827 3300048926 Bacteria 20536
542 Ga0496124_0093636 3300048927 Bacteria 2445
543 Ga0496124_0140390 3300048927 Bacteria 1907
544 Ga0496124_0146334 3300048927 Bacteria 1859
545 Ga0496124_0233729 3300048927 Bacteria 1372
546 Ga0496125_0007163 3300048928 Bacteria 11904
547 Ga0496126_0000898 3300048929 Bacteria 51758
548 Ga0496126_0001470 3300048929 Bacteria 36664
549 Ga0496126_0011911 3300048929 Bacteria 8944
550 Ga0495678_000630 3300049459 Bacteria 32774
551 Ga0495678_001102 3300049459 Bacteria 22703
552 Ga0495678_002129 3300049459 Bacteria 14033
553 Ga0495682_0000239 3300049460 Bacteria 43540
554 Ga0495682_0007290 3300049460 Bacteria 4410
555 Ga0501033_0038492 3300049570 Bacteria 3575
556 Ga0501043_0015056 3300049579 Bacteria 6057
557 Ga0501249_006057 3300049679 Bacteria 2483
558 Ga0501269_000550 3300049766 Bacteria 7137
559 Ga0501044_0152070 3300049823 Bacteria 2296
560 nmdc:mga03683_36280_c1 3300050489 Bacteria 2005
561 nmdc:mga0k408_118719_c1 3300050493 Bacteria 1566
562 nmdc:mga0k408_157818_c1 3300050493 Bacteria 1351
563 nmdc:mga06z11_8010_c1 3300050494 Bacteria 4381
564 nmdc:mga07m45_11641_c1 3300050496 Bacteria 4626
565 nmdc:mga07m45_2701_c1 3300050496 Bacteria 8360
566 nmdc:mga0sz30_3702_c1 3300050516 Bacteria 5511
567 Ga0500578_0037027 3300053086 Bacteria 3133
568 Ga0500644_0000132 3300053088 Bacteria 45910
569 Ga0500644_0014342 3300053088 Bacteria 2235
570 Ga0500650_0149548 3300053098 Bacteria 1080
571 Ga0500593_018177 3300053117 Bacteria 3061
572 Ga0500618_000024 3300053125 Bacteria 152149
573 Ga0500618_000052 3300053125 Bacteria 102436
574 Ga0500658_0004682 3300053134 Bacteria 5105
575 Ga0500559_0001139 3300053136 Bacteria 16025
576 Ga0500559_0016508 3300053136 Bacteria 3118
577 Ga0500559_0034406 3300053136 Bacteria 2185
578 Ga0500568_0008130 3300053139 Bacteria 5086
579 Ga0500573_0097630 3300053140 Bacteria 1655
580 Ga0500622_0011947 3300053156 Bacteria 4722
581 Ga0500636_0003457 3300053177 Bacteria 8888
582 Ga0500645_000911 3300053730 Bacteria 17004
583 Ga0500645_010449 3300053730 Bacteria 3071
584 Ga0500661_004366 3300055283 Bacteria 2647
585 2600811155 2600255067 Bacteria 6795583
586 2509128869 2508501125 Bacteria 7208311
587 2511247274 2511231002 Bacteria 5042903
588 2513553327 2513237082 Bacteria 8640282
589 2513564219 2513237083 Bacteria 8410967
590 2515679823 2515154122 Bacteria 8609520
591 2516021945 2515154189 Bacteria 9629850
592 2527079846 2526164713 Bacteria 6780608
593 2585148730 2582581279 Bacteria 4980720
594 2599739269 2599185239 Bacteria 8686614
595 2644253001 2643221645 Bacteria 7207331
596 2644339332 2643221660 Bacteria 4208257
597 2644354937 2643221664 Bacteria 7272945
598 2738737901 2738541280 Bacteria 6630198
599 2738828369 2738541297 Bacteria 6549566
600 2738842114 2738541300 Bacteria 6675882
601 2739152165 2738541357 Bacteria 6549408
602 2739193814 2738543003 Bacteria 6549560
603 2739272972 2738543018 Bacteria 6718814
604 2739320561 2738543026 Bacteria 6549408
605 2739338531 2738543029 Bacteria 6549249
606 2739342016 2738543030 Bacteria 6719714
607 2746091421 2744054900 Bacteria 8399525
608 2746097315 2744054901 Bacteria 8397047
609 2819636049 2818991452 Bacteria 8442785
610 2821449952 2821443989 Bacteria 7658172
611 2842713359 2842711865 Bacteria 7155354
612 2842737026 2842733646 Bacteria 5716726
613 2842750273 2842747753 Bacteria 5578255
614 2857561455 2857558681 Bacteria 6617694
615 2857569833 2857564685 Bacteria 6290584
616 2857580690 2857576091 Bacteria 5465855
617 2883093585 2883087390 Bacteria 9532701
618 2885275138 2885270888 Bacteria 9831543
619 2902690237 2902682994 Bacteria 8951596
620 2904425341 2904424332 Bacteria 7633521
621 2904489454 2904483920 Bacteria 7545285
622 2919531824 2919527303 Bacteria 7718827
623 2928176524 2928170801 Bacteria 8785406
624 2928529316 2928526807 Bacteria 4760224
625 8003960700 8003955200 Bacteria 8601927
626 8018853211 8018845410 Bacteria 8933938
627 8021124505 8021120328 Bacteria 8782274
628 8055270546 8055266321 Bacteria 7999742
629 JGI25155J39150_1000059
630 JGI25156J39149_1000081
631 JGI25156J39149_1000477
632 JGI25156J39149_1000957
633 JGI25156J39149_1015503
634 JGI25154J39366_1000109
635 JGI25154J39366_1000834
636 JGI25157J39369_1000103
637 JGI25159J45721_1000488
638 JGI25159J45721_1001139
639 JGI25151J46595_10000370
640 JGI25151J46595_10002071
641 JGI25165J46597_1000785
642 JGI25153J46596_10011848
643 JGI25153J46596_10039913
644 rootH1_10000270
645 rootH2_10117627
646 rootL2_10042248
647 rootL2_10081604
648 rootL2_10092949
649 rootH1_10299132
650 JGI25160J50197_1000431
651 JGI25161J50226_1000077
652 Ga0055533_1000089
653 Ga0055533_1000348
654 Ga0055532_1000014
655 Ga0055532_1000278
656 Ga0055527_1000013
657 Ga0055535_1000011
658 Ga0055535_1000452
659 Ga0055542_1000018
660 Ga0055529_1000017
661 Ga0055529_1000076
662 Ga0055529_1000472
663 Ga0055529_1000926
664 Ga0055526_1000001
665 Ga0055526_1000672
666 Ga0055537_1000077
667 Ga0055524_1000084
668 Ga0055524_1024568
669 Ga0055534_1000165
670 Ga0055528_1000492
671 Ga0055530_10002145
672 Ga0055530_10005720
673 Ga0055530_10009500
674 Ga0055540_1000086
675 Ga0055531_10019491
676 Ga0055543_1000685
677 Ga0055543_1010012
678 Ga0065165_1000007
679 Ga0065165_1000294
680 Ga0065165_1011904
681 Ga0065165_1026398
682 Ga0070690_100062178
683 Ga0068868_100020817
684 Ga0070669_100030065
685 Ga0070669_100487157
686 Ga0070667_100014746
687 Ga0070667_100345037
688 Ga0070678_100033043
689 Ga0070678_100376431
690 Ga0068853_100073187
691 Ga0068852_100182331
692 Ga0068859_100905159
693 Ga0075368_10004357
694 Ga0070712_100103541
695 Ga0075362_10016380
696 Ga0075362_10021049
697 Ga0075367_10254405
698 Ga0075369_10057168
699 Ga0075366_10060808
700 Ga0075366_10120441
701 Ga0075366_10238336
702 Ga0075370_10004578
703 Ga0075370_10015894
704 Ga0097620_100904953
705 Ga0079104_1000100
706 Ga0105251_10113629
707 Ga0105244_10004115
708 Ga0105244_10005426
709 Ga0105237_10003783
710 Ga0105238_10028150
711 Ga0105239_10000623
712 Ga0105239_10564140
713 Ga0157369_10005320
714 Ga0157378_10062477
715 Ga0163162_10028252
716 Ga0163162_10084686
717 Ga0163162_10278875
718 Ga0182007_10006203
719 Ga0183361_10003
720 Ga0163161_10027436
721 Ga0213872_10000014
722 Ga0213872_10000363
723 Ga0213872_10000894
724 Ga0213872_10003590
725 Ga0213872_10025154
726 Ga0213872_10034254
727 Ga0213872_10043974
728 Ga0213872_10079269
729 Ga0213872_10105725
730 Ga0209435_100047
731 Ga0209674_100051
732 Ga0209674_100112
733 Ga0209672_100027
734 Ga0209147_100021
735 Ga0209147_100035
736 Ga0209563_102067
737 Ga0207427_100297
738 Ga0209258_100052
739 Ga0209258_100501
740 Ga0207425_1000159
741 Ga0207425_1020066
742 Ga0209646_1000038
743 Ga0209646_1000054
744 Ga0209026_1000180
745 Ga0209026_1001901
746 Ga0209677_102326
747 Ga0209148_1000064
748 Ga0209148_1009751
749 Ga0209759_1000015
750 Ga0209759_1000125
751 Ga0209759_1000205
752 Ga0209759_1001148
753 Ga0209759_1003364
754 Ga0209129_1005364
755 Ga0209233_1000073
756 Ga0209565_1000003
757 Ga0209565_1000771
758 Ga0209455_1000057
759 Ga0209455_1000073
760 Ga0209455_1000341
761 Ga0209673_1000003
762 Ga0209130_1000040
763 Ga0209130_1000306
764 Ga0209675_1000003
765 Ga0209675_1003383
766 Ga0209675_1016911
767 Ga0209676_1000476
768 Ga0209676_1002341
769 Ga0209025_1000061
770 Ga0209025_1002648
771 Ga0209025_1005800
772 Ga0209025_1013541
773 Ga0209564_1000002
774 Ga0209564_1000011
775 Ga0209564_1000012
776 Ga0209564_1001283
777 Ga0209564_1008278
778 Ga0209758_1000249
779 Ga0209758_1001391
780 Ga0209758_1003600
781 Ga0209050_1000053
782 Ga0209050_1000506
783 Ga0209050_1002675
784 Ga0209050_1008406
785 Ga0209256_1000029
786 Ga0209256_1000071
787 Ga0207426_1000359
788 Ga0209051_1000210
789 Ga0209051_1001779
790 Ga0209257_1000314
791 Ga0209257_1000316
792 Ga0209257_1006323
793 Ga0209257_1011179
794 Ga0209257_1012588
795 Ga0207655_1020772
796 Ga0207647_10012621
797 Ga0207671_10008408
798 Ga0207693_10029893
799 Ga0207681_10176098
800 Ga0207665_10219201
801 Ga0207691_10114281
802 Ga0207689_10086122
803 Ga0207658_10091847
804 Ga0207658_10350035
805 Ga0207677_10016814
806 Ga0207639_10184582
807 Ga0207639_10210691
808 Ga0207641_10033387
809 Ga0207676_10017519
810 Ga0207683_10052169
811 Ga0207683_10075406
812 Ga0207698_10129856
813 Ga0209281_1000084
814 Ga0209371_1007459
815 Ga0268264_10120234
816 Ga0265336_10000111
817 Ga0307515_10289783
818 Ga0307515_10338347
819 Ga0265324_10002789
820 Ga0268256_1007679
821 Ga0307511_10000056
822 Ga0316177_1072788
823 Ga0316180_1052560
824 Ga0307513_10307563
825 Ga0307408_100008377
826 Ga0307408_100295245
827 Ga0307516_10003006
828 Ga0307516_10022947
829 Ga0307406_10070468
830 Ga0373934_0007593
831 Ga0395898_0004799
832 Ga0395898_0098319
833 Ga0395901_0000079
834 Ga0395901_0005069
835 Ga0436361_0156472
836 Ga0436361_0295570
837 Ga0436361_0344276
838 Ga0436361_0434209
839 Ga0436361_0700633
840 Ga0436361_0865069
841 Ga0436361_1112214
842 Ga0436361_1145940
843 Ga0439436_0000199
844 Ga0439439_0023454
845 Ga0439449_0008250
846 Ga0466965_0036307
847 Ga0466968_0101508
848 Ga0495617_000285
849 Ga0495617_000629
850 Ga0495617_001983
851 Ga0495617_015539
852 Ga0495592_0011088
853 Ga0495592_0077764
854 Ga0495592_0092383
855 Ga0495603_0002032
856 Ga0495603_0015559
857 Ga0495590_0000002
858 Ga0495590_0014452
859 Ga0495629_0001421
860 Ga0495629_0003207
861 Ga0495629_0017898
862 Ga0495638_0000030
863 Ga0495638_0004879
864 Ga0495641_0020814
865 Ga0495651_0032429
866 Ga0495651_0094199
867 Ga0495651_0251833
868 Ga0495653_0000005
869 Ga0495653_0034722
870 Ga0495653_0041185
871 Ga0495653_0110585
872 Ga0495650_0000067
873 Ga0495650_0000385
874 Ga0495650_0003168
875 Ga0495650_0008424
876 Ga0495650_0009509
877 Ga0495650_0012274
878 Ga0495650_0013800
879 Ga0495650_0112249
880 Ga0495580_0000183
881 Ga0495580_0002954
882 Ga0495580_0006601
883 Ga0495580_0012034
884 Ga0495580_0047056
885 Ga0495582_0004221
886 Ga0495582_0010606
887 Ga0495582_0328369
888 Ga0495605_0000073
889 Ga0495605_0006264
890 Ga0495639_0003400
891 Ga0495639_0007560
892 Ga0495662_0020387
893 Ga0495662_0043649
894 Ga0495664_0001680
895 Ga0495664_0002758
896 Ga0495664_0004994
897 Ga0495584_0000016
898 Ga0495584_0101339
899 Ga0495585_0003881
900 Ga0495585_0004708
901 Ga0495585_0028940
902 Ga0495585_0048595
903 Ga0495594_0245952
904 Ga0495596_0002408
905 Ga0495607_0000219
906 Ga0495607_0001517
907 Ga0495607_0001827
908 Ga0495607_0044621
909 Ga0495607_0117844
910 Ga0495583_0000029
911 Ga0495583_0000058
912 Ga0495583_0000113
913 Ga0495583_0013348
914 Ga0495583_0018439
915 Ga0495583_0133575
916 Ga0495606_0000049
917 Ga0495606_0000381
918 Ga0495606_0000422
919 Ga0495606_0001776
920 Ga0495606_0002831
921 Ga0495606_0004619
922 Ga0495606_0027046
923 Ga0495608_0009673
924 Ga0495608_0057849
925 Ga0495610_0000012
926 Ga0495610_0002552
927 Ga0495610_0007104
928 Ga0495610_0048317
929 Ga0495610_0052229
930 Ga0495616_0002322
931 Ga0495616_0024647
932 Ga0495618_0017609
933 Ga0495628_0004640
934 Ga0495628_0006852
935 Ga0495628_0068082
936 Ga0495628_0082804
937 Ga0495630_0029737
938 Ga0495630_0037927
939 Ga0495630_0236289
940 Ga0495632_0004689
941 Ga0495637_0001275
942 Ga0495643_0000011
943 Ga0495643_0000078
944 Ga0495644_0000967
945 Ga0495644_0002934
946 Ga0495644_0039222
947 Ga0495648_0000009
948 Ga0495648_0002444
949 Ga0495648_0006254
950 Ga0495648_0009797
951 Ga0495648_0012276
952 Ga0495648_0012288
953 Ga0495648_0017753
954 Ga0495648_0023719
955 Ga0495648_0023740
956 Ga0495648_0036988
957 Ga0495663_0002855
958 Ga0495663_0003293
959 Ga0495666_0001075
960 Ga0495666_0002585
961 Ga0495666_0006590
962 Ga0495666_0012104
963 Ga0495642_0005575
964 Ga0495642_0017008
965 Ga0495642_0024533
966 Ga0495642_0028310
967 Ga0495652_0010507
968 Ga0495652_0114881
969 Ga0495652_0255603
970 Ga0495652_0317994
971 Ga0495654_0000011
972 Ga0495654_0052378
973 Ga0495665_0008679
974 Ga0495665_0016089
975 Ga0495665_0060357
976 Ga0495640_0006014
977 Ga0495640_0020445
978 Ga0495586_0009365
979 Ga0495586_0064330
980 Ga0495586_0111034
981 Ga0495587_0012720
982 Ga0495587_0021846
983 Ga0495609_0000054
984 Ga0495609_0064812
985 Ga0495597_0000014
986 Ga0495597_0000362
987 Ga0495597_0043475
988 Ga0495597_0066839
989 Ga0495645_0001543
990 Ga0495645_0019470
991 Ga0495622_0000002
992 Ga0495622_0000018
993 Ga0495622_0001368
994 Ga0495633_0000041
995 Ga0495633_0000047
996 Ga0495633_0001049
997 Ga0495633_0001874
998 Ga0495633_0007614
999 Ga0495633_0039613
1000 Ga0495633_0159095
1001 Ga0495667_0021458
1002 Ga0495656_0008463
1003 Ga0495656_0121524
1004 Ga0495668_0000020
1005 Ga0495668_0000077
1006 Ga0495668_0000750
1007 Ga0495668_0002404
1008 Ga0495668_0019403
1009 Ga0495634_0034718
1010 Ga0495634_0047786
1011 Ga0495611_0003441
1012 Ga0495611_0003837
1013 Ga0495611_0009879
1014 Ga0495625_0000023
1015 Ga0495625_0000721
1016 Ga0495625_0003924
1017 Ga0495625_0009136
1018 Ga0495625_0059480
1019 Ga0495625_0082040
1020 Ga0495625_0085478
1021 Ga0495625_0097742
1022 Ga0495625_0407929
1023 Ga0495635_0001086
1024 Ga0495635_0001345
1025 Ga0495635_0198231
1026 Ga0495659_0000012
1027 Ga0495659_0000155
1028 Ga0495661_0023956
1029 Ga0495661_0025145
1030 Ga0495661_0042851
1031 Ga0495588_0048900
1032 Ga0495588_0051996
1033 Ga0495657_0057553
1034 Ga0495623_0007343
1035 Ga0495623_0086121
1036 Ga0495646_0002226
1037 Ga0495646_0005808
1038 Ga0495646_0010615
1039 Ga0495646_0041779
1040 Ga0495669_0003596
1041 Ga0495669_0035024
1042 Ga0495613_0000702
1043 Ga0495613_0014097
1044 Ga0495613_0019525
1045 Ga0495624_0001390
1046 Ga0495624_0007668
1047 Ga0495624_0037528
1048 Ga0495624_0043821
1049 Ga0495624_0070239
1050 Ga0495670_0004550
1051 Ga0495670_0022998
1052 Ga0495671_0000006
1053 Ga0495671_0000145
1054 Ga0495671_0018495
1055 Ga0495671_0028885
1056 Ga0495671_0071502
1057 Ga0495649_0002043
1058 Ga0495649_0003667
1059 Ga0495649_0008694
1060 Ga0495649_0037498
1061 Ga0495589_0006404
1062 Ga0495589_0008587
1063 Ga0495589_0051063
1064 Ga0495600_0010468
1065 Ga0495600_0094155
1066 Ga0495660_0001355
1067 Ga0495660_0007238
1068 Ga0495660_0016445
1069 Ga0495660_0067772
1070 Ga0495660_0105313
1071 Ga0495604_0034566
1072 Ga0495604_0046792
1073 Ga0495604_0061919
1074 Ga0495636_0001529
1075 Ga0495636_0003932
1076 Ga0495674_0003027
1077 Ga0495674_0068284
1078 Ga0495674_0108798
1079 Ga0495674_0168854
1080 Ga0495672_0000019
1081 Ga0495672_0000369
1082 Ga0495672_0002008
1083 Ga0495672_0002210
1084 Ga0495672_0003325
1085 Ga0495672_0003638
1086 Ga0495672_0036263
1087 Ga0495676_0016966
1088 Ga0495676_0042118
1089 Ga0495680_0015217
1090 Ga0495680_0023602
1091 Ga0495683_0080377
1092 Ga0495687_001155
1093 Ga0495687_008492
1094 Ga0495687_010933
1095 Ga0495687_022167
1096 Ga0495687_061619
1097 Ga0495675_0013857
1098 Ga0495677_0001723
1099 Ga0495677_0009011
1100 Ga0495677_0010710
1101 Ga0495679_000321
1102 Ga0495679_006469
1103 Ga0495679_008544
1104 Ga0495679_008890
1105 Ga0495685_000327
1106 Ga0495685_011991
1107 Ga0495685_061229
1108 Ga0495673_0000003
1109 Ga0495673_0000050
1110 Ga0495673_0000951
1111 Ga0495673_0003746
1112 Ga0495673_0004762
1113 Ga0495673_0086680
1114 Ga0495681_0021197
1115 Ga0495684_0029802
1116 Ga0495684_0196892
1117 Ga0495686_0000143
1118 Ga0495686_0000358
1119 Ga0495686_0000590
1120 Ga0495686_0002536
1121 Ga0495686_0004056
1122 Ga0495686_0005085
1123 Ga0495686_0024624
1124 Ga0495686_0040483
1125 Ga0495593_0011624
1126 Ga0495593_0026239
1127 Ga0495602_0012270
1128 Ga0495602_0190587
1129 Ga0495614_0009783
1130 Ga0495614_0019584
1131 Ga0495615_0000451
1132 Ga0495615_0050572
1133 Ga0496100_0081238
1134 Ga0496101_0000981
1135 Ga0496101_0013439
1136 Ga0496102_0022687
1137 Ga0496102_0032143
1138 Ga0496103_0004133
1139 Ga0496103_0031109
1140 Ga0496103_0198099
1141 Ga0496105_0005727
1142 Ga0496105_0095207
1143 Ga0496106_0074059
1144 Ga0496106_0110844
1145 Ga0496107_0000515
1146 Ga0496107_0172315
1147 Ga0496108_0398770
1148 Ga0496110_0002220
1149 Ga0496110_0024162
1150 Ga0496110_0234273
1151 Ga0496111_0036317
1152 Ga0496111_0217051
1153 Ga0496112_0137098
1154 Ga0496113_0323743
1155 Ga0496114_0011104
1156 Ga0496114_0019609
1157 Ga0496114_0028604
1158 Ga0496114_0069234
1159 Ga0496117_0038142
1160 Ga0496118_0000175
1161 Ga0496120_0147162
1162 Ga0496121_0000187
1163 Ga0496121_0002676
1164 Ga0496121_0015294
1165 Ga0496122_0000754
1166 Ga0496122_0016086
1167 Ga0496122_0018330
1168 Ga0496123_0000299
1169 Ga0496123_0002827
1170 Ga0496124_0093636
1171 Ga0496124_0140390
1172 Ga0496124_0146334
1173 Ga0496124_0233729
1174 Ga0496125_0007163
1175 Ga0496126_0000898
1176 Ga0496126_0001470
1177 Ga0496126_0011911
1178 Ga0495678_000630
1179 Ga0495678_001102
1180 Ga0495678_002129
1181 Ga0495682_0000239
1182 Ga0495682_0007290
1183 Ga0501033_0038492
1184 Ga0501043_0015056
1185 Ga0501249_006057
1186 Ga0501269_000550
1187 Ga0501044_0152070
1188 nmdc:mga03683_36280_c1
1189 nmdc:mga0k408_118719_c1
1190 nmdc:mga0k408_157818_c1
1191 nmdc:mga06z11_8010_c1
1192 nmdc:mga07m45_11641_c1
1193 nmdc:mga07m45_2701_c1
1194 nmdc:mga0sz30_3702_c1
1195 Ga0500578_0037027
1196 Ga0500644_0000132
1197 Ga0500644_0014342
1198 Ga0500650_0149548
1199 Ga0500593_018177
1200 Ga0500618_000024
1201 Ga0500618_000052
1202 Ga0500658_0004682
1203 Ga0500559_0001139
1204 Ga0500559_0016508
1205 Ga0500559_0034406
1206 Ga0500568_0008130
1207 Ga0500573_0097630
1208 Ga0500622_0011947
1209 Ga0500636_0003457
1210 Ga0500645_000911
1211 Ga0500645_010449
1212 Ga0500661_004366
1213 2600811155
1214 2509128869
1215 2511247274
1216 2513553327
1217 2513564219
1218 2515679823
1219 2516021945
1220 2527079846
1221 2585148730
1222 2599739269
1223 2644253001
1224 2644339332
1225 2644354937
1226 2738737901
1227 2738828369
1228 2738842114
1229 2739152165
1230 2739193814
1231 2739272972
1232 2739320561
1233 2739338531
1234 2739342016
1235 2746091421
1236 2746097315
1237 2819636049
1238 2821449952
1239 2842713359
1240 2842737026
1241 2842750273
1242 2857561455
1243 2857569833
1244 2857580690
1245 2883093585
1246 2885275138
1247 2902690237
1248 2904425341
1249 2904489454
1250 2919531824
1251 2928176524
1252 2928529316
1253 8003960700
1254 8018853211
1255 8021124505
1256 8055270546

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

1

59

0.97

PF03466

LysR_substrate

LysR substrate binding domain

83

290

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9492 1 87
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9454 1 87
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9376 1 87
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9361 1 86
5z4y-assembly1.cif.gz_B crystal structure of pacysb ntd domain with space group p4 0.9335 4 86
ID Description Score Start End Superfamily
af_P37682_6_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9782 4 87 1.10.10.10
af_P30864_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9711 4 85 1.10.10.10
3fzvC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9641 4 73 1.10.10.10
af_P67662_3_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9636 3 79 1.10.10.10
af_P27111_3_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9619 5 77 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y4T7C7-F1-model_v4 LysR family transcriptional regulator 0.9518 109 299 GO:0003700
GO:0006351
GO:0043565
AF-A0A850QN73-F1-model_v4 LysR family transcriptional regulator 0.9348 96 300 GO:0003700
GO:0006351
GO:0043565
AF-A0A1Q9QL98-F1-model_v4 deleted 0.9331 1 303
AF-A0A5C8BTK9-F1-model_v4 LysR family transcriptional regulator 0.9314 118 297 GO:0003700
GO:0006351
GO:0043565
AF-A0A850QN73-F1-model_v4 LysR family transcriptional regulator 0.9262 96 300 GO:0003700
GO:0006351
GO:0043565

Map